Basic Information | |
---|---|
Family ID | F002630 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 542 |
Average Sequence Length | 40 residues |
Representative Sequence | MRLRDPGLEYLKTDPLMDPLRKEPRFQAIERELKFPD |
Number of Associated Samples | 306 |
Number of Associated Scaffolds | 542 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 9.89 % |
% of genes near scaffold ends (potentially truncated) | 83.39 % |
% of genes from short scaffolds (< 2000 bps) | 86.72 % |
Associated GOLD sequencing projects | 278 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.317 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.229 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.085 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.214 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 542 Family Scaffolds |
---|---|---|
PF13676 | TIR_2 | 4.61 |
PF02371 | Transposase_20 | 1.66 |
PF07690 | MFS_1 | 1.66 |
PF13432 | TPR_16 | 1.11 |
PF00589 | Phage_integrase | 1.11 |
PF00144 | Beta-lactamase | 0.92 |
PF13561 | adh_short_C2 | 0.74 |
PF16658 | RF3_C | 0.74 |
PF01527 | HTH_Tnp_1 | 0.74 |
PF00561 | Abhydrolase_1 | 0.74 |
PF02586 | SRAP | 0.74 |
PF07969 | Amidohydro_3 | 0.74 |
PF14534 | DUF4440 | 0.74 |
PF13936 | HTH_38 | 0.74 |
PF03928 | HbpS-like | 0.74 |
PF08340 | DUF1732 | 0.74 |
PF00248 | Aldo_ket_red | 0.74 |
PF13302 | Acetyltransf_3 | 0.55 |
PF00239 | Resolvase | 0.55 |
PF01381 | HTH_3 | 0.55 |
PF13181 | TPR_8 | 0.55 |
PF00753 | Lactamase_B | 0.55 |
PF00106 | adh_short | 0.55 |
PF13419 | HAD_2 | 0.55 |
PF11937 | DUF3455 | 0.55 |
PF13356 | Arm-DNA-bind_3 | 0.37 |
PF13602 | ADH_zinc_N_2 | 0.37 |
PF13650 | Asp_protease_2 | 0.37 |
PF11927 | DUF3445 | 0.37 |
PF00857 | Isochorismatase | 0.37 |
PF13193 | AMP-binding_C | 0.37 |
PF03358 | FMN_red | 0.37 |
PF02567 | PhzC-PhzF | 0.37 |
PF12441 | CopG_antitoxin | 0.37 |
PF17170 | DUF5128 | 0.37 |
PF00378 | ECH_1 | 0.37 |
PF02411 | MerT | 0.37 |
PF00465 | Fe-ADH | 0.37 |
PF12697 | Abhydrolase_6 | 0.37 |
PF13489 | Methyltransf_23 | 0.37 |
PF00583 | Acetyltransf_1 | 0.37 |
PF00282 | Pyridoxal_deC | 0.37 |
PF00440 | TetR_N | 0.37 |
PF01546 | Peptidase_M20 | 0.37 |
PF04972 | BON | 0.37 |
PF11453 | DUF2950 | 0.37 |
PF01638 | HxlR | 0.37 |
PF01464 | SLT | 0.37 |
PF02604 | PhdYeFM_antitox | 0.37 |
PF00891 | Methyltransf_2 | 0.37 |
PF13211 | DUF4019 | 0.37 |
PF05598 | DUF772 | 0.37 |
PF08818 | DUF1801 | 0.37 |
PF00593 | TonB_dep_Rec | 0.37 |
PF00069 | Pkinase | 0.37 |
PF03466 | LysR_substrate | 0.37 |
PF13817 | DDE_Tnp_IS66_C | 0.37 |
PF13672 | PP2C_2 | 0.18 |
PF00196 | GerE | 0.18 |
PF01436 | NHL | 0.18 |
PF01979 | Amidohydro_1 | 0.18 |
PF02775 | TPP_enzyme_C | 0.18 |
PF13610 | DDE_Tnp_IS240 | 0.18 |
PF01209 | Ubie_methyltran | 0.18 |
PF02540 | NAD_synthase | 0.18 |
PF16691 | DUF5062 | 0.18 |
PF14067 | LssY_C | 0.18 |
PF08668 | HDOD | 0.18 |
PF02630 | SCO1-SenC | 0.18 |
PF00005 | ABC_tran | 0.18 |
PF02668 | TauD | 0.18 |
PF11455 | MazE-like | 0.18 |
PF13428 | TPR_14 | 0.18 |
PF14023 | DUF4239 | 0.18 |
PF13520 | AA_permease_2 | 0.18 |
PF01872 | RibD_C | 0.18 |
PF08241 | Methyltransf_11 | 0.18 |
PF01548 | DEDD_Tnp_IS110 | 0.18 |
PF07508 | Recombinase | 0.18 |
PF13977 | TetR_C_6 | 0.18 |
PF13411 | MerR_1 | 0.18 |
PF03693 | ParD_antitoxin | 0.18 |
PF13847 | Methyltransf_31 | 0.18 |
PF02852 | Pyr_redox_dim | 0.18 |
PF03703 | bPH_2 | 0.18 |
PF00078 | RVT_1 | 0.18 |
PF04542 | Sigma70_r2 | 0.18 |
PF05015 | HigB-like_toxin | 0.18 |
PF01402 | RHH_1 | 0.18 |
PF15937 | PrlF_antitoxin | 0.18 |
PF00890 | FAD_binding_2 | 0.18 |
PF02129 | Peptidase_S15 | 0.18 |
PF07995 | GSDH | 0.18 |
PF09925 | DUF2157 | 0.18 |
PF04828 | GFA | 0.18 |
PF02897 | Peptidase_S9_N | 0.18 |
PF13683 | rve_3 | 0.18 |
PF05345 | He_PIG | 0.18 |
PF13505 | OMP_b-brl | 0.18 |
PF06863 | DUF1254 | 0.18 |
PF02353 | CMAS | 0.18 |
PF16694 | Cytochrome_P460 | 0.18 |
PF00083 | Sugar_tr | 0.18 |
PF02254 | TrkA_N | 0.18 |
PF13924 | Lipocalin_5 | 0.18 |
PF06439 | 3keto-disac_hyd | 0.18 |
PF00459 | Inositol_P | 0.18 |
PF00717 | Peptidase_S24 | 0.18 |
PF01693 | Cauli_VI | 0.18 |
PF00072 | Response_reg | 0.18 |
PF14366 | DUF4410 | 0.18 |
PF06841 | Phage_T4_gp19 | 0.18 |
PF00293 | NUDIX | 0.18 |
PF13592 | HTH_33 | 0.18 |
PF12694 | cpYpsA | 0.18 |
PF08546 | ApbA_C | 0.18 |
PF00903 | Glyoxalase | 0.18 |
PF04452 | Methyltrans_RNA | 0.18 |
PF01738 | DLH | 0.18 |
PF07681 | DoxX | 0.18 |
PF07992 | Pyr_redox_2 | 0.18 |
PF04434 | SWIM | 0.18 |
PF03475 | 3-alpha | 0.18 |
PF07045 | DUF1330 | 0.18 |
PF00588 | SpoU_methylase | 0.18 |
PF02777 | Sod_Fe_C | 0.18 |
PF00654 | Voltage_CLC | 0.18 |
PF09286 | Pro-kuma_activ | 0.18 |
PF07298 | NnrU | 0.18 |
PF02687 | FtsX | 0.18 |
PF01923 | Cob_adeno_trans | 0.18 |
PF01988 | VIT1 | 0.18 |
PF08240 | ADH_N | 0.18 |
PF13343 | SBP_bac_6 | 0.18 |
PF01380 | SIS | 0.18 |
PF00126 | HTH_1 | 0.18 |
PF12973 | Cupin_7 | 0.18 |
PF12833 | HTH_18 | 0.18 |
PF11695 | DUF3291 | 0.18 |
PF13495 | Phage_int_SAM_4 | 0.18 |
PF06155 | GBBH-like_N | 0.18 |
PF01321 | Creatinase_N | 0.18 |
PF12802 | MarR_2 | 0.18 |
PF01163 | RIO1 | 0.18 |
PF04879 | Molybdop_Fe4S4 | 0.18 |
PF00892 | EamA | 0.18 |
PF02561 | FliS | 0.18 |
PF07978 | NIPSNAP | 0.18 |
PF01435 | Peptidase_M48 | 0.18 |
PF04191 | PEMT | 0.18 |
PF03237 | Terminase_6N | 0.18 |
PF00830 | Ribosomal_L28 | 0.18 |
PF06271 | RDD | 0.18 |
PF03550 | LolB | 0.18 |
PF13744 | HTH_37 | 0.18 |
PF10067 | DUF2306 | 0.18 |
PF12085 | DUF3562 | 0.18 |
PF13560 | HTH_31 | 0.18 |
PF08534 | Redoxin | 0.18 |
PF03352 | Adenine_glyco | 0.18 |
PF13751 | DDE_Tnp_1_6 | 0.18 |
PF08206 | OB_RNB | 0.18 |
PF02896 | PEP-utilizers_C | 0.18 |
PF13508 | Acetyltransf_7 | 0.18 |
PF02738 | MoCoBD_1 | 0.18 |
PF03330 | DPBB_1 | 0.18 |
PF04362 | Iron_traffic | 0.18 |
PF05960 | DUF885 | 0.18 |
PF10604 | Polyketide_cyc2 | 0.18 |
PF07366 | SnoaL | 0.18 |
PF14803 | Nudix_N_2 | 0.18 |
PF09411 | PagL | 0.18 |
PF07885 | Ion_trans_2 | 0.18 |
COG ID | Name | Functional Category | % Frequency in 542 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.85 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.48 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.92 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.92 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.92 |
COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.74 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.74 |
COG1516 | Flagellin-specific chaperone FliS | Cell motility [N] | 0.55 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.55 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.37 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.37 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.37 |
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.37 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.37 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.37 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.37 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.37 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.37 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.37 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.37 |
COG2924 | Fe-S cluster biosynthesis and repair protein YggX | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.37 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.37 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.37 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.18 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.18 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.18 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.18 |
COG0227 | Ribosomal protein L28 | Translation, ribosomal structure and biogenesis [J] | 0.18 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.18 |
COG0557 | Exoribonuclease R | Transcription [K] | 0.18 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.18 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.18 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.18 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.18 |
COG1158 | Transcription termination factor Rho | Transcription [K] | 0.18 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.18 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.18 |
COG1278 | Cold shock protein, CspA family | Transcription [K] | 0.18 |
COG1385 | 16S rRNA U1498 N3-methylase RsmE | Translation, ribosomal structure and biogenesis [J] | 0.18 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.18 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.18 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.18 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.18 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.18 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.18 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.18 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.18 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.18 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.18 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.18 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.18 |
COG2258 | N-hydroxylaminopurine reductase YiiM, contains MOSC domain | Defense mechanisms [V] | 0.18 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.18 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.18 |
COG3017 | Outer membrane lipoprotein LolB, involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.18 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.18 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.18 |
COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.18 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.18 |
COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.18 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.18 |
COG4094 | Uncharacterized membrane protein | Function unknown [S] | 0.18 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.18 |
COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.18 |
COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.18 |
COG4776 | Exoribonuclease II | Transcription [K] | 0.18 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.18 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.18 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.18 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.18 |
COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.18 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.18 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.69 % |
Unclassified | root | N/A | 15.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000651|AP72_2010_repI_A10DRAFT_1006682 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300001546|JGI12659J15293_10122306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
3300001593|JGI12635J15846_10583642 | Not Available | 651 | Open in IMG/M |
3300001661|JGI12053J15887_10095227 | Not Available | 1619 | Open in IMG/M |
3300001661|JGI12053J15887_10239701 | Not Available | 905 | Open in IMG/M |
3300004092|Ga0062389_100239307 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
3300004092|Ga0062389_102620172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
3300004633|Ga0066395_10209504 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300004633|Ga0066395_11000831 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300004635|Ga0062388_102571230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300005364|Ga0070673_101740321 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005434|Ga0070709_10876693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
3300005435|Ga0070714_102003005 | Not Available | 565 | Open in IMG/M |
3300005436|Ga0070713_101488523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
3300005439|Ga0070711_101168588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 665 | Open in IMG/M |
3300005526|Ga0073909_10507115 | Not Available | 584 | Open in IMG/M |
3300005533|Ga0070734_10050580 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
3300005538|Ga0070731_10670856 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005541|Ga0070733_10506257 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300005561|Ga0066699_10015012 | Not Available | 4049 | Open in IMG/M |
3300005610|Ga0070763_10186468 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300005614|Ga0068856_100535409 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300005614|Ga0068856_100616889 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300005712|Ga0070764_10107560 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300005712|Ga0070764_10841314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300005718|Ga0068866_10973921 | Not Available | 601 | Open in IMG/M |
3300005764|Ga0066903_100782015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1703 | Open in IMG/M |
3300005764|Ga0066903_103084450 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300005764|Ga0066903_107296812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sandarakinorhabdus → unclassified Sandarakinorhabdus → Sandarakinorhabdus sp. AAP62 | 572 | Open in IMG/M |
3300005843|Ga0068860_101392013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 723 | Open in IMG/M |
3300005921|Ga0070766_10911422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingosinicellaceae → Sandarakinorhabdus → unclassified Sandarakinorhabdus → Sandarakinorhabdus sp. AAP62 | 602 | Open in IMG/M |
3300005993|Ga0080027_10152484 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300005993|Ga0080027_10318871 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300005995|Ga0066790_10073583 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
3300006041|Ga0075023_100438401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
3300006047|Ga0075024_100248269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
3300006050|Ga0075028_100101734 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1467 | Open in IMG/M |
3300006163|Ga0070715_10030227 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
3300006173|Ga0070716_101593177 | Not Available | 536 | Open in IMG/M |
3300006175|Ga0070712_100605703 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300006755|Ga0079222_10238396 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300006797|Ga0066659_10076692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2204 | Open in IMG/M |
3300009174|Ga0105241_12504496 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300009553|Ga0105249_10581316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1173 | Open in IMG/M |
3300009635|Ga0116117_1213293 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300009649|Ga0105855_1121570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
3300009759|Ga0116101_1154977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300009784|Ga0123357_10726260 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300009787|Ga0116226_10031911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5202 | Open in IMG/M |
3300009787|Ga0116226_10471206 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
3300009792|Ga0126374_10027156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2620 | Open in IMG/M |
3300009792|Ga0126374_10234573 | Not Available | 1186 | Open in IMG/M |
3300009792|Ga0126374_10538875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 849 | Open in IMG/M |
3300009792|Ga0126374_11352233 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300009826|Ga0123355_10153673 | All Organisms → cellular organisms → Bacteria | 3488 | Open in IMG/M |
3300009826|Ga0123355_12068381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 525 | Open in IMG/M |
3300010043|Ga0126380_10255550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1216 | Open in IMG/M |
3300010043|Ga0126380_11280339 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300010043|Ga0126380_11958454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300010046|Ga0126384_11733392 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300010048|Ga0126373_10194512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 1961 | Open in IMG/M |
3300010048|Ga0126373_10297627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1608 | Open in IMG/M |
3300010048|Ga0126373_10567319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1184 | Open in IMG/M |
3300010048|Ga0126373_10750799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1036 | Open in IMG/M |
3300010048|Ga0126373_11065706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
3300010048|Ga0126373_11300633 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300010048|Ga0126373_11433802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
3300010048|Ga0126373_11871839 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300010048|Ga0126373_12895201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300010048|Ga0126373_13186428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300010048|Ga0126373_13200316 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300010048|Ga0126373_13262203 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300010049|Ga0123356_10296558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1720 | Open in IMG/M |
3300010320|Ga0134109_10172322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
3300010320|Ga0134109_10424629 | Not Available | 536 | Open in IMG/M |
3300010321|Ga0134067_10038898 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300010326|Ga0134065_10066826 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300010358|Ga0126370_10552003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
3300010358|Ga0126370_11765776 | Not Available | 597 | Open in IMG/M |
3300010358|Ga0126370_11809181 | Not Available | 591 | Open in IMG/M |
3300010359|Ga0126376_10403634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 1232 | Open in IMG/M |
3300010359|Ga0126376_11776323 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300010360|Ga0126372_12929305 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300010361|Ga0126378_10105843 | All Organisms → cellular organisms → Bacteria | 2787 | Open in IMG/M |
3300010361|Ga0126378_11591172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 742 | Open in IMG/M |
3300010361|Ga0126378_12196374 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300010361|Ga0126378_12310189 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300010366|Ga0126379_10342731 | Not Available | 1521 | Open in IMG/M |
3300010366|Ga0126379_10431374 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
3300010366|Ga0126379_10832843 | Not Available | 1023 | Open in IMG/M |
3300010366|Ga0126379_13812572 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300010373|Ga0134128_10673118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces olivaceus | 1150 | Open in IMG/M |
3300010376|Ga0126381_100224199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2529 | Open in IMG/M |
3300010376|Ga0126381_100582066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1590 | Open in IMG/M |
3300010376|Ga0126381_100615247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1547 | Open in IMG/M |
3300010376|Ga0126381_100694402 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300010376|Ga0126381_100969400 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300010376|Ga0126381_101267629 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300010376|Ga0126381_101270248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1064 | Open in IMG/M |
3300010376|Ga0126381_101755205 | Not Available | 896 | Open in IMG/M |
3300010376|Ga0126381_101786457 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300010376|Ga0126381_101793991 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 886 | Open in IMG/M |
3300010376|Ga0126381_103090779 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300010376|Ga0126381_103156192 | Not Available | 652 | Open in IMG/M |
3300010376|Ga0126381_103225990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
3300010376|Ga0126381_103273281 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300010376|Ga0126381_104872567 | Not Available | 516 | Open in IMG/M |
3300010398|Ga0126383_10369637 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300010398|Ga0126383_10482980 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1294 | Open in IMG/M |
3300010398|Ga0126383_10749272 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300010398|Ga0126383_11175861 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300010398|Ga0126383_11427709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 782 | Open in IMG/M |
3300010398|Ga0126383_12167949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Allosphingosinicella → Allosphingosinicella indica | 642 | Open in IMG/M |
3300010398|Ga0126383_12812077 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300010400|Ga0134122_11959917 | Not Available | 623 | Open in IMG/M |
3300010869|Ga0126359_1206469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
3300012202|Ga0137363_10221239 | Not Available | 1528 | Open in IMG/M |
3300012285|Ga0137370_10158547 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300012285|Ga0137370_10944199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 532 | Open in IMG/M |
3300012683|Ga0137398_10826280 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012923|Ga0137359_10191024 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
3300012925|Ga0137419_10422796 | Not Available | 1045 | Open in IMG/M |
3300012929|Ga0137404_10010731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6333 | Open in IMG/M |
3300012948|Ga0126375_10653983 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 811 | Open in IMG/M |
3300012948|Ga0126375_10865449 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300012961|Ga0164302_11761539 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300012971|Ga0126369_10214400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1868 | Open in IMG/M |
3300012971|Ga0126369_13389187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 522 | Open in IMG/M |
3300012989|Ga0164305_10028863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3013 | Open in IMG/M |
3300012989|Ga0164305_10429225 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300013297|Ga0157378_10327822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1489 | Open in IMG/M |
3300013306|Ga0163162_11146692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
3300014164|Ga0181532_10245538 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300014169|Ga0181531_10452009 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300014201|Ga0181537_10436991 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300014495|Ga0182015_10112601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1878 | Open in IMG/M |
3300014495|Ga0182015_10169503 | Not Available | 1475 | Open in IMG/M |
3300014501|Ga0182024_10415472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1735 | Open in IMG/M |
3300014501|Ga0182024_11386587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
3300014654|Ga0181525_10472355 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300014657|Ga0181522_10230310 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300014658|Ga0181519_11043452 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300014969|Ga0157376_12314347 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300015087|Ga0167637_1046289 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300015242|Ga0137412_10661101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300015264|Ga0137403_11527517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300015371|Ga0132258_10629531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 2696 | Open in IMG/M |
3300015371|Ga0132258_11350464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1801 | Open in IMG/M |
3300015374|Ga0132255_100298403 | Not Available | 2318 | Open in IMG/M |
3300016294|Ga0182041_10039392 | All Organisms → cellular organisms → Bacteria | 3108 | Open in IMG/M |
3300016294|Ga0182041_10295447 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300016294|Ga0182041_11061660 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300016294|Ga0182041_11266048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300016294|Ga0182041_11348812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
3300016294|Ga0182041_11827428 | Not Available | 564 | Open in IMG/M |
3300016294|Ga0182041_12184675 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300016294|Ga0182041_12221321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
3300016319|Ga0182033_10358197 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300016319|Ga0182033_10364490 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300016319|Ga0182033_10398599 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300016319|Ga0182033_10998556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
3300016319|Ga0182033_11927962 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300016341|Ga0182035_10288430 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
3300016341|Ga0182035_12172737 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300016357|Ga0182032_10265660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 1341 | Open in IMG/M |
3300016357|Ga0182032_10977125 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300016357|Ga0182032_11144647 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300016357|Ga0182032_11569954 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300016371|Ga0182034_11179941 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300016371|Ga0182034_11980334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300016387|Ga0182040_10519250 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300016387|Ga0182040_10963483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d | 710 | Open in IMG/M |
3300016404|Ga0182037_10208601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1520 | Open in IMG/M |
3300016404|Ga0182037_10520005 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300016404|Ga0182037_11941137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 528 | Open in IMG/M |
3300016404|Ga0182037_12002993 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300016422|Ga0182039_10174555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1690 | Open in IMG/M |
3300016422|Ga0182039_10222576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1520 | Open in IMG/M |
3300016422|Ga0182039_10354394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 1233 | Open in IMG/M |
3300016422|Ga0182039_11170238 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300016422|Ga0182039_11243158 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300016422|Ga0182039_11372782 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300016422|Ga0182039_11482646 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300016445|Ga0182038_11359244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300016445|Ga0182038_11885577 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300017927|Ga0187824_10071012 | Not Available | 1093 | Open in IMG/M |
3300017936|Ga0187821_10034956 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1780 | Open in IMG/M |
3300017948|Ga0187847_10532637 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300017959|Ga0187779_10102418 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300017961|Ga0187778_10004129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9623 | Open in IMG/M |
3300017961|Ga0187778_10066548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2209 | Open in IMG/M |
3300017961|Ga0187778_10877573 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300017970|Ga0187783_10021995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4713 | Open in IMG/M |
3300017970|Ga0187783_10025380 | All Organisms → cellular organisms → Bacteria | 4388 | Open in IMG/M |
3300017970|Ga0187783_10036040 | All Organisms → cellular organisms → Bacteria | 3664 | Open in IMG/M |
3300017970|Ga0187783_10196337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1483 | Open in IMG/M |
3300017970|Ga0187783_10257002 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1277 | Open in IMG/M |
3300017972|Ga0187781_10137610 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
3300017972|Ga0187781_10960700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Micropepsales → Micropepsaceae → Rhizomicrobium → Rhizomicrobium palustre | 624 | Open in IMG/M |
3300017972|Ga0187781_11213656 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300017973|Ga0187780_10010987 | All Organisms → cellular organisms → Bacteria | 6676 | Open in IMG/M |
3300017975|Ga0187782_11450155 | Not Available | 540 | Open in IMG/M |
3300018034|Ga0187863_10147146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1315 | Open in IMG/M |
3300018058|Ga0187766_10096789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1785 | Open in IMG/M |
3300018058|Ga0187766_11302252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
3300018060|Ga0187765_10792735 | Not Available | 631 | Open in IMG/M |
3300018062|Ga0187784_10671402 | Not Available | 830 | Open in IMG/M |
3300018085|Ga0187772_10174939 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300018085|Ga0187772_10454840 | Not Available | 898 | Open in IMG/M |
3300018086|Ga0187769_10681542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Denitratisoma | 777 | Open in IMG/M |
3300019786|Ga0182025_1325679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1535 | Open in IMG/M |
3300020170|Ga0179594_10173816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 802 | Open in IMG/M |
3300020580|Ga0210403_11019855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300020581|Ga0210399_10396265 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300020582|Ga0210395_10491491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 923 | Open in IMG/M |
3300020583|Ga0210401_10132097 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
3300020583|Ga0210401_10893080 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300021088|Ga0210404_10267750 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300021168|Ga0210406_10153779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Planktotalea → Planktotalea frisia | 1930 | Open in IMG/M |
3300021168|Ga0210406_11093970 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300021181|Ga0210388_10487715 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300021372|Ga0213877_10204187 | Not Available | 643 | Open in IMG/M |
3300021377|Ga0213874_10086371 | Not Available | 1024 | Open in IMG/M |
3300021402|Ga0210385_10461559 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300021403|Ga0210397_11526733 | Not Available | 518 | Open in IMG/M |
3300021404|Ga0210389_10360177 | Not Available | 1143 | Open in IMG/M |
3300021407|Ga0210383_10402658 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300021407|Ga0210383_11003282 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300021420|Ga0210394_10954848 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300021433|Ga0210391_11271636 | Not Available | 568 | Open in IMG/M |
3300021474|Ga0210390_10298186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1365 | Open in IMG/M |
3300021474|Ga0210390_10854598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium | 751 | Open in IMG/M |
3300021474|Ga0210390_10953131 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300021475|Ga0210392_10626679 | Not Available | 799 | Open in IMG/M |
3300021476|Ga0187846_10234693 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300021477|Ga0210398_10607434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
3300021477|Ga0210398_10778672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300021477|Ga0210398_10884127 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300021477|Ga0210398_11084235 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300021478|Ga0210402_10086203 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
3300021479|Ga0210410_10262448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1549 | Open in IMG/M |
3300021479|Ga0210410_11766252 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300021559|Ga0210409_11277321 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300021560|Ga0126371_10067364 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
3300021560|Ga0126371_10414967 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
3300021560|Ga0126371_10809641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1083 | Open in IMG/M |
3300021560|Ga0126371_11620385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
3300021560|Ga0126371_12855410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300021560|Ga0126371_13045714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 567 | Open in IMG/M |
3300021953|Ga0213880_10088768 | Not Available | 797 | Open in IMG/M |
3300022533|Ga0242662_10041849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 1150 | Open in IMG/M |
3300022840|Ga0224549_1012015 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300022840|Ga0224549_1053414 | Not Available | 551 | Open in IMG/M |
3300024271|Ga0224564_1054016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
3300024310|Ga0247681_1058689 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300024330|Ga0137417_1404866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2097 | Open in IMG/M |
3300025915|Ga0207693_10519275 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300025924|Ga0207694_10658377 | Not Available | 882 | Open in IMG/M |
3300025928|Ga0207700_10185069 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
3300025928|Ga0207700_11222686 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300025931|Ga0207644_10066591 | All Organisms → cellular organisms → Bacteria | 2623 | Open in IMG/M |
3300025936|Ga0207670_10836294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
3300025939|Ga0207665_11305195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300025942|Ga0207689_11186705 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300026078|Ga0207702_10161695 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
3300026317|Ga0209154_1002993 | All Organisms → cellular organisms → Bacteria | 9286 | Open in IMG/M |
3300026335|Ga0209804_1280402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 580 | Open in IMG/M |
3300027432|Ga0209421_1006863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2133 | Open in IMG/M |
3300027565|Ga0209219_1017380 | Not Available | 1737 | Open in IMG/M |
3300027610|Ga0209528_1002424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3832 | Open in IMG/M |
3300027633|Ga0208988_1103614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300027703|Ga0207862_1025535 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
3300027737|Ga0209038_10092657 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300027853|Ga0209274_10079316 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
3300027855|Ga0209693_10033278 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
3300027869|Ga0209579_10316011 | Not Available | 843 | Open in IMG/M |
3300027869|Ga0209579_10605815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 594 | Open in IMG/M |
3300027879|Ga0209169_10651103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 548 | Open in IMG/M |
3300027889|Ga0209380_10514594 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300027895|Ga0209624_10773728 | Not Available | 631 | Open in IMG/M |
3300027908|Ga0209006_11100272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 627 | Open in IMG/M |
3300027910|Ga0209583_10028318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1840 | Open in IMG/M |
3300028731|Ga0302301_1116949 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300028747|Ga0302219_10112075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1034 | Open in IMG/M |
3300028773|Ga0302234_10102521 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300028773|Ga0302234_10348063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 635 | Open in IMG/M |
3300028775|Ga0302231_10073207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1431 | Open in IMG/M |
3300028780|Ga0302225_10231889 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300028789|Ga0302232_10534073 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300028789|Ga0302232_10539415 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300028801|Ga0302226_10053822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1901 | Open in IMG/M |
3300028801|Ga0302226_10287238 | Not Available | 694 | Open in IMG/M |
3300028871|Ga0302230_10300880 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300029200|Ga0120082_1015705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium | 867 | Open in IMG/M |
3300029701|Ga0222748_1013301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 1105 | Open in IMG/M |
3300029910|Ga0311369_10422015 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300029914|Ga0311359_11046436 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300029916|Ga0302148_1059176 | Not Available | 1095 | Open in IMG/M |
3300029943|Ga0311340_10087086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3499 | Open in IMG/M |
3300029943|Ga0311340_11526442 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300029944|Ga0311352_10164045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1915 | Open in IMG/M |
3300029951|Ga0311371_11205493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
3300029951|Ga0311371_11650356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 703 | Open in IMG/M |
3300029997|Ga0302302_1270446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 620 | Open in IMG/M |
3300029999|Ga0311339_10095589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3695 | Open in IMG/M |
3300029999|Ga0311339_10722918 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300030013|Ga0302178_10150247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1154 | Open in IMG/M |
3300030020|Ga0311344_11172250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 582 | Open in IMG/M |
3300030054|Ga0302182_10193731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
3300030056|Ga0302181_10306472 | Not Available | 704 | Open in IMG/M |
3300030056|Ga0302181_10373165 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300030057|Ga0302176_10043733 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
3300030058|Ga0302179_10069689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1564 | Open in IMG/M |
3300030399|Ga0311353_11112295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 656 | Open in IMG/M |
3300030490|Ga0302184_10131205 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300030490|Ga0302184_10203390 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300030503|Ga0311370_10012348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13428 | Open in IMG/M |
3300030503|Ga0311370_10715670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
3300030503|Ga0311370_12318844 | Not Available | 523 | Open in IMG/M |
3300030520|Ga0311372_10172338 | All Organisms → cellular organisms → Bacteria | 3689 | Open in IMG/M |
3300030524|Ga0311357_10138951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2409 | Open in IMG/M |
3300030580|Ga0311355_10092670 | All Organisms → cellular organisms → Bacteria | 3385 | Open in IMG/M |
3300030618|Ga0311354_10920293 | Not Available | 813 | Open in IMG/M |
3300030646|Ga0302316_10058405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1714 | Open in IMG/M |
3300030687|Ga0302309_10124214 | Not Available | 1370 | Open in IMG/M |
3300030693|Ga0302313_10046030 | Not Available | 1944 | Open in IMG/M |
3300030746|Ga0302312_10014409 | All Organisms → cellular organisms → Bacteria | 4023 | Open in IMG/M |
3300030906|Ga0302314_10248301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2117 | Open in IMG/M |
3300031027|Ga0302308_10398710 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300031027|Ga0302308_10579095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 650 | Open in IMG/M |
3300031231|Ga0170824_110620100 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300031233|Ga0302307_10072736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1810 | Open in IMG/M |
3300031233|Ga0302307_10146451 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300031234|Ga0302325_10212296 | All Organisms → cellular organisms → Bacteria | 3306 | Open in IMG/M |
3300031236|Ga0302324_100012801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17084 | Open in IMG/M |
3300031236|Ga0302324_100025859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11240 | Open in IMG/M |
3300031236|Ga0302324_100709968 | Not Available | 1417 | Open in IMG/M |
3300031236|Ga0302324_101124390 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300031258|Ga0302318_10501943 | Not Available | 615 | Open in IMG/M |
3300031474|Ga0170818_107202307 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
3300031524|Ga0302320_10330538 | Not Available | 1990 | Open in IMG/M |
3300031524|Ga0302320_10401563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1728 | Open in IMG/M |
3300031524|Ga0302320_11140157 | Not Available | 807 | Open in IMG/M |
3300031525|Ga0302326_11462949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
3300031525|Ga0302326_12367533 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300031525|Ga0302326_13008802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300031543|Ga0318516_10117512 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea | 1514 | Open in IMG/M |
3300031543|Ga0318516_10272065 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300031543|Ga0318516_10728178 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300031543|Ga0318516_10863395 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300031544|Ga0318534_10096307 | Not Available | 1692 | Open in IMG/M |
3300031545|Ga0318541_10023248 | All Organisms → cellular organisms → Bacteria | 2993 | Open in IMG/M |
3300031545|Ga0318541_10636389 | Not Available | 596 | Open in IMG/M |
3300031546|Ga0318538_10707413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300031561|Ga0318528_10083305 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae | 1662 | Open in IMG/M |
3300031564|Ga0318573_10177708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
3300031564|Ga0318573_10216699 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300031572|Ga0318515_10395990 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300031573|Ga0310915_11186444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300031573|Ga0310915_11207504 | Not Available | 523 | Open in IMG/M |
3300031668|Ga0318542_10057946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1780 | Open in IMG/M |
3300031668|Ga0318542_10746184 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031679|Ga0318561_10050625 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
3300031679|Ga0318561_10799937 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300031680|Ga0318574_10398586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 804 | Open in IMG/M |
3300031681|Ga0318572_10400450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 816 | Open in IMG/M |
3300031681|Ga0318572_10713812 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300031682|Ga0318560_10012612 | All Organisms → cellular organisms → Bacteria | 3686 | Open in IMG/M |
3300031708|Ga0310686_100126146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 2047 | Open in IMG/M |
3300031708|Ga0310686_109096890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
3300031708|Ga0310686_112401623 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300031715|Ga0307476_10673719 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300031715|Ga0307476_10856934 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300031718|Ga0307474_10132725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. FDAARGOS 1247 | 1873 | Open in IMG/M |
3300031719|Ga0306917_10026526 | All Organisms → cellular organisms → Bacteria | 3662 | Open in IMG/M |
3300031719|Ga0306917_10527360 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300031719|Ga0306917_10806692 | Not Available | 736 | Open in IMG/M |
3300031719|Ga0306917_11366879 | Not Available | 547 | Open in IMG/M |
3300031720|Ga0307469_10135595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1812 | Open in IMG/M |
3300031723|Ga0318493_10329482 | Not Available | 828 | Open in IMG/M |
3300031723|Ga0318493_10622282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
3300031724|Ga0318500_10380768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
3300031724|Ga0318500_10406937 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300031736|Ga0318501_10162104 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300031736|Ga0318501_10230530 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300031736|Ga0318501_10744605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 541 | Open in IMG/M |
3300031744|Ga0306918_10660615 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300031744|Ga0306918_10909246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 685 | Open in IMG/M |
3300031751|Ga0318494_10139585 | Not Available | 1360 | Open in IMG/M |
3300031753|Ga0307477_10161365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1563 | Open in IMG/M |
3300031753|Ga0307477_11058072 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300031754|Ga0307475_11281931 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300031763|Ga0318537_10127251 | Not Available | 947 | Open in IMG/M |
3300031763|Ga0318537_10241066 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300031763|Ga0318537_10289045 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300031768|Ga0318509_10272498 | Not Available | 946 | Open in IMG/M |
3300031768|Ga0318509_10462309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 710 | Open in IMG/M |
3300031770|Ga0318521_10787245 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300031770|Ga0318521_10882732 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300031771|Ga0318546_10180412 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
3300031771|Ga0318546_10610232 | Not Available | 767 | Open in IMG/M |
3300031771|Ga0318546_11208714 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300031777|Ga0318543_10022421 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
3300031777|Ga0318543_10298626 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300031777|Ga0318543_10542192 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300031780|Ga0318508_1039024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1229 | Open in IMG/M |
3300031781|Ga0318547_10235779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1100 | Open in IMG/M |
3300031781|Ga0318547_10705619 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300031782|Ga0318552_10119723 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300031782|Ga0318552_10329743 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300031782|Ga0318552_10726097 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031792|Ga0318529_10060484 | Not Available | 1653 | Open in IMG/M |
3300031795|Ga0318557_10212501 | Not Available | 884 | Open in IMG/M |
3300031795|Ga0318557_10475342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
3300031796|Ga0318576_10400546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 649 | Open in IMG/M |
3300031797|Ga0318550_10213437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 935 | Open in IMG/M |
3300031798|Ga0318523_10458568 | Not Available | 632 | Open in IMG/M |
3300031798|Ga0318523_10572055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 557 | Open in IMG/M |
3300031819|Ga0318568_10403483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 852 | Open in IMG/M |
3300031831|Ga0318564_10304505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas | 703 | Open in IMG/M |
3300031833|Ga0310917_10484934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 841 | Open in IMG/M |
3300031835|Ga0318517_10326432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
3300031837|Ga0302315_10103865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1838 | Open in IMG/M |
3300031837|Ga0302315_10334732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 859 | Open in IMG/M |
3300031879|Ga0306919_10260831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1306 | Open in IMG/M |
3300031879|Ga0306919_10852275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 699 | Open in IMG/M |
3300031879|Ga0306919_11254491 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300031880|Ga0318544_10353568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
3300031890|Ga0306925_10491254 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300031890|Ga0306925_10621754 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300031890|Ga0306925_11155700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
3300031890|Ga0306925_11380562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 696 | Open in IMG/M |
3300031890|Ga0306925_11559488 | Not Available | 644 | Open in IMG/M |
3300031896|Ga0318551_10008121 | All Organisms → cellular organisms → Bacteria | 4409 | Open in IMG/M |
3300031897|Ga0318520_10147161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1363 | Open in IMG/M |
3300031897|Ga0318520_10994289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
3300031897|Ga0318520_10997476 | Not Available | 529 | Open in IMG/M |
3300031897|Ga0318520_11095025 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300031910|Ga0306923_10252524 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
3300031910|Ga0306923_10344259 | Not Available | 1700 | Open in IMG/M |
3300031910|Ga0306923_10396420 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
3300031910|Ga0306923_11656072 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 663 | Open in IMG/M |
3300031910|Ga0306923_11957782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 596 | Open in IMG/M |
3300031912|Ga0306921_10157669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2657 | Open in IMG/M |
3300031912|Ga0306921_10232044 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
3300031912|Ga0306921_10475580 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300031941|Ga0310912_10901033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter soli | 681 | Open in IMG/M |
3300031942|Ga0310916_10078317 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
3300031942|Ga0310916_10210263 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
3300031942|Ga0310916_10833560 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300031942|Ga0310916_11574367 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300031945|Ga0310913_10315165 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300031945|Ga0310913_10376280 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300031945|Ga0310913_11006227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
3300031946|Ga0310910_11224059 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300031946|Ga0310910_11395727 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300031946|Ga0310910_11416055 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031947|Ga0310909_11128707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300031954|Ga0306926_10056281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4719 | Open in IMG/M |
3300031954|Ga0306926_10094716 | All Organisms → cellular organisms → Bacteria | 3653 | Open in IMG/M |
3300031954|Ga0306926_10628160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1309 | Open in IMG/M |
3300031954|Ga0306926_10679784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1250 | Open in IMG/M |
3300031954|Ga0306926_11640968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
3300031959|Ga0318530_10149049 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300031962|Ga0307479_12075736 | Not Available | 516 | Open in IMG/M |
3300031981|Ga0318531_10159253 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300031981|Ga0318531_10351398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
3300032001|Ga0306922_10111605 | Not Available | 2901 | Open in IMG/M |
3300032001|Ga0306922_10162227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2393 | Open in IMG/M |
3300032001|Ga0306922_11190627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Pandoraea → Pandoraea terrae | 776 | Open in IMG/M |
3300032001|Ga0306922_11351677 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300032008|Ga0318562_10706963 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300032009|Ga0318563_10678421 | Not Available | 554 | Open in IMG/M |
3300032009|Ga0318563_10731603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 531 | Open in IMG/M |
3300032010|Ga0318569_10345538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
3300032010|Ga0318569_10429609 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300032035|Ga0310911_10186652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1176 | Open in IMG/M |
3300032035|Ga0310911_10354642 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300032035|Ga0310911_10540182 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300032035|Ga0310911_10552447 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300032041|Ga0318549_10251055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 796 | Open in IMG/M |
3300032041|Ga0318549_10551288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 518 | Open in IMG/M |
3300032044|Ga0318558_10169588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1057 | Open in IMG/M |
3300032052|Ga0318506_10104088 | Not Available | 1215 | Open in IMG/M |
3300032054|Ga0318570_10416344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300032054|Ga0318570_10584394 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300032055|Ga0318575_10184786 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300032059|Ga0318533_10521061 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300032059|Ga0318533_10946337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
3300032060|Ga0318505_10600484 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
3300032065|Ga0318513_10517141 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300032066|Ga0318514_10790394 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
3300032067|Ga0318524_10175347 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300032067|Ga0318524_10339909 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 779 | Open in IMG/M |
3300032068|Ga0318553_10113879 | Not Available | 1386 | Open in IMG/M |
3300032068|Ga0318553_10458335 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300032076|Ga0306924_10171399 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
3300032076|Ga0306924_11641844 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300032076|Ga0306924_11827241 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300032089|Ga0318525_10066021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
3300032089|Ga0318525_10607965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
3300032090|Ga0318518_10039107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2212 | Open in IMG/M |
3300032090|Ga0318518_10100719 | Not Available | 1441 | Open in IMG/M |
3300032091|Ga0318577_10078760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1520 | Open in IMG/M |
3300032091|Ga0318577_10472349 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300032091|Ga0318577_10554294 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300032094|Ga0318540_10383188 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300032094|Ga0318540_10625767 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300032180|Ga0307471_100675833 | Not Available | 1196 | Open in IMG/M |
3300032205|Ga0307472_102671779 | Not Available | 510 | Open in IMG/M |
3300032261|Ga0306920_100004673 | All Organisms → cellular organisms → Bacteria | 17577 | Open in IMG/M |
3300032261|Ga0306920_100041463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 6657 | Open in IMG/M |
3300032261|Ga0306920_100725130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_02_FULL_57_36 | 1464 | Open in IMG/M |
3300032261|Ga0306920_101126895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 1137 | Open in IMG/M |
3300032261|Ga0306920_101919632 | Not Available | 832 | Open in IMG/M |
3300032261|Ga0306920_102554362 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300032261|Ga0306920_102793009 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300032261|Ga0306920_104296681 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300032783|Ga0335079_10033640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5885 | Open in IMG/M |
3300032783|Ga0335079_11244901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 746 | Open in IMG/M |
3300032805|Ga0335078_10176784 | All Organisms → cellular organisms → Bacteria | 2991 | Open in IMG/M |
3300032828|Ga0335080_10109733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3063 | Open in IMG/M |
3300032892|Ga0335081_12230421 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300032955|Ga0335076_11252966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 626 | Open in IMG/M |
3300033158|Ga0335077_10737277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1010 | Open in IMG/M |
3300033158|Ga0335077_12147861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → gamma proteobacterium NOR5-3 | 514 | Open in IMG/M |
3300033289|Ga0310914_10859617 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300033289|Ga0310914_11006041 | Not Available | 734 | Open in IMG/M |
3300033290|Ga0318519_10018784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3045 | Open in IMG/M |
3300033290|Ga0318519_10091887 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300033290|Ga0318519_10489016 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300033828|Ga0334850_077241 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300033829|Ga0334854_001814 | All Organisms → cellular organisms → Bacteria | 5174 | Open in IMG/M |
3300034163|Ga0370515_0347067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
3300034199|Ga0370514_006814 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
3300034199|Ga0370514_140363 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.36% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.15% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.87% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.29% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.29% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.48% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.48% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.11% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.11% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.55% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.55% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
Biofilm | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm | 0.18% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.18% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.18% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.18% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.18% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.18% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.18% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.18% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.18% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.18% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.18% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.18% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.18% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.74% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.74% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.37% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.37% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.37% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.37% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.37% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.37% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.37% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.37% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Host-Associated | Open in IMG/M |
3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300029200 | Biofilm microbial communities from University of Hong Kong - Biofilm | Environmental | Open in IMG/M |
3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AP72_2010_repI_A10DRAFT_10066822 | 3300000651 | Forest Soil | DTARRVGDSGLIFLKTDPLLDPLRTQSRFQAIERALKFPN* |
JGI12659J15293_101223061 | 3300001546 | Forest Soil | LETALRLRDPGLENLKTVPLLDPLRKEPRFQAIERELKFP* |
JGI12635J15846_105836421 | 3300001593 | Forest Soil | SLRSLDVAVRLHDSGLVLLKVDPLLDPVRKEPRFQAIERELKFPMD* |
JGI12053J15887_100952272 | 3300001661 | Forest Soil | MGHPLQLRDPGLEYLKIDPLVDPLRKEPRFQAIERELKFPS* |
JGI12053J15887_102397011 | 3300001661 | Forest Soil | GDRAKALEWLDVAMRLRDPGLENLKTEPFFDPLRKELRFKAIERELKFPTD* |
Ga0062389_1002393072 | 3300004092 | Bog Forest Soil | MLWSNTSRRLREPGLAIFGVDPLLDPLRQDPRFKNIERELKFPD* |
Ga0062389_1026201722 | 3300004092 | Bog Forest Soil | WLETALRLRDTGLAILRVDPLLDPIRREPRFQAIERALKFPN* |
Ga0066395_102095042 | 3300004633 | Tropical Forest Soil | MGRRTQARGWLDTAKRLCDPGLVFLKADALMDPLRKEPRFQAIARELKSPD* |
Ga0066395_110008311 | 3300004633 | Tropical Forest Soil | EWLETVMRLRSGLGELKIDPHMDPVRNEPRLEAVMRELKFPQ* |
Ga0062388_1025712302 | 3300004635 | Bog Forest Soil | LAMRLRDPGLVLLKTDPLMDPLRNEPRFQAIERQLKFPS* |
Ga0070673_1017403211 | 3300005364 | Switchgrass Rhizosphere | MGWQVKDPGLSAMRVDPLMDPIRNDPRFQAIAEKLNFPT* |
Ga0070709_108766931 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ETALRLRDPGLVYLKTDPLMDPLRKEPRFQAVMRELKFPS* |
Ga0070714_1020030052 | 3300005435 | Agricultural Soil | TKALESLTTAMRLRNWDLVYVKTDPLLDPLRKDPRFQAIERALKFPD* |
Ga0070713_1014885231 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LDWLDTAMRLRDTGLTGLKTDPLLDPLRDQPRFQAVERKLNFPH* |
Ga0070711_1011685882 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RRRAAGVRVRDSGFEYQKTDPLTDRLRNEPRFQAIERELKFPS* |
Ga0073909_105071151 | 3300005526 | Surface Soil | MRLRNWDLVYVKTDPLLDPLRKDPRFQAIERALKFPD* |
Ga0070734_100505803 | 3300005533 | Surface Soil | RLRDPQLVSLKTEPLLDPLRQEPRFKAIERELKFPP* |
Ga0070731_106708562 | 3300005538 | Surface Soil | DRSRALEWIDTAVRLRDPGLSNLKTDPLMDPLHNEPRFQVIARQLKFPN* |
Ga0070733_105062572 | 3300005541 | Surface Soil | LEKARRLGDPGLIYLKTDPLIDPLRQEPRFQAIERELKFPT* |
Ga0066699_100150122 | 3300005561 | Soil | MRDWRNPTLELIKASVSLSPLRTEPRFQAIERELKFPS* |
Ga0070763_101864682 | 3300005610 | Soil | VLGNTAKALEWLARAVRLPDLGVVYMKTDALMDPLRNEPRFRAIERELRFPD* |
Ga0068856_1005354093 | 3300005614 | Corn Rhizosphere | LRSPWLERLKTDPLLDPLRNEPRFQVIERGLKFPD* |
Ga0068856_1006168893 | 3300005614 | Corn Rhizosphere | RLPDSGLELLKTDPLLDSLRQEPRFQAIERELKFPS* |
Ga0068864_1019226111 | 3300005618 | Switchgrass Rhizosphere | AVLDLGVESMKVDPFLDPLRSEPRFQALQRALKFPP* |
Ga0070764_101075601 | 3300005712 | Soil | LEWLETAFRLMDPGLLYLKTDTLVDALRQEPRFQAIYTKLRFPS* |
Ga0070764_108413141 | 3300005712 | Soil | ALRLRDSSLTEVKTAPELDPLRQEPRFQAILKELKFPD* |
Ga0068866_109739212 | 3300005718 | Miscanthus Rhizosphere | VRAAGLEYLKADPLTDSLRKEARFRAIERALKFPN* |
Ga0066903_1007820151 | 3300005764 | Tropical Forest Soil | AVRLRDVDLQVLKVDPLLDPLRKEPRFQAIERKLKFPD* |
Ga0066903_1030844501 | 3300005764 | Tropical Forest Soil | LDNLELALRNRNAWLVYVKTYAEFDSLRKEPRFQAVMRELKFPD* |
Ga0066903_1072968121 | 3300005764 | Tropical Forest Soil | VAIGPRLEWLDIAMRLRDGGLENLKTEPFFDPLRKEPRFQAIERAPKSPD* |
Ga0068860_1013920132 | 3300005843 | Switchgrass Rhizosphere | VRAAGLEYLKADPLTDSLRKEARFRAIERELKFPN* |
Ga0070766_109114221 | 3300005921 | Soil | ESALRLRDPGLGYLKVDWTLDPLRKAPRFQAIERALRFPH* |
Ga0080027_101524842 | 3300005993 | Prmafrost Soil | RDANLETLKIDPLLDPLRKEPRFLEIERELKFPS* |
Ga0080027_103188711 | 3300005993 | Prmafrost Soil | TALRLRDPGLETLKTDPLLDPLRQEPRFQAMERELKFPT* |
Ga0066790_100735831 | 3300005995 | Soil | LDTAWRLRDPGLENLKTDPFMDPLRQEPRFQAIERELKFPPQ* |
Ga0075023_1004384011 | 3300006041 | Watersheds | KALRLRDSGLILVKTDPLMDPLRQEPRFQAIERELKFPT* |
Ga0075024_1002482691 | 3300006047 | Watersheds | LEKAMRLRDTGLYRLRVDPSFDSLRKEPRFRAVERQVRFPD* |
Ga0075028_1001017342 | 3300006050 | Watersheds | MRQRRLRDPGLICVKTDAHLDPLRKEPLFNAIERELKFPT* |
Ga0070715_100302271 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | WLETAQRLRDPGLVVLKMDPLMDPLRSEVRLQTVLQALQFPQ* |
Ga0070716_1015931772 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRDPGFRHLKTDPLMDPLRGESRFQAIERELKFPD* |
Ga0070712_1006057033 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EALKWLDTAMRVRDPGLALLKSDPLMDPLRNEPRLQAVMRELKFPD* |
Ga0079222_102383963 | 3300006755 | Agricultural Soil | RSMRFVALRLRDPGWQYLKVDSLLDPLRHEPRFQAIERELKFPN* |
Ga0066659_100766924 | 3300006797 | Soil | ALRLRDPGLENLKTDPLMDPLRKEPRFQAIERELKFPT* |
Ga0105241_125044961 | 3300009174 | Corn Rhizosphere | QALESLESSWRLRVPELRWLKADPLMDPLRNEPRFQAIERALRFPD* |
Ga0105249_105813161 | 3300009553 | Switchgrass Rhizosphere | KALEWLATGMGMPCGCLVYVRTDPLLDPLRKEPRFLAIEQELKFPN* |
Ga0116117_12132932 | 3300009635 | Peatland | LRDPGLNYLKTDSLMDSLREEPRFQAIERELKFPD* |
Ga0105855_11215701 | 3300009649 | Permafrost Soil | MRLRDPGLELLKTDPLMDPLRKEPRFQAVMRELKFPD* |
Ga0116101_11549771 | 3300009759 | Peatland | EWLDTAVRLRASGLEGLKVSPLLDPLRKEPRFQAVERALKFPP* |
Ga0123357_107262601 | 3300009784 | Termite Gut | ALEWLETARRVHDPGLQYLKTDPLMDPLRNDSRVKAIERALKFPD* |
Ga0116226_1003191110 | 3300009787 | Host-Associated | AWRLRDPGLELLKTDPLMDPLRQEPRFQAILRELKFPD* |
Ga0116226_104712063 | 3300009787 | Host-Associated | AYRLKDPGLHELKVDAYMDPLRKEPRFQAVLQKLDFPD* |
Ga0126374_100271563 | 3300009792 | Tropical Forest Soil | VRLRDPGLISLKTDPLMDPLRNEPRFQAIERELKFPN* |
Ga0126374_102345731 | 3300009792 | Tropical Forest Soil | MRLRDPELVELRTDPLMDPVRKEPRFQAIERELKFPQ* |
Ga0126374_105388751 | 3300009792 | Tropical Forest Soil | AMRLRDPGLEFLKTDPLMDPLRAEPRFQAVVRQLKFPA* |
Ga0126374_113522332 | 3300009792 | Tropical Forest Soil | GDSTKALEWLETAARLRTPGLEGLRTYPLLDPVRQEPRFQMIERALKFSD* |
Ga0123355_101536731 | 3300009826 | Termite Gut | ARRVRDPGLTTLKTDPLLDPVRKEPRFQAIERALKFPSH* |
Ga0123355_120683811 | 3300009826 | Termite Gut | GNTAKALEWLESAVRVRDAGLVQLKTDPFMDPLRLEPRFKAIERELKFPP* |
Ga0126380_102555501 | 3300010043 | Tropical Forest Soil | LRDPGVTILKVDPLLDPVRNEPRFQFIQQALTFPP* |
Ga0126380_112803391 | 3300010043 | Tropical Forest Soil | ALEWLDTAVRLHDSALSWLKRDPLLDPLRNEPRFRAIERALNFPN* |
Ga0126380_119584541 | 3300010043 | Tropical Forest Soil | NHSEALGWLDKAMRLRDPGLIDVKNDPLLDPLRKEPRFQAI* |
Ga0126384_117333921 | 3300010046 | Tropical Forest Soil | VRDPGLGWLKADPFLDPVRKEPWFIAIERELKFPD* |
Ga0126373_101945122 | 3300010048 | Tropical Forest Soil | LDRLETAMRGRTSDFTWLRTAFFDPLRKEPRFQAIERELKFPSN* |
Ga0126373_102976271 | 3300010048 | Tropical Forest Soil | LDMLEKTVRLRSPGLFLLKVLPLVDPLRHEPRFQAVMRELKFPD* |
Ga0126373_105673192 | 3300010048 | Tropical Forest Soil | MRLHDSGLAYLKADPLMDALRNEPRFQAIERELKFP* |
Ga0126373_107507992 | 3300010048 | Tropical Forest Soil | LVWLDTAMRRRDPGLTYVRTDPLMDPLRKEPRFQAIEKALKSPQ* |
Ga0126373_110657061 | 3300010048 | Tropical Forest Soil | DTPKALEWLEMAMRLRDPQLINLKTEPLLDPLRLEPRFKAIERELKFPP* |
Ga0126373_113006331 | 3300010048 | Tropical Forest Soil | LAWLDKAMRIRQPDLEQVKTDPAMDPLHNEPRFQAIEKALNFPN* |
Ga0126373_114338021 | 3300010048 | Tropical Forest Soil | RLRDPQLVSLKTDPLLDPLRQEPRFKAIDRELKFPP* |
Ga0126373_118718391 | 3300010048 | Tropical Forest Soil | EAAVRVRDPGLTLLRDDSLVDSLRKEPRFQAVVRELSFPD* |
Ga0126373_128952011 | 3300010048 | Tropical Forest Soil | TALRVRDPGLIFLKTDPFMDPLRKEPRFQAVMRELKFPDK* |
Ga0126373_131864281 | 3300010048 | Tropical Forest Soil | MQIRAPGFETLKTDPLMDPLRNEPRFQAIERELKFPE* |
Ga0126373_132003161 | 3300010048 | Tropical Forest Soil | MRDPGLVFLKTDPLLDPLRNEPRFQAIERELMFPG* |
Ga0126373_132622032 | 3300010048 | Tropical Forest Soil | AMRLRDPGLEYLKTDPLMDPLRKEPPFQAIERELKFPD* |
Ga0123356_102965581 | 3300010049 | Termite Gut | LETARRVRDPGLEYLKTDPLMGPLRTEPRFQAIERALRFPD* |
Ga0134109_101723221 | 3300010320 | Grasslands Soil | WLATAVRVHDPGLTWLKTDPFLDPVRKEPWFKAIERELKFPD* |
Ga0134109_104246292 | 3300010320 | Grasslands Soil | MRLRDPGLSWVKTDKLLDPLRQDPRFQAVERKLKFPN* |
Ga0134067_100388981 | 3300010321 | Grasslands Soil | DWVEAAVRLHDTGLAYLKTDPLIDPLRKEPRFQAIERALKFPT* |
Ga0134065_100668261 | 3300010326 | Grasslands Soil | LATAVRVHDPGLTWLKTDPFLDPVRKEPWFKAIERELKFPD* |
Ga0126370_105520031 | 3300010358 | Tropical Forest Soil | AAVRLHDRGVRWVKRDPLLDPLRKEPRFQAIERELKFPD* |
Ga0126370_117657761 | 3300010358 | Tropical Forest Soil | TIYASWGETANALAWLDRAVRLPDAGVVAVKTDALLDPLRNEPRFRAIERELKFPN* |
Ga0126370_118091812 | 3300010358 | Tropical Forest Soil | RLRNQDLVYVKTDALLDPLRHEPRFQAIERELKFPSN* |
Ga0126376_104036342 | 3300010359 | Tropical Forest Soil | VRLPDAGVVYVKADPLIDPLRKEPHFQAIERDLKFPD* |
Ga0126376_117763232 | 3300010359 | Tropical Forest Soil | EWLESAVRRRNPPLEGLKTDPLLDPLRNEPRFQAIERELKFPN* |
Ga0126372_129293051 | 3300010360 | Tropical Forest Soil | IPKALECLEAALRLRDPGLEYVKTDFFLDPLRKEPRFQAIERELKFP* |
Ga0126378_101058433 | 3300010361 | Tropical Forest Soil | WLDKATRLRDPGLVYLKTDPLLDPLRKEARYRAIEWELKFPN* |
Ga0126378_115911722 | 3300010361 | Tropical Forest Soil | KLSSGTAMRSRDPGLVELKTDPLMDPLRKEPRFQAIEREVKFPQ* |
Ga0126378_121963741 | 3300010361 | Tropical Forest Soil | ALEWLETAARLRTPGLEGLRTYPLLDPLRQEPRFQMIERALKFPD* |
Ga0126378_123101892 | 3300010361 | Tropical Forest Soil | LKVNQFGLWLCEPGLVFLKADVLMDPLHREPRFQAIERELKLPE* |
Ga0126379_103427312 | 3300010366 | Tropical Forest Soil | MRLRDPGLGGLKTDPLLDPLRKEPRFQAVMRELKFPN* |
Ga0126379_104313741 | 3300010366 | Tropical Forest Soil | MQMRAPGFETLKTDPLMDPLRNEPRFQAIERELKFPE* |
Ga0126379_108328432 | 3300010366 | Tropical Forest Soil | GRDPGLPNLKSDPLMDPLRKEPRFQAIERELQFPN* |
Ga0126379_138125721 | 3300010366 | Tropical Forest Soil | DCLDTALRLRNPGLESLKANPLFDPIRKEPRFQAIERALKFSE* |
Ga0134128_106731181 | 3300010373 | Terrestrial Soil | WLDIALRLRDPGFRHLKTDPLMDPLRGESRFQAIERELKFPD* |
Ga0126381_10000896114 | 3300010376 | Tropical Forest Soil | ALDSLETAMRQRDPYLIGVRTWSTLDPLRKEPRFQAIEKALKFP* |
Ga0126381_1002241991 | 3300010376 | Tropical Forest Soil | VGNRAKALEWLETALRLRNSSLVLLKTDPFLDPLRKELRFQAIEKALKFP* |
Ga0126381_1005820662 | 3300010376 | Tropical Forest Soil | MRDPGFRRLKTDPLLDPLRKEPRFQAIERELRFPN* |
Ga0126381_1006152472 | 3300010376 | Tropical Forest Soil | LRDAGLADLKTDPLMDPLRKEPRFQAIERALKFPSN* |
Ga0126381_1006944021 | 3300010376 | Tropical Forest Soil | NALAWLDRAVRLPDAGVVAVKTDALLDPLRNEPRFQAIERELKFPN* |
Ga0126381_1009694003 | 3300010376 | Tropical Forest Soil | LRDSNLEILKVDPFIDPLRQEPRFQAIERELRFPQ* |
Ga0126381_1012676292 | 3300010376 | Tropical Forest Soil | RVRDPSLQLLKVDPLLDPLRKEPRFQAIERELKFPE* |
Ga0126381_1012702481 | 3300010376 | Tropical Forest Soil | WLDTAVRRRNPSLEGVKTHPLLDPLRNEPRFQAIERELKFPSN* |
Ga0126381_1017552051 | 3300010376 | Tropical Forest Soil | MRLRDPYLYLLKTDQLIDPLRQEPRFQAVMRELKFPD* |
Ga0126381_1017864572 | 3300010376 | Tropical Forest Soil | SKALGLLETALREESVSLEVLKVDPFLDPLRKEPRFQAIERELKFPE* |
Ga0126381_1017939912 | 3300010376 | Tropical Forest Soil | ALQLRDPQLINLRTDPLMDPLRQEPRFQAIERELKFP* |
Ga0126381_1030907792 | 3300010376 | Tropical Forest Soil | LQTAVRLHDKGVRWLKRDPLMNPLRKEPRFQAIERELKFPE* |
Ga0126381_1031561921 | 3300010376 | Tropical Forest Soil | NTRRALEWLQTAVRIHDKGVRWLKRDPLMDPLRKEPGFKAIERELKFPE* |
Ga0126381_1032259901 | 3300010376 | Tropical Forest Soil | AAVRLRHPGLACLKTDPRMDPLRKEPRFQAIERALKFPE* |
Ga0126381_1032732811 | 3300010376 | Tropical Forest Soil | TAMRLRDPGLSLLKTDPLMDPLRKEPRYQAIERELRFPQ* |
Ga0126381_1048725672 | 3300010376 | Tropical Forest Soil | RGRDPGRPNLKADPLMDPLRQDPRYQATERALKFP* |
Ga0126383_103696374 | 3300010398 | Tropical Forest Soil | QRDPNLSEVKSSQFFDPLRSEPRFQAVERELKFPSN* |
Ga0126383_104829801 | 3300010398 | Tropical Forest Soil | RERALEWLDTALRLRDPGFRRLKTDPLLDPLRKEPRFQTIERELKFPS* |
Ga0126383_107492722 | 3300010398 | Tropical Forest Soil | RDPGLEFLKTDPLMDPLRTEPRFQAIVRQLKFAE* |
Ga0126383_111758611 | 3300010398 | Tropical Forest Soil | AMRLRDSGLIYLKTDPLLDPLRSEPRFQAIERELGFPH* |
Ga0126383_114277091 | 3300010398 | Tropical Forest Soil | GCLERAVRQRRENPGLGLLKVDPLLDPLRNEPSFGAIERALKFPD* |
Ga0126383_121679491 | 3300010398 | Tropical Forest Soil | MRDPGFRRLKTDPLLDPLRKEPRFQAIEQQLKFLD* |
Ga0126383_128120772 | 3300010398 | Tropical Forest Soil | ARLRTPGLEGLRTYPLLDPLRQEPRFQTIEQALKFPD* |
Ga0134122_119599172 | 3300010400 | Terrestrial Soil | MHVRDPGLIELKTAPLMEPLRNEPRFLAVIRELKFPD* |
Ga0126359_12064691 | 3300010869 | Boreal Forest Soil | LEWLETALRLRDAGLESLKTDSLMDPIRQEPRFQAVMRELKFPP* |
Ga0137363_102212391 | 3300012202 | Vadose Zone Soil | ALEWLDVAMRLRDPGLENLKTEPFFDPLRKELRFKAIERELKFPTD* |
Ga0137370_101585471 | 3300012285 | Vadose Zone Soil | VRLRDAGLVYMKTDPLIDPLRKEPRFQAIERELKFPN* |
Ga0137370_109441991 | 3300012285 | Vadose Zone Soil | KAREWLATAVRVHDPGLTWLKTDPFLDPVRKEPWFKAIERELKFPN* |
Ga0137398_108262801 | 3300012683 | Vadose Zone Soil | LRDPGLELLKTDPLMDPLRKEPRFQAIERELKFPD* |
Ga0137359_101910241 | 3300012923 | Vadose Zone Soil | AMRLRDTGLIGLKTDPLLDPLRKEPRFQAMERELKFPS* |
Ga0137419_104227961 | 3300012925 | Vadose Zone Soil | MWRALRVRDSGLEGLKTDPLMDPLRNKSRFQEIERGLKFSN* |
Ga0137404_100107317 | 3300012929 | Vadose Zone Soil | AMRLRDPGLENLKTEPFFDPLRKELRFKAIERELKFPTD* |
Ga0126375_106539831 | 3300012948 | Tropical Forest Soil | AMRSRDPWLQFVKTYPLTDPLREQPRFQALMRELKFPD* |
Ga0126375_108654492 | 3300012948 | Tropical Forest Soil | VRLPDAGVVYLKTDALMDSLRKEPRFQAIERALKFPN* |
Ga0164302_117615392 | 3300012961 | Soil | RLRDPGLIYTKTDPLLDPLRQEPRFQAVMRALKFPN* |
Ga0126369_102144001 | 3300012971 | Tropical Forest Soil | PDAGVVYVKADPLMDPLRNEPQFQAIERDLKFPD* |
Ga0126369_133891871 | 3300012971 | Tropical Forest Soil | LDTAMRLRDAGLVYLKTDPLLDPLRTEPRFQAIERDLKFPE* |
Ga0164305_100288631 | 3300012989 | Soil | RLRDPGLIYLKTDPLLDPLRKEPRFQAVQRELKFPN* |
Ga0164305_104292251 | 3300012989 | Soil | ALRLPDSGLELLKTDPLLDSLRQEPRFQAIERELKFPS* |
Ga0157378_103278221 | 3300013297 | Miscanthus Rhizosphere | LRDPGLVYLKTDPLMDPLRKEPRFQAVMRELKFPS* |
Ga0163162_111466921 | 3300013306 | Switchgrass Rhizosphere | LEWFDKAMRLRDPGLVYLKTDPLMDPLRHEPRFQAALKELKFPD* |
Ga0181532_102455382 | 3300014164 | Bog | MRLRDGALEYLRTDPLMDPLRKEPRFEAIMRELKFPP* |
Ga0181531_104520092 | 3300014169 | Bog | LQVRDPGVALMRADPLLDPVRKEPRFQAIERKLNFPN* |
Ga0181537_104369911 | 3300014201 | Bog | EKAQKLRDTGLTELKTDALMDPLRKEPRFQAIERELRFPS* |
Ga0182015_101126011 | 3300014495 | Palsa | LETAWRLRDPGLELLKTDPLLDPLRQEPRFQAIERELKFPG* |
Ga0182015_101695031 | 3300014495 | Palsa | MRLCLGRNTAWRLRDGGLELLKTDPLLDALRKEPRFQAVERELKFPT* |
Ga0182024_104154721 | 3300014501 | Permafrost | MRLRDPGLEFVKTDPLMDPLRKEPRFQAIERELKFPS* |
Ga0182024_113865873 | 3300014501 | Permafrost | LETALRLRDPGQGILKTDPLLDPLHQEPRFQTIERELKFPNLAGR* |
Ga0181525_104723551 | 3300014654 | Bog | MRLRDPGLSLLKSDPLVDPMRTQPRYQVIEQKLKFPSP* |
Ga0181522_102303101 | 3300014657 | Bog | ALHWLETAVRLRDSGLSLLKVDPDLDPLRDEPRFQQIELELKFPET* |
Ga0181519_110434521 | 3300014658 | Bog | IRLRDPGLSLLKSDPLMDPLRNEPRYRAIERDLKFPD* |
Ga0157376_123143471 | 3300014969 | Miscanthus Rhizosphere | LRDPGLVYLKTDPLMDPLRKEPRFQAVMRELKFPN* |
Ga0167637_10462891 | 3300015087 | Glacier Forefield Soil | YKLRDPGLTSLRVDPFLDPLRNEPRFKDIERKLKFPT* |
Ga0137412_106611012 | 3300015242 | Vadose Zone Soil | RLRAVGLQELKVEPLLDPLRKEQSFQVIERELQFPN* |
Ga0137403_115275171 | 3300015264 | Vadose Zone Soil | RDVDLQGLKVEPALDPLRNEPRFQAIERELKFPN* |
Ga0132258_106295311 | 3300015371 | Arabidopsis Rhizosphere | LETALRLRDSGLEYLKTDPLLDPLRKEPRFQAIERELKFPD* |
Ga0132258_113504642 | 3300015371 | Arabidopsis Rhizosphere | MIPGLFNLKVDPLMDALRKEPRFQVVMRELKFPASMQ* |
Ga0132255_1002984034 | 3300015374 | Arabidopsis Rhizosphere | LRDSGLKYLKTDPLLDPLRKEGRFQVIERELKFQD* |
Ga0182041_100393921 | 3300016294 | Soil | EWLEKALQLRDQGLQVLKTSPYLDPLRKEQRFQAVERALKFPN |
Ga0182041_102954471 | 3300016294 | Soil | EWLDTAMRLRDPGLELLKTDPLFDPLRHELRFQAIQRALKFPD |
Ga0182041_110616601 | 3300016294 | Soil | TAQALEWLDTAMRMRNPWLEEVKTNPFLDPLRKDPRFQAIEQALKFPN |
Ga0182041_112660482 | 3300016294 | Soil | EWLDTALRLRDSGFRRLKTDPLLDPLRKEPRFQAIERELKFPS |
Ga0182041_113488121 | 3300016294 | Soil | NWLETAVRFRSADLGSLKTEPLLDPLRNEPRFQAIERELKFPN |
Ga0182041_118274282 | 3300016294 | Soil | DAAVHMRDPGLPNLKTDPLMDPLRNEPHFRAIEQQLKFPQ |
Ga0182041_121846752 | 3300016294 | Soil | WGNTAKALEWLTTAMRLRKADLQYVKTDPLFDPLRKAPRFQAIERELKFPN |
Ga0182041_122213212 | 3300016294 | Soil | MRLRDPVLVELKTDPLVDPLRKEPHFQAIERELKFPQ |
Ga0182033_103581974 | 3300016319 | Soil | LEWLDIAMHRRVPALLSLKTDPLLDPLRQEPHFQAIERELKFPN |
Ga0182033_103644902 | 3300016319 | Soil | MRLRDPGLQFLKSDQLLDPLRKEPRFQAIERELNFSQ |
Ga0182033_103985991 | 3300016319 | Soil | WRLRKGSLDHVKTEPLLDPLRNEARFQAVMRELKFPD |
Ga0182033_109985562 | 3300016319 | Soil | WLDTAVRLRDPQLVTLKTDPFLDPVRKEPRFQAIEKALKFPE |
Ga0182033_119279622 | 3300016319 | Soil | ATRLRDPWLQYLKVFSLFDPLRKEPRFQEIERALNFPG |
Ga0182035_102884301 | 3300016341 | Soil | MRLRKADLQYVKTDPLVDPLGKAPRFQAIERELKFPN |
Ga0182035_121727371 | 3300016341 | Soil | ETALRLPDAGLQQLKVDPQLDPLRKEPRFQAVERALRFPE |
Ga0182032_102656602 | 3300016357 | Soil | AKGLDALDVAFRLRDPGLRYLKVDPLLNPLRREPRFQEIERELQFPN |
Ga0182032_109771252 | 3300016357 | Soil | ALEWLETAMRLRDPDLSTLKVNALLDPLRNEPRFQAIERELKFPN |
Ga0182032_111446471 | 3300016357 | Soil | NTAKALEWLTTAMRVRSPNLLFLKTDPLLDPLRNDPRFQAIERELKFPN |
Ga0182032_115699541 | 3300016357 | Soil | ALDWLETAMRLHHPNLERVKVNALLDPLRHEPRFQAIERALNFPD |
Ga0182034_111799411 | 3300016371 | Soil | MARLALRLRDPGLELLKIDPVLDPLRQEPRFQAVMRELKFPQ |
Ga0182034_119803342 | 3300016371 | Soil | LRDPGLVELKTDPLMDPLRKEPRFQAIERELKFPQ |
Ga0182040_105192502 | 3300016387 | Soil | LETATRNHLPELELVKMSTLLDPLRKEPRFQAIERALKFPRTE |
Ga0182040_109634832 | 3300016387 | Soil | RLRDPELTGLKTEPLLDPLRQEPRFQAIERELKFPE |
Ga0182037_102086012 | 3300016404 | Soil | LQLRDPQLINLKTDPLMDPLRQEPRFKAIERELKFPPN |
Ga0182037_104932911 | 3300016404 | Soil | AALRLRDGGLFQLKTDPALDPLRNEARFQAIQRALRFPD |
Ga0182037_105200052 | 3300016404 | Soil | MRLRDPGLEYLKTDPLMDPLRKEPRFQAIERELKFPD |
Ga0182037_119411372 | 3300016404 | Soil | WLEKALQLRDQGLQVLKTDPYLDPLRKEPRFQAVMRELKFPQ |
Ga0182037_120029932 | 3300016404 | Soil | EWLEKALQLRDQGLQVLKTSPYLDPLRKEQRFQAVERELKFPSN |
Ga0182039_101745554 | 3300016422 | Soil | LKRLDTAARVRDPGLVFLKTDPLLDPLRPERRFHAIERELKFPD |
Ga0182039_102225762 | 3300016422 | Soil | AQWANIPGALNWLETAVRFRSADLGSLKTEPLLDPLRNEPRFQAIERELKFPN |
Ga0182039_103543944 | 3300016422 | Soil | LETAYRARDAGLETLKTDPAMDPLRKEPRFQAVMRALKFPE |
Ga0182039_111702382 | 3300016422 | Soil | LELLETAMRLRDAGLCFLKTDPLLDPLRNEPRFQAIERALKFPG |
Ga0182039_112431582 | 3300016422 | Soil | DVAFRLRNPGLRYLKVDPLLNPLRREPRFQEIERELKFPN |
Ga0182039_113727821 | 3300016422 | Soil | AMRLHHPNLERVKVNALLDPLRHEPRFQAIERALNFPN |
Ga0182039_114826462 | 3300016422 | Soil | DTAVRLRDPGLSNLKTDALLDPLRNEPRFQAIERALKFPE |
Ga0182038_113592441 | 3300016445 | Soil | RVRDPDLIQLKVDPLMDPLRQEPRFKAIERELKFPN |
Ga0182038_118855771 | 3300016445 | Soil | MRVRDPGLVVLKNPLFDPIRKEPRFQAIERALRFPK |
Ga0187824_100710121 | 3300017927 | Freshwater Sediment | AMRARNSALEYLKTDPLLDPLRNDPRFQAIERQLRFPN |
Ga0187821_100349564 | 3300017936 | Freshwater Sediment | KALDWLDTAVRLHDSSLVSLKTDPLMDPLRGEPRFEAIERALKFPE |
Ga0187847_105326372 | 3300017948 | Peatland | ACGGDATQALGLLETALGQKDPMLENLKADPLLDPLRKEPRFQAIERDLKFPR |
Ga0187779_101024182 | 3300017959 | Tropical Peatland | MRLRDPGLSFLKTDPLMDPLRQEPRFQAVERELKFPR |
Ga0187778_100041291 | 3300017961 | Tropical Peatland | PVHWLRAAVLEVALRLRDAGLETVKTDPLIDPLRKEPRFEAIERELKFSSN |
Ga0187778_100665482 | 3300017961 | Tropical Peatland | MRLRDPYLYLLKTDQLIDPLRQEPRFQAVMRELKFPD |
Ga0187778_108775732 | 3300017961 | Tropical Peatland | TAMRLRDPYLEKLKTNPIFDPLREEPRFQAIVRELEFPN |
Ga0187783_100219956 | 3300017970 | Tropical Peatland | WLDTAMRLRDSGLEELRTDPLIDPLRNEPRLQALERQLRFPQ |
Ga0187783_100253802 | 3300017970 | Tropical Peatland | MRPGLSNTSIPEALEWLVTAMRLRDPGLEVLKTDPLLDPLRQEPRFQAIQREFKFPQ |
Ga0187783_100360404 | 3300017970 | Tropical Peatland | MRLRDPGLEYLKTDPLMDPLRKETRFQAVVRELKFPE |
Ga0187783_101963373 | 3300017970 | Tropical Peatland | ETALRLRDNDLLALKGDPLMDPLRAQPRFQAVLRALKFPD |
Ga0187783_102570022 | 3300017970 | Tropical Peatland | RVRDPGLADMNTDPMLDPVRKESRFQAVMRELKFPK |
Ga0187781_101376101 | 3300017972 | Tropical Peatland | IPEAVEWLDTAMRLRDPGPASLKTDPLMDPLRKEPRFQAVMGELKFP |
Ga0187781_109607002 | 3300017972 | Tropical Peatland | LRVRDPGLIQLKTAALLDPLRKEPGFQAIERALNFPD |
Ga0187781_112136562 | 3300017972 | Tropical Peatland | PLPTTISLEFLKTDPLFDPLPSEPRFKAVMRELNFPE |
Ga0187780_100109872 | 3300017973 | Tropical Peatland | MGCDFHTVEALTWLDTALQRRDPGLQYPLLDPLREEPRFQAIERAPRFPQ |
Ga0187782_114501551 | 3300017975 | Tropical Peatland | PKALDSLETAVRLRDPGLVEMKMDQLLDPLREQPRFQAVMRQLRFPD |
Ga0187863_101471463 | 3300018034 | Peatland | LETALGQKDPMLENLKADPLLDPLRKEPRFQAIERDLKFPR |
Ga0187766_100967891 | 3300018058 | Tropical Peatland | KALDWLDTAVRVRDPGLTLLRDDSFVDSLRKEPRFQAVERELRFPD |
Ga0187766_113022522 | 3300018058 | Tropical Peatland | MRLRDPGLVELKTDPLMDPLRKEPRFQAIEPELRFPQ |
Ga0187765_107927352 | 3300018060 | Tropical Peatland | LRDPGLVELKTDPLLDPLRKEPRFEAVLQALKFPS |
Ga0187784_106714021 | 3300018062 | Tropical Peatland | EKGLRLRDVDLQSLKVEPLLDPLRKEPRFHAVERELKFPD |
Ga0187772_101749391 | 3300018085 | Tropical Peatland | PGLAFLRVDPFLDPLRNEPRFQAIERELKFPSIVGETQ |
Ga0187772_104548402 | 3300018085 | Tropical Peatland | AMRLNDPGLALLKTDPLLDPLRQEPRFQAVLRQLKFPQ |
Ga0187769_106815421 | 3300018086 | Tropical Peatland | MRVRDPGLVSLKTDPLMDPLRNEARFQAIARALKFPE |
Ga0182025_13256792 | 3300019786 | Permafrost | MRHHDPYLEKLKTSANFDPLRDEPRFQAIERELKFPN |
Ga0179594_101738162 | 3300020170 | Vadose Zone Soil | TAMRLRIPDLVQLKDPLLDPLRKEPRYQVVERQLKFPN |
Ga0210403_110198551 | 3300020580 | Soil | RLRDSGLSELKAEPDFDPLRKEPRFQAIERSLKFPN |
Ga0210399_103962652 | 3300020581 | Soil | EIAYELRDHDLAELKVDYLLDPLRKEARFQEIERKLKFPN |
Ga0210395_104914912 | 3300020582 | Soil | ETALRMRDPGLIYVKTDPLIDPLRKEPRFQAVMRQLKFPS |
Ga0210401_101320971 | 3300020583 | Soil | QWGNTAKALEWLQTAVRLPDSALPWLRTDPLLDPLRGESRFQAIERELKFPQ |
Ga0210401_108930802 | 3300020583 | Soil | ALRLRDPRLISVKTEPLLDPLRKEPRFHAIENALKFPN |
Ga0210404_102677501 | 3300021088 | Soil | MTAIWETALRLRDTGLVYLKTDPLRHQPRFRAIERALKFPT |
Ga0210406_101537792 | 3300021168 | Soil | SLDTAVRLRSPWLERLKTDPLLDPLRKEPRFQEIERALRFPD |
Ga0210406_110939701 | 3300021168 | Soil | LRDAGLESLKTDSLMDPIRQESRFQAVIRALKFPP |
Ga0210388_104877151 | 3300021181 | Soil | RLRDAGLESLRTDSLMDPIRQEPRFQAVMRELKFPP |
Ga0213877_102041871 | 3300021372 | Bulk Soil | SRLRDPGLMQLKTDPLLDPLRHEVRFQAIERQLNFPG |
Ga0213874_100863711 | 3300021377 | Plant Roots | ETALRVRDAGLVQLKVDPQVDPLRKEPRFQAVMRELKFPE |
Ga0210385_104615593 | 3300021402 | Soil | LGDPGLIQLKVDPLMDPLRQEPRFQAALRELKFPE |
Ga0210397_115267332 | 3300021403 | Soil | QSRAMRLRDPGLVLLKIDPLMDPMRNEPSFQAIERQLKFPS |
Ga0210389_103601771 | 3300021404 | Soil | RLRDSGLIELKAEPNLDPLRKEPRFQAIERELKFPN |
Ga0210383_104026581 | 3300021407 | Soil | IALRHRDPGLDQLRVDPSLDPLRLEPRFQAIERALKFPD |
Ga0210383_104754771 | 3300021407 | Soil | AREWLATAVRLRDPGLLYLKTDPFLDPVRKELWFQATEQELKFPD |
Ga0210383_110032821 | 3300021407 | Soil | LEWLETALRLRDAGLESLKTDSLMDPIRQESRFQAVIRALKFPP |
Ga0210394_109548481 | 3300021420 | Soil | RQRDPDLAVLKVDPDLDPLREEPRFQAIERELKFPN |
Ga0210391_112716362 | 3300021433 | Soil | LATALRLRDSGLLELKTDPLLDPLRQEPRFQAIERELKFPN |
Ga0210390_102981861 | 3300021474 | Soil | VRLRDSSLTNLKTDPLLDPLRKEPRFQAIERELKFPN |
Ga0210390_108545981 | 3300021474 | Soil | ALRQRDPGLENLRTDPLMDPLRKEPRFQAVERELKFPD |
Ga0210390_109531311 | 3300021474 | Soil | KAMSVRDPGLEFLKADPLFDPLRKEPRFQAIEQELKFPY |
Ga0210392_106266793 | 3300021475 | Soil | LEWLETALRLRDAGLESLRTDSLMDPIRQEPRFQAVMRELKFP |
Ga0187846_102346931 | 3300021476 | Biofilm | LETALRLRGQGLEAVKTAPLLDPLRKEPRFQAVERALKFPG |
Ga0210398_106074343 | 3300021477 | Soil | WLEVAWRLRDPGLEELKTDPLIDPLRQEPRFQAIESALKFPS |
Ga0210398_107786722 | 3300021477 | Soil | LEWLDKAMSVRDPGLEFLKADPLFDPLRKEPRFQAIEQELKFPYS |
Ga0210398_108841271 | 3300021477 | Soil | LRDPGLVYTKVDPLMDPLRNEPRFQAVMQELQFPK |
Ga0210398_110842351 | 3300021477 | Soil | RLRDPGLEYLKTDPLMDPLRQEPGFQAILRELKFPN |
Ga0210402_100862034 | 3300021478 | Soil | RLRNPSVRWLKVDPLMDPLRKEPRFQAIERALKFPPL |
Ga0210410_102624484 | 3300021479 | Soil | RHRDPYLEKLKINANFDPLRSEPRFQAIERELKFLD |
Ga0210410_117662521 | 3300021479 | Soil | LHWLEIALRRRDPDLAVLKVEPDLDPLRKEPRFQAIERELKFPN |
Ga0210409_112773211 | 3300021559 | Soil | DKALRLRDPGLIYLRIDPLLDPLRKQPRFQAVERALNLSP |
Ga0126371_100673644 | 3300021560 | Tropical Forest Soil | MQIRAPGFETLKTDPLMDPLRNEPRFQAIERELKFPE |
Ga0126371_104149672 | 3300021560 | Tropical Forest Soil | MRSRDPGLVELKTDPLMDPLRKEPRFQAIEREVKFPQ |
Ga0126371_108096412 | 3300021560 | Tropical Forest Soil | MLEKAVRFGSPGLELLKVLPLVDPLRQEPRFQAVEKALNFPD |
Ga0126371_116203851 | 3300021560 | Tropical Forest Soil | AMRLHDPGLEFVKTDPLMDPVRAEPRFQAIVRQLKFPERPARSAR |
Ga0126371_128554101 | 3300021560 | Tropical Forest Soil | SLDDAMRRRDPGLVYLKTDPLLDPVRKEPRYRAIERALNFPN |
Ga0126371_130457142 | 3300021560 | Tropical Forest Soil | DTAVRLHDSGLIYLKTDPLFDPLRSEARFQAVERGLKFPD |
Ga0213880_100887682 | 3300021953 | Exposed Rock | LPVQLRDLGLVNIQTDPLLDPLRNEPRFQAIEQALKFPN |
Ga0242662_100418491 | 3300022533 | Soil | RAKALEWLATAMRLRDPGLVLLKTDPLLDPMRNEPGFQAIERQLKFPS |
Ga0224549_10120151 | 3300022840 | Soil | MRLCLGRNTAWRLRDGGLELFKTDPLLDALRKEPRFQAVERELKFPT |
Ga0224549_10534141 | 3300022840 | Soil | AWRLRDPGLENLKTDPFMDPLRQEPRFQAIERELKFP |
Ga0224564_10540162 | 3300024271 | Soil | VPAALLWLDTAYRLRDVGLVSLKRNELLDPLRTQPRFQAIEHKLNFPK |
Ga0247681_10586891 | 3300024310 | Soil | EWLETALRLRDSGLEYLKTDPLLDPLRKEPRFQAIERELRFPS |
Ga0137417_14048664 | 3300024330 | Vadose Zone Soil | MFQMRLRDSGLPVLKVDPLLDPLRQEPRFQAIERAIKFPN |
Ga0207693_105192753 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DHAEALKWLDTAMRVRDPGLALLKSDPLMDPLRNEPRLQAVMRELKFPD |
Ga0207694_106583772 | 3300025924 | Corn Rhizosphere | KRLPELRWLKTDPLLDSLRQEPRFQAIERALKFPN |
Ga0207700_101850692 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KAVRLRDSGLILLKSDPLLDPLRKEPRFQAIERALMFPT |
Ga0207700_112226861 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ALRLRDPGLVYLKTDPLMDPLRKEPRFQAVMRELKFPN |
Ga0207644_100665911 | 3300025931 | Switchgrass Rhizosphere | ALRLPDSGLELLKTDPLLDSLRQEPRFQAIERELKFPS |
Ga0207670_108362941 | 3300025936 | Switchgrass Rhizosphere | IPDALAALEKSKRLRDPGLEYLKADPLMDPLRNEPRFQVVLRELKFPD |
Ga0207665_113051951 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | FDRRLTLEWLDIALRLRDPGFRHLKTDPVMDPLRGESRFQAIERELKFPD |
Ga0207689_111867051 | 3300025942 | Miscanthus Rhizosphere | TAMRLRDPGLVQLKTDPLMDPLRQESRFQAVLRQLKFPD |
Ga0207702_101616953 | 3300026078 | Corn Rhizosphere | LESLDTAVRLRSPWLERLKTDPLLDPLRNEPRFQVIERGLKFPD |
Ga0209154_10029932 | 3300026317 | Soil | MRDWRNPTLELIKASVSLSPLRTEPRFQAIERELKFPS |
Ga0209804_12804022 | 3300026335 | Soil | LETALRQRDPFLQYVKTSRSFDPLRKEPRFQAIERELKFPN |
Ga0209421_10068633 | 3300027432 | Forest Soil | ALRLRDPGLELLKTDPLLDPLRKEPRFQAIERELKFPST |
Ga0209219_10173803 | 3300027565 | Forest Soil | MAGSHSDLEQLKVDELLDPLRKEPRFQAIERELKCPN |
Ga0209528_10024246 | 3300027610 | Forest Soil | NTPKALEWLTTAMRLRNPDLVYVKTDPLLDPLRNEPRFQAIERELKFPP |
Ga0208988_11036141 | 3300027633 | Forest Soil | VYDPGLVLLETDPLMDPLRNEPRFQAIERQLKFPS |
Ga0207862_10255353 | 3300027703 | Tropical Forest Soil | LEFVALVVLRLREPELRWLSADPLMDPLRNEPRFQAIESALRFPN |
Ga0209038_100926572 | 3300027737 | Bog Forest Soil | MSVRDPGLEFLKADPLFDPLRKEPRFQAMERELRFPN |
Ga0209274_100793163 | 3300027853 | Soil | MRRRDPTLEDIKVSRLLDPLRNEPRFQAIERELKFPN |
Ga0209693_100332784 | 3300027855 | Soil | LGNTAKALEWLARAVRLPDLGVVYMKTDALMDPLRNEPRFRAIERELRFPD |
Ga0209579_103160111 | 3300027869 | Surface Soil | RKEPLRALEWLDTAVRLRNPRLALLKTDPLMDPLRKERRFQAIERQLKFP |
Ga0209579_106058152 | 3300027869 | Surface Soil | EWLEAALRLRDPGLSDLKTDPLLDGIRHEPRFLAVVRALKFPD |
Ga0209169_106511031 | 3300027879 | Soil | AFRLMDPGLLYLKTDTLVDALRQEPRFQAIYTKLRFPS |
Ga0209380_105145941 | 3300027889 | Soil | LNWLESALRLRDPGLGYLKVDWTLDPLRKAPRFQAIERALRFPH |
Ga0209624_107737282 | 3300027895 | Forest Soil | TAMRSRNAALEYLKTDPLLDPLRKESRFQAIERELKFPP |
Ga0209006_111002721 | 3300027908 | Forest Soil | MGYRLEVAWRLRDPGLEYLKTDPLLDPLRQEPRFQAIERELKFPD |
Ga0209583_100283181 | 3300027910 | Watersheds | RLRDSGLILVKTDPLMDPLRQEPRFQAIERELKFPT |
Ga0302301_11169491 | 3300028731 | Palsa | WPRARRLGDPGMENLKTDPLLDPLRQEPRFQAMARELRFPT |
Ga0302219_101120751 | 3300028747 | Palsa | ESLDTAWRLRDPGLENLKTDPFMDPLRQEPRFQAIERELKFPT |
Ga0302234_101025211 | 3300028773 | Palsa | LRDPGLALLRTDPLLDPLRKEPRFQAMMRELKFPS |
Ga0302234_103480631 | 3300028773 | Palsa | ESLETALQLRDPGLEELKTDPLMDPLRKEPRFQAVVRQLKFPN |
Ga0302231_100732071 | 3300028775 | Palsa | EWLDTALRLRDPGLEFLKTEPLLDPLRKEPRFQAIERELKFPT |
Ga0302225_102318891 | 3300028780 | Palsa | ESLDTAWRLRDPGLENLKTDPFMDPLRQEPRFQAIERELKFPQ |
Ga0302232_105340732 | 3300028789 | Palsa | ARRLGDPGTENLKTDPLLDPLRQEPRFQAIARELRFPT |
Ga0302232_105394151 | 3300028789 | Palsa | LRDPGLEFLKTEPLLDPLRKEPRFQAIERELKFPT |
Ga0302226_100538221 | 3300028801 | Palsa | MRLPDPGLVYLKTDPLMDPLRNEPRFQAIERQLKFPN |
Ga0302226_102872382 | 3300028801 | Palsa | MRLCLGRNTAWRLRDGGLELLKTDPLLDALRKEPRFQAVERELKFPT |
Ga0302230_103008801 | 3300028871 | Palsa | TAWRLRDGGLELLKTDPLLDALRKEPRFQAVERELKFPT |
Ga0120082_10157051 | 3300029200 | Biofilm | DAALRLRDVGLNALRADPLMDPIRDEPRFRALLQRLKFPD |
Ga0222748_10133012 | 3300029701 | Soil | RAKALEWLATAMRLRDPGLVLLRTDPLMDPMRNEPGFQAIERQLKFPS |
Ga0311369_104220151 | 3300029910 | Palsa | LRDPGLENLKTDPFMDPLRQEPRFQAIERELKFPQ |
Ga0311359_110464361 | 3300029914 | Bog | GTQALEWLNTAIRLRDPGLEQLKTDPLMDPLRRDPSFQAALLQLKFP |
Ga0302148_10591761 | 3300029916 | Bog | LRLRDPGLGNLKTDSLLDSLRQEPRFQAIERELKFPS |
Ga0311340_100870861 | 3300029943 | Palsa | ETAFRVHDDGLLALKTDPLLDPLRKEPRFNAIERELKFPPQ |
Ga0311340_115264422 | 3300029943 | Palsa | QRASGLAELKVGPELDPLRKEPRFQAIEQELKFPN |
Ga0311352_101640451 | 3300029944 | Palsa | GNRAMALEWLETALRLRDPGLEFLKTDPLMDPLRQELRFQAIERELKFP |
Ga0311371_112054931 | 3300029951 | Palsa | MRLRDPGLANLKLDPLIDPLRQEPRFQAIERALKFPD |
Ga0311371_116503561 | 3300029951 | Palsa | VRHNPCAGGNSAKALEWLDTAVRLPDPGVTYLKTDPLMDPLRNEPRFPAVERELKFPD |
Ga0302302_12704461 | 3300029997 | Palsa | LETALQLRDPGLEELKTDPLMDPLRKEPRFQAVVRQLKFPN |
Ga0311339_100955891 | 3300029999 | Palsa | LDMALHVRDPGVVLMRTDPFLDPVRKEARFQAIERALKFPD |
Ga0311339_107229182 | 3300029999 | Palsa | LETAWRLRDPGQEFLKTDPLLEPLRKELRFQAIERELKFP |
Ga0302178_101502471 | 3300030013 | Palsa | EWLDVAMRLPDPGLVYLKTDPLMDPLRNEPRFQAIERQLKFPN |
Ga0311344_111722501 | 3300030020 | Bog | QTALRLRDPGLIAFRTEPIMDPLRGDPRVQAIDRELKLPD |
Ga0302182_101937311 | 3300030054 | Palsa | MALEWLETALRLRDPGLEFLKTDPLMDPLRQELRFQAIERELKFP |
Ga0302181_103064721 | 3300030056 | Palsa | ETAVRLPDPGLEYLKTDPFLDPLRSQVRFQAIERQLKFPD |
Ga0302181_103731651 | 3300030056 | Palsa | EKALQVHDPGLTILRVDPFLDPLRKEPRFLAVMRELKFST |
Ga0302176_100437331 | 3300030057 | Palsa | RLRDPGLENLKTDPFMDPLRQEPRFQAIERELKFP |
Ga0302179_100696891 | 3300030058 | Palsa | AVRLHDSGLVLLKVDPLLDPVRKEPRFQAIERELKFPS |
Ga0311353_111122951 | 3300030399 | Palsa | RLRDSCLESLKSDSLMDPIRQEPRFQEIERKLKFPD |
Ga0302184_101312051 | 3300030490 | Palsa | TALRVRDSGLEGLKTDPLLDPLRKEPRFQAIERELKFPT |
Ga0302184_102033901 | 3300030490 | Palsa | RLRDPVLENLKTDPPLDPLRQEPRFQAIELELKFPQQ |
Ga0311370_100123481 | 3300030503 | Palsa | WRLRDPGLENLKTDPFMDPLRQEPRFQAIERELKFPQ |
Ga0311370_107156703 | 3300030503 | Palsa | LRVRDPGLELLKTDPLLDPLRQEPRFQAIGRELKFPD |
Ga0311370_123188442 | 3300030503 | Palsa | YRLKDPGLAWLKVDPLLDPLRKEPRFQEIERKLNFPS |
Ga0311372_101723381 | 3300030520 | Palsa | RLRDPGLENLKTDPFMDPLRQEPRFQAIERELKFPT |
Ga0311357_101389511 | 3300030524 | Palsa | SLETALQLRDPGLEELKTDPLMDPLRKEPRFQAVVRQLKFPN |
Ga0311355_100926701 | 3300030580 | Palsa | TAWRLRDPGLENLKTDPFMDPLRQEPRFQAIERELKFPT |
Ga0311354_109202931 | 3300030618 | Palsa | LETAVRLPDPGLEYLKTDPFLDPLRSQVRFQAIERQLKFPD |
Ga0302316_100584051 | 3300030646 | Palsa | LRDSGLIYVKTDPLLDPLRKEPRFQAIERDLKFPSQ |
Ga0302309_101242142 | 3300030687 | Palsa | RLLDPGLINLKTDPLLDPLRQEPRFQAIERELKFPS |
Ga0302313_100460301 | 3300030693 | Palsa | MRLCLGRNTAWRLRDGGMELFKTDPLLDALRKEPRFQAVERELKFPT |
Ga0302312_100144091 | 3300030746 | Palsa | AMRLRDPGLVNVKLDPLIDPLRQEPRFQAIERVLKFPD |
Ga0302314_102483011 | 3300030906 | Palsa | NRAMALEWLETALRLRDPGLEFLKTDPLMDPLRQELRFQAIERELKFP |
Ga0302308_103987101 | 3300031027 | Palsa | LRLRDPGLEFLKTDPLLDPLRKEARLQAIERELKFPS |
Ga0302308_105790951 | 3300031027 | Palsa | RLRDPGFSYIRMDPLMDPLRKEPRYQAIEREVNFPD |
Ga0170824_1106201001 | 3300031231 | Forest Soil | YAFATVHPNALSAAMRIHSLWLEWLKTGPLLDPLRKEWRFQAIERELKFPN |
Ga0302307_100727363 | 3300031233 | Palsa | WRLRDPGLNYLKTDSLMDPLRKEPRFQAIEREVKFPD |
Ga0302307_101464512 | 3300031233 | Palsa | ETAWRLRDPGLEGLKTDPLLDPLRKEPRFQAIERELKFP |
Ga0302325_102122961 | 3300031234 | Palsa | LRDSDLVGLKTDPLMDPLRKEPQFQAIERELKFTD |
Ga0302324_10001280116 | 3300031236 | Palsa | WRLRDPGQEFLKTDPLLEPLRKEPRFQAIERELKFPT |
Ga0302324_1000258591 | 3300031236 | Palsa | MARDGVRLRDGGLGYLKTDPLLDPIRQEPCFPAVIQELKFPS |
Ga0302324_1007099683 | 3300031236 | Palsa | EWLETAWRLRDPGQEFLKTDPLLEPLRKELRFQAIERELKFP |
Ga0302324_1011243901 | 3300031236 | Palsa | LQWLEIALRQRNSDLAELKAEPELDPLRKEPRFQAIEQGLKFPN |
Ga0302318_105019431 | 3300031258 | Bog | RDGGLEELKTDPLLDPLRQEPHFRSIERALKFPTVEAQ |
Ga0170818_1072023072 | 3300031474 | Forest Soil | MCIHSLRLEWLKTGPLLDPLRKEPRFQAIERELKCPQ |
Ga0302320_103305382 | 3300031524 | Bog | RLKDPGFAWMKVDPMMNPLRSEPRFQAIEAKLKFPP |
Ga0302320_104015632 | 3300031524 | Bog | LQVRDPGVALMRADPLLDPVRKEPRFQAIERKLNFPN |
Ga0302320_111401572 | 3300031524 | Bog | ALEWLDTALRLRDGGLEELKTDPLLDPLRQEPHFRSIERALKFPTVEAQ |
Ga0302326_114629491 | 3300031525 | Palsa | LEWLDTAVRLRNPRLALLKADPLMDPLRKEPRFQAIVRELKFPPQ |
Ga0302326_123675331 | 3300031525 | Palsa | AYRLRDGGVTMLQVDSDIDPLRKEPRFQAIERKLDFPQ |
Ga0302326_130088022 | 3300031525 | Palsa | DTAMRVRDSGLMSLRTDPLMDPLRKEPRFQAIERQLKFP |
Ga0318516_101175123 | 3300031543 | Soil | MRLRDPGLMELKTDPLVDPLRKEPHFQAIERELKFPQ |
Ga0318516_102720651 | 3300031543 | Soil | LRLRDAQLVSLKTDALLDPLRQEPRFKAIERELKFPD |
Ga0318516_107281782 | 3300031543 | Soil | ALRLRDPGLEFLKTDPLVDPLRGDPRFQAIVRQLKFPD |
Ga0318516_108633951 | 3300031543 | Soil | LERLDTAVRLRDPGLSNLKTDALLDPLRNEPRFQAIERALKFPE |
Ga0318534_100963073 | 3300031544 | Soil | MRLRDPGLVELKTDPLVDPLRKEPHFQAIERELKLPQ |
Ga0318541_100232482 | 3300031545 | Soil | VLTLETALRLRDPGLVDTKTDPLLDPLRNEPRFQAIERELKFPN |
Ga0318541_106363892 | 3300031545 | Soil | RLRDPGLSSLRADPLMDPLRKEPRFRAIERELKFPN |
Ga0318538_107074131 | 3300031546 | Soil | MRLRDPGLVELKTDPLVDPLRKEPHFQAIERELKFPQ |
Ga0318528_100833051 | 3300031561 | Soil | LRLRDPGLVALKADPLLDPLRQEPRFKAIERELKFPP |
Ga0318573_101777082 | 3300031564 | Soil | LETALRLRDPFLASLKTDPLMDPLRKEPRFQAVMRDLKFPN |
Ga0318573_102166991 | 3300031564 | Soil | ALQLRDQGLQVLKTSPYLDPLRKEQRFQAVERALKFPN |
Ga0318515_103959901 | 3300031572 | Soil | AVQVRDPGVAYVKADPLLDPLRKEQRFQAIERELRFPD |
Ga0310915_111864442 | 3300031573 | Soil | WLDTAMRLRDPGLELLKTDPLFDPLRHELRFQAIQRALKFPD |
Ga0310915_112075042 | 3300031573 | Soil | ALRLRDPGLGGLGLTDDYGLLEPLRHEPRFQAVLRKLKSPE |
Ga0318542_100579461 | 3300031668 | Soil | WLDTAVRGRDPGLPNLKADPLMDPLRSEPHFQAIERQLKFPN |
Ga0318542_107461841 | 3300031668 | Soil | LEKALQLRDEGLQILKTDPLMDPLRNEPRFQAVERALKFPN |
Ga0318561_100506255 | 3300031679 | Soil | LETALRVRDPGLEFMKTDPLVDLLRGEPRFQAIMRGLKFPD |
Ga0318561_107999372 | 3300031679 | Soil | LSKALEWLDTAMRLRDPGLELLKTDPLFDPLRDELRFQALERALKFPD |
Ga0318574_103985862 | 3300031680 | Soil | GDSAKALESLDTAMRLHLPDMEYLKTDPLLDPLRKEPRFQAIERALNFPN |
Ga0318572_104004501 | 3300031681 | Soil | RLRDRNLIGLKTDPLLDPLRKEPRFQAIERELKFP |
Ga0318572_107138121 | 3300031681 | Soil | MRLHDPLLAAVKTASPLDPLRKEPRFQAIERELKFP |
Ga0318560_100126123 | 3300031682 | Soil | MARLALRLRDPGLELLKADPIMDPLRQEPRFQAVMRELRFPE |
Ga0310686_1001261465 | 3300031708 | Soil | QALTWLEAAERLRDADLNALKVDPLLDPLRQEPRFKSIERALMFPADSQ |
Ga0310686_1090968901 | 3300031708 | Soil | VRLRDSGLVELKAEPDLDPLREEPRFQAIERELKFPD |
Ga0310686_1124016231 | 3300031708 | Soil | ALRIRDTGLEYLKTDAFLDPLRSQLRFQAIERQLKFPD |
Ga0307476_106737191 | 3300031715 | Hardwood Forest Soil | EWLETALRLRDPGLENLKTDPLLDPLRKESRFQAIERELKFPT |
Ga0307476_108569342 | 3300031715 | Hardwood Forest Soil | AKALEWLDIAMRLRDPGLENLKTEPLMDPLREQPRFKAVMRELKFPT |
Ga0307474_101327251 | 3300031718 | Hardwood Forest Soil | EWLDTALRLRDPGLEYLKTDPLLDPLRKEPRFQAVMRELKFPT |
Ga0306917_100265263 | 3300031719 | Soil | LEWLDNALQLRDDGLVDMKVEPLFDPIRQEPRFQAIERELKFPN |
Ga0306917_105273602 | 3300031719 | Soil | WLETAMRLRDPDLSTLKVNALLDPLRNEPRFQAIERELKFPN |
Ga0306917_108066922 | 3300031719 | Soil | LAGALRLRDPGMHALKHDFLLDPIRHEPRFQAIERELKFPE |
Ga0306917_113668792 | 3300031719 | Soil | AVRARDASLILLKTDPLLDPMRGDPRFQAIERALKFPNPAPES |
Ga0307469_101355951 | 3300031720 | Hardwood Forest Soil | ALEWLVRAVRLPDGGVVYVKTDALLDSLRSDTRFQAIERQLNFPQ |
Ga0318493_103294821 | 3300031723 | Soil | ALRVGDPGLIFLKTDPLMDSLRNEPHFQAVMRELKFPE |
Ga0318493_106222822 | 3300031723 | Soil | ARQLKDPGLEGLKTDPLLDPLRNEPRFQAVLRELKFPG |
Ga0318500_103807681 | 3300031724 | Soil | ALEWLTTAMRLRKADLQYVKTDPLFDPLRKAPRFQAIERELKFPN |
Ga0318500_104069371 | 3300031724 | Soil | LGRAVRLPDAGVVYVKTDPLMDPLRKEPRFQAIERELKFPD |
Ga0318501_101621042 | 3300031736 | Soil | TAKALEWLTTAMRLRKADLQYVKTDPLFDPLRKAPRFQAIERELKFPN |
Ga0318501_102305301 | 3300031736 | Soil | MRLRDPDLRQLKNPLLDPLRNEPRFQAIERALRFPN |
Ga0318501_107446051 | 3300031736 | Soil | MRLHLPDMEYLKTDPLLDPLRKEPRFQAIERALNFPN |
Ga0306918_106606152 | 3300031744 | Soil | KALEWLETAERLRTPGLEGLKTSPLLDPLRNQPRFQAIERELKFPN |
Ga0306918_109092461 | 3300031744 | Soil | ETAMRVRDPGLIWLKTDPLMDPLRQKPRFQAVMRELRFPD |
Ga0318494_101395852 | 3300031751 | Soil | DTAVRLRNPALEGLKTDPLLDPLRNEPRFQGIERELKFPD |
Ga0307477_101613651 | 3300031753 | Hardwood Forest Soil | WLTTAMRLRNQDLVYVKIDPLLDPLRKEPRFQAIERALRFPD |
Ga0307477_110580722 | 3300031753 | Hardwood Forest Soil | GNSSKAIDALDVALRLRDPGLQYLKVDSLLDPLRRESRFQAIERTLKFPN |
Ga0307475_112819311 | 3300031754 | Hardwood Forest Soil | AQWHETARALDWLEIAMRQRDPLLESVKTSALLEPLRKEPRFQAIERELKFPN |
Ga0318537_101272511 | 3300031763 | Soil | WLQTAVRVHDKGVRWLKRDPLMDPLRKEPGFQAIERELKFPE |
Ga0318537_102410661 | 3300031763 | Soil | AVHRRSPGLEGLKTDPLLDPLRNEPRFQAIERDLKFPN |
Ga0318537_102890452 | 3300031763 | Soil | ALEELAGALRLRDPGMHALKHDFLLDPIRHEPRFQAIERELKFPE |
Ga0318509_102724982 | 3300031768 | Soil | AVRVRDPGLFYVKTDPLLDPLRKEPRFQAITRKLKFPD |
Ga0318509_104623093 | 3300031768 | Soil | MRLRDSSLEYLKVDPLLDPLRKEPRFQAIQRELKFPQ |
Ga0318521_107872451 | 3300031770 | Soil | TTAMRLRKADLQYVKTDPLFDPLRKAPRFQAIERELKFPN |
Ga0318521_108827321 | 3300031770 | Soil | LDTAMRMRNPWLEEVKTNPFLDPLRKDPRFQAIEQALKFPN |
Ga0318546_101804121 | 3300031771 | Soil | VRLPDAGVVAVKTDALMDSLRQEPRFQAVMRELKFPPQ |
Ga0318546_106102321 | 3300031771 | Soil | LAWLQTAMRLRDTALVWLKRDPLLDPLRSEPRFQAIERELKFPD |
Ga0318546_112087141 | 3300031771 | Soil | LQDAALSWLKRDPLLDPLRNEPRFQVIERKLKFPD |
Ga0318543_100224212 | 3300031777 | Soil | LDAAVRVRDPGLFYVKTDPLLDPLRKEPRFQAVMRELKFPE |
Ga0318543_102986261 | 3300031777 | Soil | QWGNTAKALEWLTTAMRLRKADLQYVKTDPLFDPLRKAPRFQAIERELKFPN |
Ga0318543_105421921 | 3300031777 | Soil | LDTAMRLHDTGLSHLKRDPLLDPLRNEPRFQAIERELRFPQ |
Ga0318508_10390242 | 3300031780 | Soil | MRLRDPGLVELKTDPLVDPLRKEPRFQAIERELKFPQ |
Ga0318547_102357792 | 3300031781 | Soil | FQLRDDGLVDMKVEPLFDPIRQEPRFQAIERELKFPN |
Ga0318547_107056191 | 3300031781 | Soil | QLRDPQMINLKTTPLLDPLRQEPRFQVVMRKLKFPD |
Ga0318552_101197231 | 3300031782 | Soil | EKAFRLRDAGLARLKTEPLLDPLRDEPRFQAIERELKFPD |
Ga0318552_103297432 | 3300031782 | Soil | LEMAMRLRDTGLSGLRSDPLLDPLRKEPRFQAVERALKFPD |
Ga0318552_107260972 | 3300031782 | Soil | LSWLETALRLGIDEIASVKTEPLLDPLRKEPRFRAVMRELKFPE |
Ga0318529_100604841 | 3300031792 | Soil | TALRVRHVALVYLKTFPLFDPLRNEPRFQAVMRELKFPE |
Ga0318557_102125012 | 3300031795 | Soil | TRALEWLDTAVRLRNPALEGLKTDPLLDPLRNEPRFQGIERELKFPD |
Ga0318557_104753421 | 3300031795 | Soil | WLETALRLRDPELTGLKTEPLLDPLRQEPRFQAIERELKFPE |
Ga0318576_104005461 | 3300031796 | Soil | LRVPCGCLVKVKTDPLMDPLRNEPRFQAVMRELRFPD |
Ga0318550_102134371 | 3300031797 | Soil | QVRDPGVFYVKTDPLLDPLRKEPHFQVIERELKFPD |
Ga0318523_104585682 | 3300031798 | Soil | LEELERAVRVRDPGLHSLKTDFLVDPLRSEPRFQAVMRELKFP |
Ga0318523_105720551 | 3300031798 | Soil | LRMRNADLRSVKQDPLLDPLRKEPRFQAVMGDLKFPDSVVSVR |
Ga0318568_104034832 | 3300031819 | Soil | VRALERLDTAVRLRDPGLSNLKTDALLDPLRNEPRFQAIERALKFPE |
Ga0318564_103045051 | 3300031831 | Soil | TAMRLRSPALSLLREDHYLDPLRKEPRFQAIERELKFPN |
Ga0310917_104849342 | 3300031833 | Soil | LETAMRLHHPNLERVKVNALLDPLRHEPRFQAIERALNFPD |
Ga0318517_103264322 | 3300031835 | Soil | ETALRIRHVALEYLKTSPLFDPLREEPRFQAIERALKFPN |
Ga0302315_101038654 | 3300031837 | Palsa | LPDPGLEYLKTDPFLDPLRGQVRFQAIERQLKFPN |
Ga0302315_103347323 | 3300031837 | Palsa | TAVRLRASDLEVLKVSPGFDPLRKEPRFQEIVRELKFPP |
Ga0306919_102608313 | 3300031879 | Soil | DTAMRLHLPDMEYLKTDPLLDPLRSEPRFQAIERALNFPN |
Ga0306919_108522752 | 3300031879 | Soil | TAMRLRDPGLVSLKTDPLMGPLRKEPRFQAVMRELKFPE |
Ga0306919_112544912 | 3300031879 | Soil | LRVRDPGLIFLKTDRLMDPLRNEPRFQAVMRELKFPD |
Ga0318544_103535681 | 3300031880 | Soil | TALRLRDPFLASLKTDPLMDPLRKEPRFQAVMRDLKFPN |
Ga0306925_104912542 | 3300031890 | Soil | AQWGSIPTALKWLDRAVRLHDPGLMGLKTAPLLDPLRNEPHFQAIERELKFPS |
Ga0306925_106217542 | 3300031890 | Soil | DTAIRLRNSDLESLKTDPLMDPLRNEPRFQEIERALKFP |
Ga0306925_111557003 | 3300031890 | Soil | GNTTRALVWLDTAVRLRDPGLSTLKVNALLDPLRKEPRFQVIERELKFPN |
Ga0306925_113805621 | 3300031890 | Soil | LSGLKTDPFLDPLRQEPRFQAIERALNFPSSASGT |
Ga0306925_115594881 | 3300031890 | Soil | RDPGLGGLGLTDDYGLLEPLRHEPRFQAVLRKLKSPE |
Ga0318551_100081213 | 3300031896 | Soil | MRLRDAGLVYVKTDPLLDPLRREPRFQAIEQALKFPD |
Ga0318520_101471615 | 3300031897 | Soil | MRLRSPALSLLREDHYLDPLRKEPRFQAIERELKFPN |
Ga0318520_109942892 | 3300031897 | Soil | LQWLETALRQRDSGLVYLKTDRLLDPVRTEPRFQQIERQLKFPT |
Ga0318520_109974762 | 3300031897 | Soil | LDTALRLRDSGLELLKTDPVLDPLRQESRFQAVIRELKFPR |
Ga0318520_110950252 | 3300031897 | Soil | ALESLATAVQVRDPGVAYVKADPLLDPLRKEQRFQAIERELRFPD |
Ga0306923_102525241 | 3300031910 | Soil | DLVRALERLDTAVRLRDPGLSNLKTDALLDPLRNEPRFQAIERALKFPE |
Ga0306923_103442591 | 3300031910 | Soil | LERAMRLRDPGMIYLKLDPLLDPLRNEPRFKAIERELKFPN |
Ga0306923_103964201 | 3300031910 | Soil | RLHDKGVRWLKRDPLLDPLRKEPRFQAIEKALKFP |
Ga0306923_116560721 | 3300031910 | Soil | VRLHDKGVRWLKRDPLLDPLRKEPRFQAIEKALKFPD |
Ga0306923_119577821 | 3300031910 | Soil | DWLETAMRLHHPNLERVKVNALLDPLRHEPRFQAIERALNFPD |
Ga0306921_101576692 | 3300031912 | Soil | LRVRDPGLIFLKTDPFMDSFRNEPRFQAVMRELKFPD |
Ga0306921_102320441 | 3300031912 | Soil | LRLHNPGLEALKTNPLLDPLRQEPRFRAVMRELKFPD |
Ga0306921_104755802 | 3300031912 | Soil | LRDPFLVLLKTDPLMDPLRREPRFQAVMRELKFPN |
Ga0310912_109010332 | 3300031941 | Soil | MRQHEPGLEWLNADPLMDPLRNEPRLQAVMRELKFPE |
Ga0310916_100783171 | 3300031942 | Soil | LDTAVRLRNPALEGLKTDPLLDPLRNEPRFQAIERELKFPN |
Ga0310916_102102631 | 3300031942 | Soil | RLHNPGLEALKTNPLLDPLRQEPRFRAVMRELKFPD |
Ga0310916_108335601 | 3300031942 | Soil | WLETALRLRDPELYRVKADPLLDPLRNEPRFQAIERELKFPD |
Ga0310916_115743671 | 3300031942 | Soil | LRDPQLASLKTDPLLDPLRKEPRFQAIERELKFPQ |
Ga0310913_103151652 | 3300031945 | Soil | ETALRLRNSGLQSLKTDLLLDPLRNEPRFQVIERELKFPN |
Ga0310913_103762802 | 3300031945 | Soil | AFRLRDAGLARLKTEPLLDPLRDEPRFQAIERELKFPD |
Ga0310913_110062271 | 3300031945 | Soil | EKAMRLRDPGLVYLKTDPLMDPLRSEPRLQAIARELKFPE |
Ga0310910_112240592 | 3300031946 | Soil | TAMRMRNPWLEEVKTNPFLDPLRKDPRFQAIEQALKFPN |
Ga0310910_113957272 | 3300031946 | Soil | QALNWLETAMRDRGIDLEQVKTSPWLDPLRKEPRFQAIERALKFPD |
Ga0310910_114160551 | 3300031946 | Soil | MRQRDPALEWLNADPLMDPLRNEPRLQAVMRELKFPE |
Ga0310909_111287072 | 3300031947 | Soil | SSLDAALRVRHVALDYLKTDALFNPLRKEPRFQAIERELKFPN |
Ga0306926_100562816 | 3300031954 | Soil | DTAVRSRDSGLIYLKTDPLLDPLRLQSHFQAIERELGFPN |
Ga0306926_100947166 | 3300031954 | Soil | ETAMRDRGIDLEQVKTSPWLDPLRKEPRFQAIERALKFPD |
Ga0306926_106281603 | 3300031954 | Soil | ALRLRDPFLASLKTDPLMDPLRKEPRFQAVMRDLKFPN |
Ga0306926_106797841 | 3300031954 | Soil | WRAREPELRWLSAEPLMDPLRNEPRFQAIERAMRFPN |
Ga0306926_116409682 | 3300031954 | Soil | LEWLETAVHVRDPGLVFVKTDVLIDPLRKEPRFQAIERELKFPN |
Ga0318530_101490491 | 3300031959 | Soil | LESLATAVQVRDPGVAYVKADPLLDPLRKEQRFQAIERELRFPD |
Ga0307479_120757362 | 3300031962 | Hardwood Forest Soil | RQRDPSLIAVRTSPLLDPLRKEPRFQAIERELKFPN |
Ga0318531_101592532 | 3300031981 | Soil | AIRRRDPGLIYLKTDPLMDPLRKEPRFQAIERELKFPN |
Ga0318531_103513982 | 3300031981 | Soil | LEVAMRLRDAGLVYLKTDPLLDPLRNEPRFQAIERELKFPD |
Ga0306922_101116055 | 3300032001 | Soil | ELAGALRLRDPGMHALKHDFLLDPIRHEPRFQAIERELKFPE |
Ga0306922_101622275 | 3300032001 | Soil | ESAMRLRDAGLVYVKTDPLLDPLRREPRFQAIEQALKFPD |
Ga0306922_111906271 | 3300032001 | Soil | AQWANIPRALNWLETAVRFRSADLRSLKTEPLLDPLRNEPRFQAIERELKFPD |
Ga0306922_113516772 | 3300032001 | Soil | ALRLRNGDLAYMKIDPLLDPLRNDPRFQAMERELQFPQ |
Ga0306922_118953442 | 3300032001 | Soil | WLETAMRRHDPYLELTTIRVFDPLRKEPRFQAVMRELRFPE |
Ga0318562_107069632 | 3300032008 | Soil | RLRNSDLENLKTDPLMDPLRKEPRFQAIERELKFPN |
Ga0318563_106784212 | 3300032009 | Soil | AKSLESLDDAMRRRDPGLVYLKTDPLLDPVRKEPRYRAIERALNFPN |
Ga0318563_107316031 | 3300032009 | Soil | SLEAALRIRHVALEYLKTSPLFDPLRKEPRFQAIERALKFPN |
Ga0318569_103455382 | 3300032010 | Soil | GNVPKALEWLDTAVRVRDPGLVFLKTDPLLDPLRPERRFHAIERELKFPD |
Ga0318569_104296091 | 3300032010 | Soil | TQSARMARLALRLRDPVLELLKADPIMDPLRQEPRFQAVMRELRFPE |
Ga0310911_101866521 | 3300032035 | Soil | ALKWLETALRLRDRQLVSLKTNPLLDPLRKESRFQAVMRELKFPQ |
Ga0310911_103546421 | 3300032035 | Soil | MRLRDPGLEALKVEPLLDPLRSEPRFQAIERALKFP |
Ga0310911_105401822 | 3300032035 | Soil | KALEWLETAPRMRDPQLQWLKVEPFLDPIRNEPRFQTVERELKFPN |
Ga0310911_105524471 | 3300032035 | Soil | TALRLRDSDLFALKTDPWLDPLRKEPRFQAVERALKFPD |
Ga0318549_102510551 | 3300032041 | Soil | DRAVRGRDPGLPNLKSDPLMDPLRKEPHFQAIERELRFPD |
Ga0318549_105512882 | 3300032041 | Soil | TAVRLRDPGLSNLKTDALLDPLRNEPRFQAIERALKFPE |
Ga0318558_101695882 | 3300032044 | Soil | WLDTALRLRDSGFRRLKTDPLLDPLRKEPRFQAIERELKFPS |
Ga0318506_101040882 | 3300032052 | Soil | VRVRDPGLFYVKTDPLLDPLRKEPRFQAITRKLKFPD |
Ga0318570_104163441 | 3300032054 | Soil | RRRARGLIALKTDPLIDPLRNEPRFQAVMRELRFPN |
Ga0318570_105843941 | 3300032054 | Soil | QALESLEAAWRLRVPALRWLKVDPLMDPLRNEPRFQAIERELEFPSN |
Ga0318575_101847861 | 3300032055 | Soil | MARLALRLRDPGLELLKADPIMDPLRQEPRFQAVMRKLKFPTD |
Ga0318533_105210611 | 3300032059 | Soil | AYRARDAGLETLKTDPAMDPLRKEPRFQAVMRALKFPE |
Ga0318533_109463371 | 3300032059 | Soil | MLRDPGLVELKTDPLMDPLRKEPRFQAIEGQLKFPQ |
Ga0318505_106004842 | 3300032060 | Soil | AVRLRNPALEGLKTDPLLDPLRNEPRFQGIERELKFPD |
Ga0318513_105171411 | 3300032065 | Soil | SRALDGLQLAMSVKDPWLENVRTSPFLDPLRNEPRFQAIERELKFPE |
Ga0318514_107903941 | 3300032066 | Soil | WLGRAVRLPDPGVVYVKTDPLMDPLRKEPRFQAIERELKFPD |
Ga0318524_101753471 | 3300032067 | Soil | LDTAMRLRDPGLLFLKSDPLMGPLHKEPRFQAIERELKFPD |
Ga0318524_103399091 | 3300032067 | Soil | QTAVRVRDSGLGWLKIDPLLDPLRKEPRFEAVKRELKFPD |
Ga0318524_107228741 | 3300032067 | Soil | TALRLRDGGMEYLRVDPLLDPIRNEPRFQALERELRFPQ |
Ga0318553_101138792 | 3300032068 | Soil | GDTTRALEWLDTAVRLRNPALEGLKTDPLLDPLRNEPRFQGIERELKFPD |
Ga0318553_104583351 | 3300032068 | Soil | RLRDPGLQFLKSDQLLDPLRKEPRFQAIERELNFSQ |
Ga0306924_101713991 | 3300032076 | Soil | LRDSGFRRLKTDPLLDPLRKEPRFQAIERELKFPS |
Ga0306924_116418441 | 3300032076 | Soil | KQALEWLEKALQLRDEALQVLKTDPYVDPLRKEPRFQAVERALKFPN |
Ga0306924_118272411 | 3300032076 | Soil | MRRRDPGLIYLKTDPLMNPLRQEPRFQAVMRKLKFPTD |
Ga0318525_100660214 | 3300032089 | Soil | KAVRLRDPGLVCLKTDPLIDPLRKEPRFQAIERELKFLP |
Ga0318525_106079651 | 3300032089 | Soil | WGNTREALTWLETALRLRDAQLVSLKTDALLDPLRQEPRFKAIERELKFPD |
Ga0318518_100391074 | 3300032090 | Soil | AKALESLDTAMRLHLPDMEYLKTDPLLDPLRSEPRFQAIERALNFPN |
Ga0318518_101007191 | 3300032090 | Soil | MRLRDPGLVELKTDPLVDPLRKEPHFQAIERELKFP |
Ga0318577_100787601 | 3300032091 | Soil | VRGRDPGLPNLKSDPLMDPLRKEPHFQAIERELRFPD |
Ga0318577_104723492 | 3300032091 | Soil | LDTAVRSHDSGLIYLKTDPLLDPLRSQSHFQAIERELGFPN |
Ga0318577_105542941 | 3300032091 | Soil | TKQALEWLEKALQLRDQGLQVLKTSPYLDPLRKEQRFQAVERALKFPN |
Ga0318540_103831882 | 3300032094 | Soil | PKALDWLETAYRVRDSDLEQLKTDPLVDPLRHEPRYQAIERALRFPD |
Ga0318540_106257672 | 3300032094 | Soil | DTAMRLHDTGLSHLKRDPLLDPLRNEPRFQAIERELRFPQ |
Ga0307471_1006758331 | 3300032180 | Hardwood Forest Soil | MRQRDPALEYLKIAAWLNPLRKEPRFQAIERELTFPN |
Ga0307472_1026717791 | 3300032205 | Hardwood Forest Soil | PRALRWLDTAQRRQDSGLTMLKMDPLMDPLRREARFQAIAQALKFPE |
Ga0306920_1000046731 | 3300032261 | Soil | KALQLRDQGLQVLKTSPYLDPLRKEQRFQAVERELKFPSN |
Ga0306920_1000414637 | 3300032261 | Soil | MRMRRSDLVNLKADPLLDPLRKEPRFQAIERELKFPN |
Ga0306920_1007251304 | 3300032261 | Soil | QHEPGLEWLNADPLMDPLRNEPRLQAVMRELKFPE |
Ga0306920_1011268951 | 3300032261 | Soil | AVRVHDKGVRWLKRDPLMDPLRKEPGFQAIERELKFPN |
Ga0306920_1019196322 | 3300032261 | Soil | ALRLRDPGLVYLKTDPLMDPLHKEPRFQTVMRQLKFPE |
Ga0306920_1025543621 | 3300032261 | Soil | LEWLTTALRLRNGDLAYMKIDPLLDPLRNDPRFQAMERELQFPQ |
Ga0306920_1027930091 | 3300032261 | Soil | LRMPGLEGLKTEPLLDSLRKEPRFQAIERALKFPD |
Ga0306920_1042966811 | 3300032261 | Soil | DTAMRLRDAGLESTKTDPLLDPLRNEPRFQAIERELKFPN |
Ga0335079_100336409 | 3300032783 | Soil | TRNPSLYGLKNEPFFDPLRKEPRFQAIERELKFPT |
Ga0335079_112449012 | 3300032783 | Soil | DTAMRRRDTRLVYLKTDPDLDPLRKEPRFQAVMRGLKFPQ |
Ga0335078_101767843 | 3300032805 | Soil | MRRRDTQLVYLKTDPDLDPLRKEPRFQAVMRGLKFPQ |
Ga0335080_101097336 | 3300032828 | Soil | LRDPGLVQLKTDPLMDPLHKEPRFLAVMRELKFPN |
Ga0335081_122304211 | 3300032892 | Soil | MRRRDTRLVYLKTDPDLDPLRKEPRFQAVMRGLKFPQ |
Ga0335076_112529661 | 3300032955 | Soil | RLHDPGLVGLKSDPLMDPIRQESRFQAALKQLKFPD |
Ga0335077_107372772 | 3300033158 | Soil | WLDTAMRLRDPGLEYLKTDPLMDPLRKEPRFRAIERELKFPD |
Ga0335077_121478612 | 3300033158 | Soil | LDWLHSAVRLHDSSLEALKTDPLMDPLRREPRFEAIERALKFPE |
Ga0310914_108596172 | 3300033289 | Soil | LDTAMRLRDPGLELLKTDPLFDPLRDELRFQALERALKFPD |
Ga0310914_110060411 | 3300033289 | Soil | SKALEELAGALRLRDPGMHALKHDFLLDPIRHEPRFQAIERELKFPE |
Ga0318519_100187844 | 3300033290 | Soil | WGNVPKALEWLDTAIRLRNSDLESLKTDPLMDPLRNEPRFQAIERALKFP |
Ga0318519_100918872 | 3300033290 | Soil | AMRLRDTGLSGLRADPLMDPLRKEPRFQAVMRELKFPD |
Ga0318519_104890161 | 3300033290 | Soil | AMSVKDPWLENVRTSPFLDPLRNEPRFQAIERELKFPE |
Ga0334850_077241_519_632 | 3300033828 | Soil | RLGDPGLIYLKTDPLIDPLRNEPRFQEVMRELNFPPQ |
Ga0334854_001814_5062_5172 | 3300033829 | Soil | QLHDSGLTDIRLDPLLDPLRKEPRFQAIVRSLNFPA |
Ga0370515_0347067_2_121 | 3300034163 | Untreated Peat Soil | TTVRLRDPGLSSMKVDPLMDPLRKEPRFQAIERELKFPN |
Ga0370514_006814_2478_2591 | 3300034199 | Untreated Peat Soil | LRVRDPGLGNLKTDPLLDPLRKEPRFQAIERSLKFPN |
Ga0370514_140363_510_623 | 3300034199 | Untreated Peat Soil | WRLRDGGLELFKTDPLLDALRKEPRFQAVERELKFPT |
⦗Top⦘ |