Basic Information | |
---|---|
Family ID | F003189 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 502 |
Average Sequence Length | 44 residues |
Representative Sequence | EQEEVAKKVIGSTEFQNKARVARSEYRKVLGTELIREIILK |
Number of Associated Samples | 350 |
Number of Associated Scaffolds | 502 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.20 % |
% of genes near scaffold ends (potentially truncated) | 96.41 % |
% of genes from short scaffolds (< 2000 bps) | 89.04 % |
Associated GOLD sequencing projects | 318 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.645 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.952 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.721 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.582 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 502 Family Scaffolds |
---|---|---|
PF00266 | Aminotran_5 | 6.77 |
PF01042 | Ribonuc_L-PSP | 6.18 |
PF13417 | GST_N_3 | 4.18 |
PF02897 | Peptidase_S9_N | 3.98 |
PF07883 | Cupin_2 | 3.39 |
PF02633 | Creatininase | 2.99 |
PF16798 | DUF5069 | 2.19 |
PF03466 | LysR_substrate | 2.19 |
PF07978 | NIPSNAP | 1.39 |
PF12867 | DinB_2 | 1.20 |
PF02567 | PhzC-PhzF | 1.00 |
PF00126 | HTH_1 | 1.00 |
PF00082 | Peptidase_S8 | 1.00 |
PF05163 | DinB | 0.60 |
PF01850 | PIN | 0.60 |
PF03446 | NAD_binding_2 | 0.60 |
PF12704 | MacB_PCD | 0.60 |
PF07228 | SpoIIE | 0.60 |
PF02661 | Fic | 0.60 |
PF14499 | DUF4437 | 0.60 |
PF07676 | PD40 | 0.60 |
PF13472 | Lipase_GDSL_2 | 0.40 |
PF13354 | Beta-lactamase2 | 0.40 |
PF02371 | Transposase_20 | 0.40 |
PF01625 | PMSR | 0.40 |
PF08241 | Methyltransf_11 | 0.40 |
PF14534 | DUF4440 | 0.40 |
PF13924 | Lipocalin_5 | 0.40 |
PF14588 | YjgF_endoribonc | 0.40 |
PF00583 | Acetyltransf_1 | 0.40 |
PF00440 | TetR_N | 0.40 |
PF01381 | HTH_3 | 0.40 |
PF12802 | MarR_2 | 0.40 |
PF13356 | Arm-DNA-bind_3 | 0.20 |
PF04041 | Glyco_hydro_130 | 0.20 |
PF13561 | adh_short_C2 | 0.20 |
PF04993 | TfoX_N | 0.20 |
PF01979 | Amidohydro_1 | 0.20 |
PF00175 | NAD_binding_1 | 0.20 |
PF04343 | DUF488 | 0.20 |
PF00155 | Aminotran_1_2 | 0.20 |
PF14060 | DUF4252 | 0.20 |
PF11741 | AMIN | 0.20 |
PF00392 | GntR | 0.20 |
PF02630 | SCO1-SenC | 0.20 |
PF00436 | SSB | 0.20 |
PF01183 | Glyco_hydro_25 | 0.20 |
PF13673 | Acetyltransf_10 | 0.20 |
PF04952 | AstE_AspA | 0.20 |
PF13622 | 4HBT_3 | 0.20 |
PF01266 | DAO | 0.20 |
PF01370 | Epimerase | 0.20 |
PF04397 | LytTR | 0.20 |
PF00561 | Abhydrolase_1 | 0.20 |
PF10041 | DUF2277 | 0.20 |
PF07617 | DUF1579 | 0.20 |
PF17170 | DUF5128 | 0.20 |
PF06983 | 3-dmu-9_3-mt | 0.20 |
PF03737 | RraA-like | 0.20 |
PF08669 | GCV_T_C | 0.20 |
PF02586 | SRAP | 0.20 |
PF00378 | ECH_1 | 0.20 |
PF02776 | TPP_enzyme_N | 0.20 |
PF13546 | DDE_5 | 0.20 |
PF13683 | rve_3 | 0.20 |
PF00487 | FA_desaturase | 0.20 |
PF12697 | Abhydrolase_6 | 0.20 |
PF03900 | Porphobil_deamC | 0.20 |
PF01124 | MAPEG | 0.20 |
PF13191 | AAA_16 | 0.20 |
PF14294 | DUF4372 | 0.20 |
PF08546 | ApbA_C | 0.20 |
PF16576 | HlyD_D23 | 0.20 |
PF01694 | Rhomboid | 0.20 |
PF03992 | ABM | 0.20 |
PF07929 | PRiA4_ORF3 | 0.20 |
PF08031 | BBE | 0.20 |
PF00563 | EAL | 0.20 |
PF03631 | Virul_fac_BrkB | 0.20 |
PF09286 | Pro-kuma_activ | 0.20 |
PF01610 | DDE_Tnp_ISL3 | 0.20 |
PF04073 | tRNA_edit | 0.20 |
PF00326 | Peptidase_S9 | 0.20 |
PF05853 | BKACE | 0.20 |
PF00668 | Condensation | 0.20 |
PF03061 | 4HBT | 0.20 |
PF00106 | adh_short | 0.20 |
PF01144 | CoA_trans | 0.20 |
PF13637 | Ank_4 | 0.20 |
PF06742 | DUF1214 | 0.20 |
PF07715 | Plug | 0.20 |
PF00589 | Phage_integrase | 0.20 |
PF02798 | GST_N | 0.20 |
PF13508 | Acetyltransf_7 | 0.20 |
PF05960 | DUF885 | 0.20 |
PF13173 | AAA_14 | 0.20 |
COG ID | Name | Functional Category | % Frequency in 502 Family Scaffolds |
---|---|---|---|
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 6.18 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 3.98 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 3.98 |
COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 2.99 |
COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 1.00 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.60 |
COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.40 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.40 |
COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.20 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.20 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.20 |
COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.20 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.20 |
COG1020 | EntF, seryl-AMP synthase component of non-ribosomal peptide synthetase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.20 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.20 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.20 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.20 |
COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.20 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.20 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.20 |
COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.20 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.20 |
COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.20 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.20 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.20 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.20 |
COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.20 |
COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.20 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.20 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.20 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.20 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.20 |
COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.20 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.20 |
COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.20 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.20 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.20 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.20 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.20 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.20 |
COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.20 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.65 % |
Unclassified | root | N/A | 11.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2032320006|FACEOR_FYWIORV02GQ8EV | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
2170459002|FZY7DQ102IQ6SZ | Not Available | 507 | Open in IMG/M |
2189573004|GZGWRS402IU5A5 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2360961 | Not Available | 716 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_14472915 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300001471|JGI12712J15308_10192060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 535 | Open in IMG/M |
3300001471|JGI12712J15308_10202417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300001593|JGI12635J15846_10076719 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
3300001593|JGI12635J15846_10767614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100388845 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100429903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1198 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101270304 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101676437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 534 | Open in IMG/M |
3300002911|JGI25390J43892_10102637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
3300004091|Ga0062387_100193134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1221 | Open in IMG/M |
3300004114|Ga0062593_101144784 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300004633|Ga0066395_10482814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
3300005166|Ga0066674_10131208 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300005167|Ga0066672_10389650 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300005171|Ga0066677_10278110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
3300005174|Ga0066680_10248219 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
3300005177|Ga0066690_10592632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
3300005177|Ga0066690_10883218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 572 | Open in IMG/M |
3300005178|Ga0066688_10613970 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300005179|Ga0066684_10567370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
3300005180|Ga0066685_10036428 | All Organisms → cellular organisms → Bacteria | 3087 | Open in IMG/M |
3300005181|Ga0066678_10872308 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005184|Ga0066671_10830023 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300005184|Ga0066671_11014233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Frateuria → Frateuria terrea | 521 | Open in IMG/M |
3300005293|Ga0065715_10118218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2318 | Open in IMG/M |
3300005293|Ga0065715_10435963 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300005332|Ga0066388_105905925 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300005332|Ga0066388_107468609 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005335|Ga0070666_10693372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
3300005338|Ga0068868_100754501 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300005338|Ga0068868_100913427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 798 | Open in IMG/M |
3300005354|Ga0070675_101020921 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300005367|Ga0070667_100206546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1744 | Open in IMG/M |
3300005435|Ga0070714_100082105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 2807 | Open in IMG/M |
3300005435|Ga0070714_100694751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 981 | Open in IMG/M |
3300005436|Ga0070713_101344152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 693 | Open in IMG/M |
3300005437|Ga0070710_10248333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1143 | Open in IMG/M |
3300005441|Ga0070700_100643895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
3300005446|Ga0066686_10575259 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300005446|Ga0066686_10836788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300005450|Ga0066682_10387711 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300005454|Ga0066687_10370262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
3300005467|Ga0070706_100815692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
3300005534|Ga0070735_10134448 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300005534|Ga0070735_10832545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 543 | Open in IMG/M |
3300005536|Ga0070697_102022427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 516 | Open in IMG/M |
3300005537|Ga0070730_10041622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3382 | Open in IMG/M |
3300005540|Ga0066697_10494457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
3300005542|Ga0070732_10144657 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300005545|Ga0070695_101278393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
3300005553|Ga0066695_10516920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
3300005557|Ga0066704_10520147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
3300005569|Ga0066705_10499600 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300005569|Ga0066705_10511582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 750 | Open in IMG/M |
3300005574|Ga0066694_10342963 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300005574|Ga0066694_10485712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
3300005586|Ga0066691_10431647 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300005591|Ga0070761_10568205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
3300005598|Ga0066706_11395031 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005602|Ga0070762_11002310 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005610|Ga0070763_10468192 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005616|Ga0068852_101596343 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005712|Ga0070764_10834264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 575 | Open in IMG/M |
3300005713|Ga0066905_100589363 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300005764|Ga0066903_101337075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1341 | Open in IMG/M |
3300005764|Ga0066903_103479465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 849 | Open in IMG/M |
3300005764|Ga0066903_105066732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 698 | Open in IMG/M |
3300005764|Ga0066903_105597475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 661 | Open in IMG/M |
3300005764|Ga0066903_105964941 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300005841|Ga0068863_101509475 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300005841|Ga0068863_102673833 | Not Available | 508 | Open in IMG/M |
3300005921|Ga0070766_11095411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
3300005952|Ga0080026_10252976 | Not Available | 532 | Open in IMG/M |
3300005995|Ga0066790_10520208 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300006031|Ga0066651_10338534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
3300006031|Ga0066651_10582013 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300006034|Ga0066656_10385408 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300006046|Ga0066652_100152907 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300006050|Ga0075028_100045144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2095 | Open in IMG/M |
3300006050|Ga0075028_100670432 | Not Available | 622 | Open in IMG/M |
3300006163|Ga0070715_10721220 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300006175|Ga0070712_100325189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
3300006175|Ga0070712_101483239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Frateuria → Frateuria terrea | 592 | Open in IMG/M |
3300006176|Ga0070765_100224714 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
3300006755|Ga0079222_11240145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300006794|Ga0066658_10318179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 831 | Open in IMG/M |
3300006796|Ga0066665_10985158 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300006800|Ga0066660_10619518 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300006800|Ga0066660_10701137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 831 | Open in IMG/M |
3300006800|Ga0066660_10832858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 752 | Open in IMG/M |
3300006800|Ga0066660_11503373 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006903|Ga0075426_10428720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
3300006914|Ga0075436_101013003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
3300006954|Ga0079219_10061553 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300007076|Ga0075435_100185773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1758 | Open in IMG/M |
3300007076|Ga0075435_101325639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
3300007265|Ga0099794_10583809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
3300007788|Ga0099795_10011136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2676 | Open in IMG/M |
3300007788|Ga0099795_10207813 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300009012|Ga0066710_102000103 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300009093|Ga0105240_11765518 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300009162|Ga0075423_12163367 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300009162|Ga0075423_12554687 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300009633|Ga0116129_1223911 | Not Available | 534 | Open in IMG/M |
3300009635|Ga0116117_1068504 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300009635|Ga0116117_1093673 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300009660|Ga0105854_1396080 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300009665|Ga0116135_1364203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 581 | Open in IMG/M |
3300009759|Ga0116101_1038840 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 997 | Open in IMG/M |
3300009792|Ga0126374_11458487 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300009839|Ga0116223_10743841 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300010046|Ga0126384_10991996 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300010046|Ga0126384_12008459 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010047|Ga0126382_10310133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
3300010047|Ga0126382_12528945 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300010048|Ga0126373_10161473 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
3300010048|Ga0126373_11108882 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300010159|Ga0099796_10195670 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300010159|Ga0099796_10210046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 793 | Open in IMG/M |
3300010159|Ga0099796_10331757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
3300010303|Ga0134082_10305763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 667 | Open in IMG/M |
3300010320|Ga0134109_10297340 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300010322|Ga0134084_10116430 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300010323|Ga0134086_10222749 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300010326|Ga0134065_10089153 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300010333|Ga0134080_10145337 | Not Available | 1002 | Open in IMG/M |
3300010343|Ga0074044_10649933 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300010358|Ga0126370_10043643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2801 | Open in IMG/M |
3300010359|Ga0126376_11508459 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300010359|Ga0126376_12628299 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300010360|Ga0126372_11223211 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300010361|Ga0126378_10959635 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300010361|Ga0126378_11599713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
3300010361|Ga0126378_12373401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300010361|Ga0126378_13130982 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300010366|Ga0126379_11291255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 836 | Open in IMG/M |
3300010366|Ga0126379_11744242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
3300010366|Ga0126379_11766277 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300010366|Ga0126379_13069509 | Not Available | 559 | Open in IMG/M |
3300010371|Ga0134125_10070100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3898 | Open in IMG/M |
3300010371|Ga0134125_12226311 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010373|Ga0134128_10001154 | All Organisms → cellular organisms → Bacteria | 35006 | Open in IMG/M |
3300010373|Ga0134128_11242080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 822 | Open in IMG/M |
3300010376|Ga0126381_101439667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
3300010376|Ga0126381_103631720 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300010376|Ga0126381_104918920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
3300010379|Ga0136449_104116708 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300010397|Ga0134124_12132901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 599 | Open in IMG/M |
3300010397|Ga0134124_12737778 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300010397|Ga0134124_13045882 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010398|Ga0126383_10393220 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
3300010398|Ga0126383_10431831 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300010398|Ga0126383_12536780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 597 | Open in IMG/M |
3300010398|Ga0126383_12552514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
3300010399|Ga0134127_10058379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3222 | Open in IMG/M |
3300010400|Ga0134122_11586042 | Not Available | 678 | Open in IMG/M |
3300010401|Ga0134121_10871508 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300010863|Ga0124850_1075147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1019 | Open in IMG/M |
3300011269|Ga0137392_11227371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300011270|Ga0137391_11196271 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300012042|Ga0136627_1017196 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
3300012189|Ga0137388_10560834 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300012198|Ga0137364_10342499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1114 | Open in IMG/M |
3300012198|Ga0137364_10847300 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300012200|Ga0137382_10646625 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300012201|Ga0137365_10228472 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
3300012202|Ga0137363_10035409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3479 | Open in IMG/M |
3300012202|Ga0137363_10925505 | Not Available | 740 | Open in IMG/M |
3300012205|Ga0137362_11030316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 700 | Open in IMG/M |
3300012205|Ga0137362_11515042 | Not Available | 557 | Open in IMG/M |
3300012207|Ga0137381_11530909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
3300012208|Ga0137376_10872426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 773 | Open in IMG/M |
3300012208|Ga0137376_10931664 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300012210|Ga0137378_10651541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
3300012211|Ga0137377_10408984 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300012357|Ga0137384_10299734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1337 | Open in IMG/M |
3300012361|Ga0137360_10219584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1548 | Open in IMG/M |
3300012361|Ga0137360_11055603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 701 | Open in IMG/M |
3300012362|Ga0137361_11860225 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300012363|Ga0137390_11066620 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300012475|Ga0157317_1033574 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 510 | Open in IMG/M |
3300012515|Ga0157338_1066099 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300012582|Ga0137358_10051322 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
3300012582|Ga0137358_10794779 | Not Available | 629 | Open in IMG/M |
3300012683|Ga0137398_10045432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2576 | Open in IMG/M |
3300012683|Ga0137398_10062246 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
3300012683|Ga0137398_10096326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1854 | Open in IMG/M |
3300012683|Ga0137398_11132956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300012908|Ga0157286_10354488 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012917|Ga0137395_10053619 | Not Available | 2546 | Open in IMG/M |
3300012917|Ga0137395_10321330 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300012918|Ga0137396_10397517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
3300012922|Ga0137394_10245000 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300012923|Ga0137359_10368171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1277 | Open in IMG/M |
3300012923|Ga0137359_11448929 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300012923|Ga0137359_11570855 | Not Available | 546 | Open in IMG/M |
3300012925|Ga0137419_11306952 | Not Available | 610 | Open in IMG/M |
3300012927|Ga0137416_11671977 | Not Available | 580 | Open in IMG/M |
3300012929|Ga0137404_11489992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
3300012930|Ga0137407_11940563 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012948|Ga0126375_10923641 | Not Available | 703 | Open in IMG/M |
3300012960|Ga0164301_10026479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2695 | Open in IMG/M |
3300012971|Ga0126369_10952963 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300012971|Ga0126369_11099514 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300012971|Ga0126369_12553493 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300012971|Ga0126369_13056277 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300012977|Ga0134087_10212998 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300012984|Ga0164309_10459921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 964 | Open in IMG/M |
3300013100|Ga0157373_10435178 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300013100|Ga0157373_11052220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 609 | Open in IMG/M |
3300013105|Ga0157369_12541085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
3300013296|Ga0157374_12317000 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300013297|Ga0157378_12354473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 584 | Open in IMG/M |
3300013306|Ga0163162_12194348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300013306|Ga0163162_13387963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
3300013307|Ga0157372_11429929 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300013307|Ga0157372_12524574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
3300014160|Ga0181517_10237741 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300014201|Ga0181537_10234021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
3300014325|Ga0163163_12256383 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300014489|Ga0182018_10361845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
3300014489|Ga0182018_10440471 | Not Available | 693 | Open in IMG/M |
3300014495|Ga0182015_10433056 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300014968|Ga0157379_10444103 | Not Available | 1197 | Open in IMG/M |
3300014969|Ga0157376_11286255 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300015052|Ga0137411_1175527 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
3300015241|Ga0137418_10576317 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300015242|Ga0137412_10110222 | Not Available | 2234 | Open in IMG/M |
3300015264|Ga0137403_11560660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300015359|Ga0134085_10188988 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300015371|Ga0132258_10634091 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
3300015372|Ga0132256_100091065 | All Organisms → cellular organisms → Bacteria | 2946 | Open in IMG/M |
3300015372|Ga0132256_100284967 | All Organisms → cellular organisms → Bacteria | 1731 | Open in IMG/M |
3300015372|Ga0132256_100289809 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
3300015372|Ga0132256_103148399 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300015372|Ga0132256_103820773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 506 | Open in IMG/M |
3300015373|Ga0132257_100579840 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1384 | Open in IMG/M |
3300015373|Ga0132257_100647748 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300015373|Ga0132257_102591463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
3300015373|Ga0132257_104439460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
3300015374|Ga0132255_103302793 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300016294|Ga0182041_12138881 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300016371|Ga0182034_10187739 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
3300016387|Ga0182040_11552952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
3300016422|Ga0182039_10032114 | All Organisms → cellular organisms → Bacteria | 3389 | Open in IMG/M |
3300016445|Ga0182038_11650376 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300017656|Ga0134112_10278293 | Not Available | 669 | Open in IMG/M |
3300017659|Ga0134083_10280265 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300017930|Ga0187825_10022594 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
3300017939|Ga0187775_10076337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
3300017942|Ga0187808_10176274 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300017947|Ga0187785_10386340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300017948|Ga0187847_10220379 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300017959|Ga0187779_10390566 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300017970|Ga0187783_10282578 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300017970|Ga0187783_11138281 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300017972|Ga0187781_10014646 | All Organisms → cellular organisms → Bacteria | 5542 | Open in IMG/M |
3300017972|Ga0187781_10770817 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300017974|Ga0187777_10951368 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300017975|Ga0187782_11638545 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300018007|Ga0187805_10096132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1339 | Open in IMG/M |
3300018009|Ga0187884_10276685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 681 | Open in IMG/M |
3300018029|Ga0187787_10222809 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300018037|Ga0187883_10242040 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300018062|Ga0187784_10475493 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300018085|Ga0187772_11026157 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300018085|Ga0187772_11461954 | Not Available | 508 | Open in IMG/M |
3300018431|Ga0066655_10070092 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
3300018431|Ga0066655_10151789 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
3300018431|Ga0066655_10594061 | Not Available | 745 | Open in IMG/M |
3300018431|Ga0066655_10600718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 741 | Open in IMG/M |
3300018431|Ga0066655_10633343 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300018431|Ga0066655_10710207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300018433|Ga0066667_10717100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 841 | Open in IMG/M |
3300018433|Ga0066667_10924916 | Not Available | 751 | Open in IMG/M |
3300018468|Ga0066662_10092132 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
3300018482|Ga0066669_11711976 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300019787|Ga0182031_1209314 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300019879|Ga0193723_1094182 | Not Available | 850 | Open in IMG/M |
3300019887|Ga0193729_1047109 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1762 | Open in IMG/M |
3300020199|Ga0179592_10252618 | Not Available | 791 | Open in IMG/M |
3300020199|Ga0179592_10393547 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300020579|Ga0210407_10261683 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300020580|Ga0210403_10246649 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
3300020580|Ga0210403_11264498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 565 | Open in IMG/M |
3300020582|Ga0210395_11236159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300020583|Ga0210401_10102768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2684 | Open in IMG/M |
3300020583|Ga0210401_10437172 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300020583|Ga0210401_10534811 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300020583|Ga0210401_10557797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1007 | Open in IMG/M |
3300020583|Ga0210401_11328711 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300021046|Ga0215015_10634021 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300021178|Ga0210408_10036052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3897 | Open in IMG/M |
3300021180|Ga0210396_10757728 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300021181|Ga0210388_10244900 | Not Available | 1573 | Open in IMG/M |
3300021181|Ga0210388_11462880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300021377|Ga0213874_10137268 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300021404|Ga0210389_10527193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 929 | Open in IMG/M |
3300021404|Ga0210389_10968025 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300021406|Ga0210386_10584975 | Not Available | 964 | Open in IMG/M |
3300021406|Ga0210386_11210127 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300021420|Ga0210394_10007494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11480 | Open in IMG/M |
3300021433|Ga0210391_10130703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1977 | Open in IMG/M |
3300021444|Ga0213878_10529051 | Not Available | 520 | Open in IMG/M |
3300021474|Ga0210390_10410176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1145 | Open in IMG/M |
3300021474|Ga0210390_10690276 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300021474|Ga0210390_10800721 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300021477|Ga0210398_10547107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 941 | Open in IMG/M |
3300021478|Ga0210402_10653770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
3300021478|Ga0210402_11155384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300021478|Ga0210402_11625851 | Not Available | 573 | Open in IMG/M |
3300021559|Ga0210409_10680397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
3300021559|Ga0210409_11281686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
3300021559|Ga0210409_11407537 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300021560|Ga0126371_10117851 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
3300021560|Ga0126371_11083564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
3300021560|Ga0126371_11985281 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
3300021560|Ga0126371_12345246 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300021560|Ga0126371_12586321 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300021560|Ga0126371_12748564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Hypericibacter → Hypericibacter adhaerens | 597 | Open in IMG/M |
3300021560|Ga0126371_12959684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 575 | Open in IMG/M |
3300021560|Ga0126371_13033942 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300021953|Ga0213880_10009987 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
3300021953|Ga0213880_10207295 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300022531|Ga0242660_1239720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 513 | Open in IMG/M |
3300022557|Ga0212123_10397744 | Not Available | 925 | Open in IMG/M |
3300024181|Ga0247693_1061785 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300024288|Ga0179589_10039475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1717 | Open in IMG/M |
3300025321|Ga0207656_10593214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
3300025414|Ga0208935_1061160 | Not Available | 507 | Open in IMG/M |
3300025898|Ga0207692_10859905 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300025904|Ga0207647_10017678 | All Organisms → cellular organisms → Bacteria | 4844 | Open in IMG/M |
3300025904|Ga0207647_10260869 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300025906|Ga0207699_11424629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300025914|Ga0207671_11342987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
3300025915|Ga0207693_10320928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1212 | Open in IMG/M |
3300025915|Ga0207693_10440273 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300025915|Ga0207693_10713332 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300025915|Ga0207693_10772982 | Not Available | 741 | Open in IMG/M |
3300025916|Ga0207663_11648571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300025921|Ga0207652_10698963 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300025927|Ga0207687_10324722 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300025928|Ga0207700_10219843 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300025928|Ga0207700_10456976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga | 1126 | Open in IMG/M |
3300025929|Ga0207664_10583188 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300025929|Ga0207664_11970714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
3300025930|Ga0207701_10098712 | All Organisms → cellular organisms → Bacteria | 2621 | Open in IMG/M |
3300025939|Ga0207665_10095371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2067 | Open in IMG/M |
3300025941|Ga0207711_10827095 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300025944|Ga0207661_10569478 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300025949|Ga0207667_10106683 | All Organisms → cellular organisms → Bacteria | 2889 | Open in IMG/M |
3300025960|Ga0207651_11552632 | Not Available | 596 | Open in IMG/M |
3300025961|Ga0207712_11526402 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300025981|Ga0207640_10090369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2119 | Open in IMG/M |
3300026075|Ga0207708_10687392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 874 | Open in IMG/M |
3300026088|Ga0207641_12476455 | Not Available | 517 | Open in IMG/M |
3300026308|Ga0209265_1017993 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
3300026308|Ga0209265_1055814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1208 | Open in IMG/M |
3300026314|Ga0209268_1166744 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
3300026316|Ga0209155_1196929 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300026326|Ga0209801_1000592 | All Organisms → cellular organisms → Bacteria | 23679 | Open in IMG/M |
3300026329|Ga0209375_1133470 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300026329|Ga0209375_1190336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 795 | Open in IMG/M |
3300026330|Ga0209473_1198905 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300026332|Ga0209803_1183870 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300026334|Ga0209377_1345963 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300026343|Ga0209159_1180039 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300026377|Ga0257171_1031723 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300026481|Ga0257155_1011322 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300026496|Ga0257157_1007027 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
3300026523|Ga0209808_1208830 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300026528|Ga0209378_1214091 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300026542|Ga0209805_1226055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 776 | Open in IMG/M |
3300026552|Ga0209577_10866970 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300027330|Ga0207777_1090324 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300027371|Ga0209418_1000467 | All Organisms → cellular organisms → Bacteria | 3574 | Open in IMG/M |
3300027376|Ga0209004_1058972 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300027527|Ga0209684_1013520 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300027545|Ga0209008_1006728 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
3300027590|Ga0209116_1098139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
3300027610|Ga0209528_1054955 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300027652|Ga0209007_1030421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1387 | Open in IMG/M |
3300027765|Ga0209073_10506423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
3300027821|Ga0209811_10085869 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300027854|Ga0209517_10605685 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300027884|Ga0209275_10118427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1374 | Open in IMG/M |
3300027884|Ga0209275_10314382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 872 | Open in IMG/M |
3300027894|Ga0209068_10406722 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300027908|Ga0209006_10122157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2299 | Open in IMG/M |
3300027908|Ga0209006_10651918 | Not Available | 866 | Open in IMG/M |
3300027908|Ga0209006_10813642 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300027908|Ga0209006_11062696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 640 | Open in IMG/M |
3300027986|Ga0209168_10208182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 976 | Open in IMG/M |
3300027991|Ga0247683_1001257 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
3300028379|Ga0268266_10246054 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
3300028566|Ga0302147_10335155 | Not Available | 501 | Open in IMG/M |
3300028746|Ga0302233_10026453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2496 | Open in IMG/M |
3300028775|Ga0302231_10179511 | Not Available | 884 | Open in IMG/M |
3300028795|Ga0302227_10354983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300028806|Ga0302221_10380809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300028808|Ga0302228_10212026 | Not Available | 880 | Open in IMG/M |
3300028877|Ga0302235_10238071 | Not Available | 795 | Open in IMG/M |
3300028884|Ga0307308_10414226 | Not Available | 646 | Open in IMG/M |
3300028906|Ga0308309_11093066 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300029636|Ga0222749_10485754 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300029882|Ga0311368_10335806 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300029882|Ga0311368_10889253 | Not Available | 598 | Open in IMG/M |
3300029944|Ga0311352_11508138 | Not Available | 503 | Open in IMG/M |
3300029951|Ga0311371_10411616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1832 | Open in IMG/M |
3300029951|Ga0311371_10955854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
3300029951|Ga0311371_12670599 | Not Available | 502 | Open in IMG/M |
3300029999|Ga0311339_10011798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13631 | Open in IMG/M |
3300029999|Ga0311339_11769678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
3300030007|Ga0311338_10428953 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300030053|Ga0302177_10619111 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300030399|Ga0311353_10047624 | All Organisms → cellular organisms → Bacteria | 4374 | Open in IMG/M |
3300030399|Ga0311353_11342033 | Not Available | 585 | Open in IMG/M |
3300030503|Ga0311370_10011974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13649 | Open in IMG/M |
3300030503|Ga0311370_10074666 | All Organisms → cellular organisms → Bacteria | 4885 | Open in IMG/M |
3300030503|Ga0311370_10292512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2113 | Open in IMG/M |
3300030520|Ga0311372_10020378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13991 | Open in IMG/M |
3300030520|Ga0311372_10368053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2206 | Open in IMG/M |
3300030520|Ga0311372_12944689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Lautropia | 517 | Open in IMG/M |
3300030524|Ga0311357_10335630 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300030580|Ga0311355_11495314 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300030659|Ga0316363_10435485 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300030737|Ga0302310_10088420 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300030739|Ga0302311_10496481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 840 | Open in IMG/M |
3300030813|Ga0265750_1012088 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300030973|Ga0075395_10032149 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031057|Ga0170834_103920470 | Not Available | 768 | Open in IMG/M |
3300031128|Ga0170823_10931150 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300031231|Ga0170824_107855800 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031231|Ga0170824_114969721 | Not Available | 910 | Open in IMG/M |
3300031233|Ga0302307_10067741 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300031234|Ga0302325_11312284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
3300031234|Ga0302325_11587090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
3300031236|Ga0302324_101187469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1018 | Open in IMG/M |
3300031236|Ga0302324_101612964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 836 | Open in IMG/M |
3300031446|Ga0170820_17013599 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300031469|Ga0170819_16895512 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300031469|Ga0170819_17018604 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300031474|Ga0170818_105084647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1501 | Open in IMG/M |
3300031474|Ga0170818_105704316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1279 | Open in IMG/M |
3300031525|Ga0302326_10004783 | All Organisms → cellular organisms → Bacteria | 31160 | Open in IMG/M |
3300031525|Ga0302326_10557744 | Not Available | 1717 | Open in IMG/M |
3300031525|Ga0302326_11259040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
3300031525|Ga0302326_13557313 | Not Available | 516 | Open in IMG/M |
3300031545|Ga0318541_10038902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → Rhodanobacter glycinis | 2400 | Open in IMG/M |
3300031616|Ga0307508_10554211 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300031679|Ga0318561_10661392 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300031682|Ga0318560_10211669 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300031708|Ga0310686_103344751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio natriegens | 689 | Open in IMG/M |
3300031715|Ga0307476_10699599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
3300031719|Ga0306917_10732247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300031720|Ga0307469_10134264 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
3300031724|Ga0318500_10192742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 974 | Open in IMG/M |
3300031820|Ga0307473_11491988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 512 | Open in IMG/M |
3300031831|Ga0318564_10451818 | Not Available | 560 | Open in IMG/M |
3300031833|Ga0310917_10305031 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300031833|Ga0310917_10695724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 688 | Open in IMG/M |
3300031837|Ga0302315_10223749 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300031897|Ga0318520_10473816 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300031910|Ga0306923_10308169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Kordiimonadales → Kordiimonadaceae → Eilatimonas → Eilatimonas milleporae | 1809 | Open in IMG/M |
3300031910|Ga0306923_10877877 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300031912|Ga0306921_12350613 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300031941|Ga0310912_11441572 | Not Available | 519 | Open in IMG/M |
3300031945|Ga0310913_10226203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
3300031945|Ga0310913_11043844 | Not Available | 572 | Open in IMG/M |
3300031946|Ga0310910_11015450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
3300031946|Ga0310910_11024846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 644 | Open in IMG/M |
3300031947|Ga0310909_10421958 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300031962|Ga0307479_10266058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1694 | Open in IMG/M |
3300031962|Ga0307479_10979663 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300032001|Ga0306922_10156065 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
3300032001|Ga0306922_11923787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
3300032001|Ga0306922_12428288 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300032025|Ga0318507_10349897 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300032035|Ga0310911_10290556 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300032035|Ga0310911_10772199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 556 | Open in IMG/M |
3300032035|Ga0310911_10821192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 537 | Open in IMG/M |
3300032042|Ga0318545_10358364 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300032052|Ga0318506_10404930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 605 | Open in IMG/M |
3300032060|Ga0318505_10212462 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300032076|Ga0306924_10743567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
3300032076|Ga0306924_11672733 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300032180|Ga0307471_100211460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1953 | Open in IMG/M |
3300032180|Ga0307471_100369705 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300032180|Ga0307471_102435841 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300032180|Ga0307471_102608636 | Not Available | 640 | Open in IMG/M |
3300032205|Ga0307472_100701641 | Not Available | 910 | Open in IMG/M |
3300033289|Ga0310914_11193240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 663 | Open in IMG/M |
3300033289|Ga0310914_11703960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
3300033475|Ga0310811_10602762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
3300033829|Ga0334854_033711 | Not Available | 1230 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.95% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.77% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.98% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.39% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.39% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.79% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.59% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.20% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.20% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.20% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.99% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.99% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.99% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.80% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.60% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.60% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.60% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.40% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.40% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.40% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.40% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.40% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.40% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.20% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.20% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.20% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.20% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.20% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.20% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.20% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.20% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.20% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.20% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.20% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.20% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.20% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012042 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ489 (22.06) | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Host-Associated | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027991 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24 | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACEORE_1645500 | 2032320006 | Soil | KGIEQEYVDQEGNREHRVQNKKRVERSEYRKVLGIELIREIILR |
E1_04257160 | 2170459002 | Grass Soil | YGGNIGDKGIEQEYVARKVIGSTELQNKKRVERSEYRKVLGIEFDS |
FG2_07192630 | 2189573004 | Grass Soil | DIEGEYVARKVIGSTEFQNKKRVERTGYRKVLGIELIREILLK |
ICChiseqgaiiDRAFT_23609613 | 3300000033 | Soil | NIGDKGIEQEYVARXVIGSTXXQNKXRVERSXYRKVLGIELIREIILK* |
ICChiseqgaiiFebDRAFT_144729153 | 3300000363 | Soil | KGIEQEYVARNVIGSTEVQNKKRVERSEYRKVLGIELIREIILR* |
JGI12712J15308_101920601 | 3300001471 | Forest Soil | AALDKGVELEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK* |
JGI12712J15308_102024172 | 3300001471 | Forest Soil | LDKGVELEAVAKKVIGSTEVQNKARVARSEYRKVLGNEYIRELILK* |
JGI12635J15846_100767195 | 3300001593 | Forest Soil | LDKGVELEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK* |
JGI12635J15846_107676141 | 3300001593 | Forest Soil | EAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK* |
JGIcombinedJ26739_1003888454 | 3300002245 | Forest Soil | KGVELEAVAKKVICSTECQNKARVARSEYRKALGNEYIRELILK* |
JGIcombinedJ26739_1004299031 | 3300002245 | Forest Soil | GNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
JGIcombinedJ26739_1012703041 | 3300002245 | Forest Soil | KVXXSTEFQNKKRVERSEYRKVLGIELIREIILK* |
JGIcombinedJ26739_1016764371 | 3300002245 | Forest Soil | FKNAAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGTEYIRELNLK* |
JGI25390J43892_101026371 | 3300002911 | Grasslands Soil | DRGVEEEDVAKKVIGSTEFQNKARVGRNEYRKILRREYIRELILK* |
Ga0062387_1001931343 | 3300004091 | Bog Forest Soil | EAVAKKVIGSTEVQNKARVARNEYRKVLGSEFIRELILK* |
Ga0062593_1011447841 | 3300004114 | Soil | AAYAGNIGDKGIEQEYVARNVIGSTEVQNKARVARNEYRKVLGRELIRELILK* |
Ga0066395_104828141 | 3300004633 | Tropical Forest Soil | GIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0066674_101312081 | 3300005166 | Soil | GIEQEYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK* |
Ga0066672_103896502 | 3300005167 | Soil | KGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK* |
Ga0066677_102781101 | 3300005171 | Soil | KNAAAALDKGVELEYVARKVICDTECQNKARVARSEYRKVMGIELIRELILK* |
Ga0066680_102482191 | 3300005174 | Soil | EYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK* |
Ga0066690_105926323 | 3300005177 | Soil | QEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0066690_108832182 | 3300005177 | Soil | YGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK* |
Ga0066688_106139702 | 3300005178 | Soil | EYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILR* |
Ga0066684_105673701 | 3300005179 | Soil | KGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIRELILK* |
Ga0066685_100364286 | 3300005180 | Soil | EAVAKKVIGSTEFQNKKRVERTGYRKVMGSEFIRELILK* |
Ga0066678_108723081 | 3300005181 | Soil | EYVARKVIGSTEFQNKKRVQRSEYRKVLGIELIREIILK* |
Ga0066671_108300232 | 3300005184 | Soil | YGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0066671_110142331 | 3300005184 | Soil | IEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0065715_101182181 | 3300005293 | Miscanthus Rhizosphere | AAYGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGVELIRELILK* |
Ga0065715_104359631 | 3300005293 | Miscanthus Rhizosphere | EQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0066388_1059059251 | 3300005332 | Tropical Forest Soil | GAAALDNGVEQEEVAKKVIGSTEVQNKARVGRNQYRKVIGVEYMRELSLQ* |
Ga0066388_1074686091 | 3300005332 | Tropical Forest Soil | DKGVELEEVAKKVIGSTEVQNKARVGRNQYRRVLGIEYVREIILK* |
Ga0070666_106933723 | 3300005335 | Switchgrass Rhizosphere | EYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0068868_1007545011 | 3300005338 | Miscanthus Rhizosphere | IEGEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0068868_1009134271 | 3300005338 | Miscanthus Rhizosphere | IGDKGIEAEYVARNVIGSTEFQNKKRVERSEYRKVLGTELIREIILK* |
Ga0070675_1010209212 | 3300005354 | Miscanthus Rhizosphere | GIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0070667_1002065463 | 3300005367 | Switchgrass Rhizosphere | IEGEYVARKVIGSTEFQNKKRVERTGYRKVLGIELIREIILK* |
Ga0070714_1000821056 | 3300005435 | Agricultural Soil | DAVAEKVIGSTEVQNQARVGRNEYRTVLGAELIRELILK* |
Ga0070714_1006947511 | 3300005435 | Agricultural Soil | GGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGVELIRELILK* |
Ga0070713_1013441521 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GDKGIEAEYVARKVIGSTEFQNKKRVERTGYRKALGTELIREVILK* |
Ga0070710_102483331 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GAEEEDVAKKVIGGTDFQNKARIGRNDYREVLGSELLRELILK* |
Ga0070700_1006438951 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | KGAELEDVAKQVIGSTEFQNKARVHRNDYRKVLGTEYIRELILK* |
Ga0066686_105752592 | 3300005446 | Soil | EQEYVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILR* |
Ga0066686_108367881 | 3300005446 | Soil | QEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0066682_103877112 | 3300005450 | Soil | EQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0066687_103702621 | 3300005454 | Soil | GNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGTELIREIILR* |
Ga0070706_1008156922 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IEAEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0070734_1000248625 | 3300005533 | Surface Soil | MAEKVIGSLELQNKRRVERTQYRTVLGSELVRELVLS* |
Ga0070735_101344482 | 3300005534 | Surface Soil | MGALDRGVEEEEVAKKVICSTECQNAARVHRNEYRKVLRREYIRELFLK* |
Ga0070735_108325451 | 3300005534 | Surface Soil | EYVARKVIGSTELQNKKRVERTGYRKVLGTELIREVILK* |
Ga0070697_1020224271 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GVELEAVAKKVIGSTKVQNKARVARNEYRKLLGSELIRELILK* |
Ga0070730_100416225 | 3300005537 | Surface Soil | AAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGTELIRELILR* |
Ga0066697_104944571 | 3300005540 | Soil | GDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELTREIILK* |
Ga0070732_101446572 | 3300005542 | Surface Soil | VEEEEVAKKVICSTECQNAARVHRNEYRKVLRREYIRELFLK* |
Ga0070695_1012783932 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | KGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0066695_105169202 | 3300005553 | Soil | KVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0066704_105201473 | 3300005557 | Soil | RKVICDTECQNKARVARSEYRKVMGIELIRELILK* |
Ga0066705_104996001 | 3300005569 | Soil | IEQEYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK* |
Ga0066705_105115822 | 3300005569 | Soil | QEYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK* |
Ga0066694_103429631 | 3300005574 | Soil | IAKKVIGSTEVQNKARVGRNEYRKVLRREYVRELILK* |
Ga0066694_104857121 | 3300005574 | Soil | RKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0066691_104316471 | 3300005586 | Soil | KGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0070761_105682052 | 3300005591 | Soil | AKKVICSTECQNKARVGRNEYRKVLGSEYIRELILK* |
Ga0066706_113950311 | 3300005598 | Soil | ARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0070762_110023102 | 3300005602 | Soil | VAKKVIGSTEFQNKARVARSEYRKVLGTELIRELILK* |
Ga0070763_104681922 | 3300005610 | Soil | AKKVIGSTEVQNKARVARTEYRKVLGTEYIRELILK* |
Ga0068852_1015963431 | 3300005616 | Corn Rhizosphere | AEKVIGSTEFQNKARVSRNQYRKVIGIEYVTEIVLK* |
Ga0070764_108342642 | 3300005712 | Soil | ALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK* |
Ga0066905_1005893633 | 3300005713 | Tropical Forest Soil | IGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0066903_1013370753 | 3300005764 | Tropical Forest Soil | ARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0066903_1034794651 | 3300005764 | Tropical Forest Soil | ELEEVAKKVIGSTEVQNKARVGRNEYRKVLGIEYVREIILN* |
Ga0066903_1050667321 | 3300005764 | Tropical Forest Soil | KGAEEEDVAKKVIGSTDFQNKARIGRNDYREVLGSELLREIILK* |
Ga0066903_1055974751 | 3300005764 | Tropical Forest Soil | KGAEEEDVAKKVIGSTDFQNKARIGRNDYREVLGSELLRELILK* |
Ga0066903_1059649412 | 3300005764 | Tropical Forest Soil | DKGVEQEEVAKKVIGSTEFQNKARVGRNQYRKVLGIEYVRELILK* |
Ga0068863_1015094751 | 3300005841 | Switchgrass Rhizosphere | EYVARKVIGSTEFQNKKRVERTGYRKVLGIELIREIILK* |
Ga0068863_1026738332 | 3300005841 | Switchgrass Rhizosphere | LDRSVEEEEIAKKVIGSTEYQNKARVARNEYRKVLRREYVRELILK* |
Ga0070766_110954111 | 3300005921 | Soil | EDVAKKVIGSTEVQNKARAFRNEYRKVLGTELIRELILK* |
Ga0080026_102529761 | 3300005952 | Permafrost Soil | AQVICSTECQNKARVARGEYRRVLGTELIREVILK* |
Ga0066790_105202081 | 3300005995 | Soil | AVAKKVICSTECQNKARVGRNEYRKVLRREYIRELILK* |
Ga0066651_103385341 | 3300006031 | Soil | ARKVIGSTEFQNKKRVERSAYRKVLGIELIRELILK* |
Ga0066651_105820131 | 3300006031 | Soil | GIEQEYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILR* |
Ga0066656_103854081 | 3300006034 | Soil | KGIEQEYVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK* |
Ga0066652_1001529071 | 3300006046 | Soil | GGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0075028_1000451445 | 3300006050 | Watersheds | ALDRGVEEEEVAKKIICSTDCQNKARVGRNEYRKVLRREYIRELILQ* |
Ga0075028_1006704321 | 3300006050 | Watersheds | ELEAVAKKVICSTECQNKARVVRNEYRKVLGTEFIRELILK* |
Ga0070715_107212202 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EYVARNVIGSTEFQNKKRVERTAYRKVLGTELIREIILR* |
Ga0070712_1003251891 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREVILK* |
Ga0070712_1014832391 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGVELIRELILK* |
Ga0070765_1002247141 | 3300006176 | Soil | EAVAKKVICSTECQNKARVARNEYRKVLGTELIRELILK* |
Ga0079222_112401451 | 3300006755 | Agricultural Soil | VELEDVAKKVIGSTEFQNKARVGRNDYRKVLGNEYIRELILK* |
Ga0066658_103181791 | 3300006794 | Soil | MAALDRGIEEEAVAKKVICSTECQNKARVGRNEYRKVTRREYIRELILK* |
Ga0066665_109851582 | 3300006796 | Soil | VARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0066660_106195182 | 3300006800 | Soil | EQEYVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK* |
Ga0066660_107011371 | 3300006800 | Soil | DKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK* |
Ga0066660_108328581 | 3300006800 | Soil | EAVAKKVIGSTEFQNKKRVERSEYRKVLRREYIRELILK* |
Ga0066660_115033732 | 3300006800 | Soil | LEEVAKKVIGSTDVQNKARVGRNEYRKVLGTEYIRELILK* |
Ga0075426_104287201 | 3300006903 | Populus Rhizosphere | VEEEEVAKKVIGSTEFQNKARVARSEYRKVLGTELIREIILK* |
Ga0075436_1010130032 | 3300006914 | Populus Rhizosphere | VAKKVIGSTEFQNKARVGRNEYRKILRREYIRELILK* |
Ga0079219_100615531 | 3300006954 | Agricultural Soil | DRGIEEEAVAKKVIGSTEVQNKARVGRNEYRKVLRREYIREVILK* |
Ga0075435_1001857731 | 3300007076 | Populus Rhizosphere | KGIELEAVAKKVIGTTEVQNKARVARNEYRKLLGSELIRELILK* |
Ga0075435_1013256391 | 3300007076 | Populus Rhizosphere | KDMAAYAGDIGDKAVEMDAVAEKVIGSTEVQNKARVARNEYRTVLGTEVMREIILK* |
Ga0099794_105838091 | 3300007265 | Vadose Zone Soil | AALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILQ* |
Ga0099795_100111363 | 3300007788 | Vadose Zone Soil | LDRGVEEEEIAKKVIGSTEVQNKARVGRNEYRKVLRREYVRELNLK* |
Ga0099795_102078132 | 3300007788 | Vadose Zone Soil | VSLDHFQNAAAALDKAVELEYVARKVICDTECQNKARVSRSEYRKVMGNEFLRELILK* |
Ga0066710_1020001032 | 3300009012 | Grasslands Soil | ALDKGVELEYVARKVIGSTEFQNKKRVERTGYRKVMGNELIRELILK |
Ga0105240_117655182 | 3300009093 | Corn Rhizosphere | FKNGAAALDNGVELEEVAKKVIGSTELQNKARVGRNEYRKVLGNEYVREVILK* |
Ga0075423_121633671 | 3300009162 | Populus Rhizosphere | QEEVAKTVIGSTEVQNKAREGRNQYRKVLGIEYVRELILQ* |
Ga0075423_125546871 | 3300009162 | Populus Rhizosphere | EYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0116129_12239112 | 3300009633 | Peatland | ALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGTEYIRELILK* |
Ga0116117_10685043 | 3300009635 | Peatland | VAKKVICSTECQNKARVARSQYRKVLGTEYIRELILK* |
Ga0116117_10936732 | 3300009635 | Peatland | MAALDKNAEEEAVAKKVICSTECQNKARVGRNEYRKVLRREYIRELILK* |
Ga0105854_13960802 | 3300009660 | Permafrost Soil | VAKKVICSTECQNKARVGRSEYRKVLGIEYIRELILK* |
Ga0116135_13642031 | 3300009665 | Peatland | DKGVELEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK* |
Ga0116101_10388402 | 3300009759 | Peatland | EEEAVAKKVIGSTEFQNKARVARNEYRKVLSREYIRELILK* |
Ga0126374_114584872 | 3300009792 | Tropical Forest Soil | VARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0116223_107438412 | 3300009839 | Peatlands Soil | EEVAKKVIGSTPVQNKARVARNEYRKVLGYELFRELILK* |
Ga0126384_109919961 | 3300010046 | Tropical Forest Soil | TFKNGAAAFDKGIELEGVAKKVIGSTEVQNKARVGRNAYRKVLGIEYVRELILK* |
Ga0126384_120084592 | 3300010046 | Tropical Forest Soil | YVARNVIGTTEFQNKKRVERSEYRKVLGVELIREIILK* |
Ga0126382_103101333 | 3300010047 | Tropical Forest Soil | AKKVIGSTEFQNKARVARNEYRKVLRREYIRELILK* |
Ga0126382_125289451 | 3300010047 | Tropical Forest Soil | YGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGTELIREIILR* |
Ga0126373_101614731 | 3300010048 | Tropical Forest Soil | VARKVIGSTEFQNKKRVERSEYRKVLGTELIREIILK* |
Ga0126373_111088821 | 3300010048 | Tropical Forest Soil | EYVARKVIGSTEFQNKKRVERSEYRKVLGTELIREIILR* |
Ga0099796_101956701 | 3300010159 | Vadose Zone Soil | TFKNAAAALDKDVELEYVARKVICNTECQNKARVARSEYRKVMGNEFIRELILK* |
Ga0099796_102100462 | 3300010159 | Vadose Zone Soil | YGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0099796_103317572 | 3300010159 | Vadose Zone Soil | VAKKAIGSTEVQNKARVGRSEYRKLLGSELIRELILK* |
Ga0134082_103057631 | 3300010303 | Grasslands Soil | KGVEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0134109_102973401 | 3300010320 | Grasslands Soil | KGIEQEYVARNVIGSTEVQNKARVARSAYRKVLGIELIREIILR* |
Ga0134084_101164301 | 3300010322 | Grasslands Soil | NIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELVREIILR* |
Ga0134086_102227491 | 3300010323 | Grasslands Soil | YVARKVIGSTEFQNKKRVERSGYRKVLGIELIRELILK* |
Ga0134065_100891531 | 3300010326 | Grasslands Soil | RKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0134080_101453373 | 3300010333 | Grasslands Soil | EQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0074044_106499331 | 3300010343 | Bog Forest Soil | EGEYVARKVIGSTEFQNKKRVQRSEYRKVLGIELIREIILK* |
Ga0126370_100436433 | 3300010358 | Tropical Forest Soil | RGVEEEEIAKKVIGSTEVQNKARVGRNEYRKVLRREYIRELMLK* |
Ga0126376_115084592 | 3300010359 | Tropical Forest Soil | AYGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0126376_126282991 | 3300010359 | Tropical Forest Soil | KNMAELDRGVEEEEIAKKVICSTDCQNKARVARNEYRKVLRREYVREIILK* |
Ga0126372_112232111 | 3300010360 | Tropical Forest Soil | DKGVELEEVAKKVIGSTEVQNKARVGRNDYRKVLGVEYVRELILK* |
Ga0126378_109596351 | 3300010361 | Tropical Forest Soil | KKVIGSTEVQNKARVGRNEYRKVLGTEYIRELILK* |
Ga0126378_115997131 | 3300010361 | Tropical Forest Soil | KGAEEEDVARKVIGSTEFQNKARIGRNDYREILGSELLRELILK* |
Ga0126378_123734011 | 3300010361 | Tropical Forest Soil | EEEIAKKVIGSTEVQNKARVGRNEYRKILRREYIRELILK* |
Ga0126378_131309821 | 3300010361 | Tropical Forest Soil | EEEIAKKVIGSTEVQNKARVARNEYRKVLRREYIRELILK* |
Ga0126379_112912551 | 3300010366 | Tropical Forest Soil | VAKKVIGSTEFQNKARVGRNDYRKVLGNEYIRELILK* |
Ga0126379_117442421 | 3300010366 | Tropical Forest Soil | AAAALDKRVEFEDVAKKVICSTECQNNARVARNEYRKVLGTEYIRELILK* |
Ga0126379_117662772 | 3300010366 | Tropical Forest Soil | GEEEEIAKKVIGSTEVQNKARVGRNEYRKVLGIEYFRELILK* |
Ga0126379_130695091 | 3300010366 | Tropical Forest Soil | EYVARKVIGSTEFQNKKRVERSEYRKVLGTELIREIILK* |
Ga0134125_100701001 | 3300010371 | Terrestrial Soil | YVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK* |
Ga0134125_122263111 | 3300010371 | Terrestrial Soil | IEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK* |
Ga0134128_1000115435 | 3300010373 | Terrestrial Soil | FKNGAAALDNGVELEEVAKKVIGSTELQNKARVGRNEYRKVFGNEYVREVILK* |
Ga0134128_112420801 | 3300010373 | Terrestrial Soil | EYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK* |
Ga0126381_1014396671 | 3300010376 | Tropical Forest Soil | VAKKVIGSTEFQNKARVGRNQYRKVLGIEYVRELILK* |
Ga0126381_1036317201 | 3300010376 | Tropical Forest Soil | KVIGSTEVQNKARVRRNTYRKVLGIEYVRELILR* |
Ga0126381_1049189201 | 3300010376 | Tropical Forest Soil | KVIGSTEFQNKKRVERSEYRKVLGIELIREIILN* |
Ga0136449_1041167082 | 3300010379 | Peatlands Soil | VEEEEVAKKVIGSTPVQNKARVARNEYRKVLGYELFRELILK* |
Ga0134124_121329011 | 3300010397 | Terrestrial Soil | GIEQEYVARNVIGSTELQNKKRVERSAYSKVLGIELIRELILK* |
Ga0134124_127377781 | 3300010397 | Terrestrial Soil | NGVELEEVAKKVIGSTELQNKARVGRNEYRKVLGNEYVREVILK* |
Ga0134124_130458822 | 3300010397 | Terrestrial Soil | MAALDRGVEEEAIAQKVIGSTEVQNKARVARNEYRKVLRRYYIRELILK* |
Ga0126383_103932202 | 3300010398 | Tropical Forest Soil | YGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILR* |
Ga0126383_104318311 | 3300010398 | Tropical Forest Soil | RGVEEEEVAKKVIGSTEVQNKARVGRNEYRKVLRREYIRELILK* |
Ga0126383_125367801 | 3300010398 | Tropical Forest Soil | KGVELEEVAKRVIGSTEVQNKARVGRNEYRKVLGIEYVRELILR* |
Ga0126383_125525141 | 3300010398 | Tropical Forest Soil | VARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILN* |
Ga0134127_100583791 | 3300010399 | Terrestrial Soil | EDVARKVIGTTEVQNKARVARNGYRKLLGSELIRELILK* |
Ga0134122_115860421 | 3300010400 | Terrestrial Soil | AQKVIGSTEVQNKARVARNEYRKVLRRYYIRELILK* |
Ga0134121_108715081 | 3300010401 | Terrestrial Soil | YGGNIGDKGIEGEYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK* |
Ga0124850_10751472 | 3300010863 | Tropical Forest Soil | VQLEEVSKKVVGSTQVQNKDSAVRNEYRRVLGTEYIRELILK* |
Ga0137392_112273711 | 3300011269 | Vadose Zone Soil | AFDKGAELEDVAKQVIGSTEFQNKARVHRNDYRKVLGTEYIRELILK* |
Ga0137391_111962713 | 3300011270 | Vadose Zone Soil | GDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0136627_10171961 | 3300012042 | Polar Desert Sand | LIGGAEELAVAEKFVGSAESQNKARIGRSDYRKVIGSELIREIILK* |
Ga0137388_105608341 | 3300012189 | Vadose Zone Soil | YVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK* |
Ga0137364_103424991 | 3300012198 | Vadose Zone Soil | KAVEFDAVAEKVICSTECQNKARVGRNEYRKVLRREYIRQLILK* |
Ga0137364_108473002 | 3300012198 | Vadose Zone Soil | VARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0137382_106466251 | 3300012200 | Vadose Zone Soil | GGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0137365_102284723 | 3300012201 | Vadose Zone Soil | YGGNLGDKGIEQEYVARKVIGSTEVQNKKRVERSAYRRVLGIELIREIILK* |
Ga0137363_1003540911 | 3300012202 | Vadose Zone Soil | AAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK* |
Ga0137363_109255052 | 3300012202 | Vadose Zone Soil | VARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK* |
Ga0137362_110303162 | 3300012205 | Vadose Zone Soil | KVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK* |
Ga0137362_115150421 | 3300012205 | Vadose Zone Soil | RKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK* |
Ga0137381_115309091 | 3300012207 | Vadose Zone Soil | KKVIGSTQVQNNARVARNEYRKLLGSELIRELILK* |
Ga0137376_108724261 | 3300012208 | Vadose Zone Soil | KVIGSTELQNKARVGRNEYRKVLGNEYVREVILK* |
Ga0137376_109316642 | 3300012208 | Vadose Zone Soil | KGIEQEYVARNVIGSTEFQNKKRVERRVYRKDMGIELIREIILK* |
Ga0137378_106515411 | 3300012210 | Vadose Zone Soil | ENVAKKVICTTECQNKARVARSVYRKVLGTELIRELILK* |
Ga0137377_104089841 | 3300012211 | Vadose Zone Soil | DKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0137384_102997341 | 3300012357 | Vadose Zone Soil | ENVAKKVICTTECQNEARVARSVYRKVLGTELIRELILK* |
Ga0137360_102195841 | 3300012361 | Vadose Zone Soil | KNGAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK* |
Ga0137360_110556031 | 3300012361 | Vadose Zone Soil | EAVAKKVIGSTEVQNKARVGRNEYRKLLGSELIRELILK* |
Ga0137361_118602252 | 3300012362 | Vadose Zone Soil | MAALDKGIEEENVAKKVIGSTEVQNKARVVRNEYRKVLGTELIRELILR* |
Ga0137390_110666202 | 3300012363 | Vadose Zone Soil | AAYGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0157317_10335742 | 3300012475 | Arabidopsis Rhizosphere | MSDSPIFSLRPAFEAGDIRDKGIEQEYVARNVIGSTEFQNKKRVERSEYRKVLGTELIREIILK* |
Ga0157338_10660992 | 3300012515 | Arabidopsis Rhizosphere | MSDSPIFSLIPAFEAGDIRDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0137358_100513221 | 3300012582 | Vadose Zone Soil | AAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK* |
Ga0137358_107947791 | 3300012582 | Vadose Zone Soil | KVIGSTEVQNKKRVERSAYRKVLGIELIREIILK* |
Ga0137398_100454323 | 3300012683 | Vadose Zone Soil | DRGVEEEEIAKKVIGSTEVQNKARVGRNEYRKVLRREYVREIILK* |
Ga0137398_100622461 | 3300012683 | Vadose Zone Soil | DKGVEQEEVAKKVIGSTEFQNKARVARSEYRKVLGTELIREIILK* |
Ga0137398_100963261 | 3300012683 | Vadose Zone Soil | NAAAALDKGVELEYVARKVICNTECQNKARAARSEYRKVMGIECIRELILK* |
Ga0137398_111329562 | 3300012683 | Vadose Zone Soil | DRGVEEEEIAKKVIGSTEVQNKARVGRNEYRKVLRREYVRELILK* |
Ga0157286_103544882 | 3300012908 | Soil | EAVAEKVIGSAEVQDRARVERSEYRKVLGSELIRELILK* |
Ga0137395_100536191 | 3300012917 | Vadose Zone Soil | VELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK* |
Ga0137395_103213303 | 3300012917 | Vadose Zone Soil | ARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK* |
Ga0137396_103975171 | 3300012918 | Vadose Zone Soil | YVARKVIGSTEFQNKKRVQRSEYRKVLGIELIREIILK* |
Ga0137394_102450001 | 3300012922 | Vadose Zone Soil | VAKKVICNTECQNKARVVRNGYRKVLGTEYVRELVLK* |
Ga0137359_103681711 | 3300012923 | Vadose Zone Soil | NGAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK* |
Ga0137359_114489291 | 3300012923 | Vadose Zone Soil | KVIGSTEFQNKKRVERSGYRKVLGIELIREIILK* |
Ga0137359_115708551 | 3300012923 | Vadose Zone Soil | YGGNIGDKGIEEEYVARKVIGSTEVQNKKRVERSAYRKVLGLELIREIILK* |
Ga0137419_113069521 | 3300012925 | Vadose Zone Soil | KGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0137416_116719772 | 3300012927 | Vadose Zone Soil | YVARKVIGSTEVQNKKRVERSVYRKVLGTELIREIILK* |
Ga0137404_114899921 | 3300012929 | Vadose Zone Soil | IAKKVIGSTEVQNKARVGRNEYRKVLRREYVRELNLK* |
Ga0137407_119405632 | 3300012930 | Vadose Zone Soil | KVIGSTEFQNKKRVERSEYRKVLGIELTREIILK* |
Ga0126375_109236411 | 3300012948 | Tropical Forest Soil | IGDKGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0164301_100264793 | 3300012960 | Soil | LDRGVEEEEIAKKVIGSTEVQNKARVGRNEYRKALRREYVRELILK* |
Ga0126369_109529633 | 3300012971 | Tropical Forest Soil | GGNIGDKGIEEEYVARKVIGSTELQNKKRVERSAYRKVLGIELIREIILK* |
Ga0126369_110995142 | 3300012971 | Tropical Forest Soil | VAKKVIGSTEVQNKARVGRNEYRKVLGTEYIRELILK* |
Ga0126369_125534931 | 3300012971 | Tropical Forest Soil | NAAAALDKGVELEYVARNVIGSTEFQNKKRVERTGYRKVMGNEFIRELILK* |
Ga0126369_130562772 | 3300012971 | Tropical Forest Soil | GNIGDKGIEQEYVARKVIGSTEFQNKKRMERSEYRKVLGIELIREIILK* |
Ga0134087_102129981 | 3300012977 | Grasslands Soil | YVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0164309_104599211 | 3300012984 | Soil | DKGIEAEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0157373_104351782 | 3300013100 | Corn Rhizosphere | EEVAKKVIGSTELQNKARVGRNEYRKVLGNEYVREVILK* |
Ga0157373_110522202 | 3300013100 | Corn Rhizosphere | EEVAKKVIGSTELQNKARVGRNEYRKVFGNEYVREVILK* |
Ga0157369_125410851 | 3300013105 | Corn Rhizosphere | GVEEEAVAKKVICSTECQNKARVNRNEYRKVTRREYIRELVLK* |
Ga0157374_123170001 | 3300013296 | Miscanthus Rhizosphere | EQEYVARKVIGSTERQNKKRVERSEYRKVLGIELIREIILR* |
Ga0157378_123544731 | 3300013297 | Miscanthus Rhizosphere | IEQEYVARKVIGSTEFQNKKRVERSEYRKVLGVELIRELILK* |
Ga0163162_121943481 | 3300013306 | Switchgrass Rhizosphere | DVAKRVIGGTDFQNKARIGRNDYREVLGSELLRELILK* |
Ga0163162_133879632 | 3300013306 | Switchgrass Rhizosphere | KKVIGSTKVQNKARVARNEYRKLLGSELIRELILK* |
Ga0157372_114299292 | 3300013307 | Corn Rhizosphere | ELDEVAEKVIGSTEFQNKARVSRNQYRKVIGIEYVTEIVLK* |
Ga0157372_125245742 | 3300013307 | Corn Rhizosphere | DRGVEEEAVAKKVICSTECQNKARVNRNEYRKVTRREYIRELVLK* |
Ga0181517_102377411 | 3300014160 | Bog | NAAAALDKGVELEAVAKKVICSTECQNKARVARNEYRKVLGTELIRELILK* |
Ga0181537_102340211 | 3300014201 | Bog | LEAVAKKVIGSTETQNKARVGRNEYRKVWGSELIRELILK* |
Ga0163163_122563831 | 3300014325 | Switchgrass Rhizosphere | GIEGEYVARKVIGSTEFQNKKRVERTGYRKVLGIELIREIILK* |
Ga0182018_103618451 | 3300014489 | Palsa | GVELEDVAKKVICSTECQNKARVARSEYRKVLGTEYIRELILK* |
Ga0182018_104404711 | 3300014489 | Palsa | AAALDKRVELEDVAKKVICSTECQNKARMARSEYRKVLGEEYIRELILK* |
Ga0182015_104330564 | 3300014495 | Palsa | FKNGAAALDKGVELEEVAAQVICSTECQNKARVARGEYRRVLGTELIREVILK* |
Ga0157379_104441031 | 3300014968 | Switchgrass Rhizosphere | RKVIGSTEFQNKKRVERTGYRKVLGIELIREIILK* |
Ga0157376_112862552 | 3300014969 | Miscanthus Rhizosphere | ELEAVAKQVIGSTEVQNKARVARSEYRKVLGTEYIRELVLK* |
Ga0137411_11755274 | 3300015052 | Vadose Zone Soil | GDKGIEEEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK* |
Ga0137418_105763171 | 3300015241 | Vadose Zone Soil | KDASAALDKGVELEYVARKVIGSTEFQNKKRVERTGYRKVMGIECIRELILK* |
Ga0137412_101102221 | 3300015242 | Vadose Zone Soil | KNAAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGDEYIRELILK* |
Ga0137403_115606601 | 3300015264 | Vadose Zone Soil | GVEEEAVAKKVIGSTEFQNKARVARSDYRKVLRREYIRELILK* |
Ga0134085_101889881 | 3300015359 | Grasslands Soil | GGNIGDKGIEQEYVARKVIGSTEFQNKRRVERSEYRKVLGIELIREIILR* |
Ga0132258_106340911 | 3300015371 | Arabidopsis Rhizosphere | PIFSLIPAFEAGDIRDKGIEQEYVARKVIGSTEFQNQKRVERSEYRKVLGIELIREIILK |
Ga0132256_1000910655 | 3300015372 | Arabidopsis Rhizosphere | YGGNIGDKGIEGEYVARKVIGSTEFQNKKRVERTAYRKVLGTELIREIILK* |
Ga0132256_1002849672 | 3300015372 | Arabidopsis Rhizosphere | AAFDKGVELEEVAKTVIGSTEVQNKARAGRNEYRRVLGVEYVRELILRDAVGAISHV* |
Ga0132256_1002898091 | 3300015372 | Arabidopsis Rhizosphere | EAGDIRDKGIEQEYVARKVIGSTEFQNQKRVERSEYRKVLGIELIREIILK* |
Ga0132256_1031483991 | 3300015372 | Arabidopsis Rhizosphere | IEAEYVARKVIGSTEFQNKKRGERSEYRKVLGIELIREIILK* |
Ga0132256_1038207731 | 3300015372 | Arabidopsis Rhizosphere | GVEEEEVAKKVIGSTEFQNKKRVERSAYRKVLRREYIRELMLK* |
Ga0132257_1005798401 | 3300015373 | Arabidopsis Rhizosphere | MSDAPIFSLIPAFEAGDIRDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK* |
Ga0132257_1006477484 | 3300015373 | Arabidopsis Rhizosphere | KAIGSTEFQNKKRVERSAYRKVLGIELIREIILK* |
Ga0132257_1025914631 | 3300015373 | Arabidopsis Rhizosphere | EVIGSTEVQNKARVGRNEYRKLLGSELIRELILK* |
Ga0132257_1044394601 | 3300015373 | Arabidopsis Rhizosphere | DKGVEQEYVARKVIGSTEFQNKKRVERREYRKVLGIELIREIILR* |
Ga0132255_1033027931 | 3300015374 | Arabidopsis Rhizosphere | GGNIGDKGIEQEYVARNVIGSTEFQNKKRVERSEYRKVLGIELIREIILR* |
Ga0182041_121388811 | 3300016294 | Soil | EVAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0182034_101877393 | 3300016371 | Soil | GAAALDNGVELEDVAKKVIGSTEVQNKARVGRNEYRKVLGTEYIRELILK |
Ga0182040_115529522 | 3300016387 | Soil | DNGVALEEATKKVVGSTQVQNKASVGRNEYRKVLGTEYVRELILK |
Ga0182039_100321141 | 3300016422 | Soil | EQEEVAKKVIGTTEVQNKARVGRNQYRTVLGTEYVREIILK |
Ga0182038_116503761 | 3300016445 | Soil | KGVEQEEVAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0134112_102782931 | 3300017656 | Grasslands Soil | GDKGIEQEYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK |
Ga0134083_102802652 | 3300017659 | Grasslands Soil | DKGIEQEYVARKVIGSTEFQNKKRVERSGYRKVLGIELIREVILR |
Ga0187825_100225941 | 3300017930 | Freshwater Sediment | GMAAFDKGAELENVAKQVIGSTEFQNKARVHRNDYRKVLGTEYIRELILK |
Ga0187775_100763372 | 3300017939 | Tropical Peatland | LDKGVEQEEVAKKVIGSTEFQNKARVGRNDYRKVLGNEYIRELILK |
Ga0187808_101762743 | 3300017942 | Freshwater Sediment | GLDKGVEEEEVAKKVICSTECQNKARVGRNEYRKVLGYELFREIILK |
Ga0187785_103863402 | 3300017947 | Tropical Peatland | MAALDKEAEQEDVARKVIGSTEFQNKARVGRNDYRKVLGNEYIRELILK |
Ga0187847_102203792 | 3300017948 | Peatland | EAVAKKVIGSTEVQNKARVVRNEYRKVLGIEYIRELNLK |
Ga0187779_103905663 | 3300017959 | Tropical Peatland | VVEQEEVAKKVIGTTEVQNKARVGRNQYRTVLGTEYVREIILK |
Ga0187783_102825781 | 3300017970 | Tropical Peatland | KGVELEDVAKKVIGSTNFQNQARVGRNDYREVLGSELIREIVLK |
Ga0187783_111382811 | 3300017970 | Tropical Peatland | AKKVIGSTEFQNKARIGRNDYREVLGSEFIRELILK |
Ga0187781_100146461 | 3300017972 | Tropical Peatland | EEVAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0187781_107708171 | 3300017972 | Tropical Peatland | VAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0187777_109513682 | 3300017974 | Tropical Peatland | FKNGAAALDNGVELDDVAKKVIGSTDVQNKARVGRNEYRKVLGTEYIRELIVK |
Ga0187782_116385452 | 3300017975 | Tropical Peatland | AAALDKGVELEEVAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0187805_100961321 | 3300018007 | Freshwater Sediment | AKKVIGSTEFQNKARVARSEYRKVLGSELIREIILK |
Ga0187884_102766851 | 3300018009 | Peatland | MAASDKGIELEAVAKKVIGRTEVQNKARAARNEYRKLLGGELIREIILK |
Ga0187787_102228093 | 3300018029 | Tropical Peatland | DVARKVIGSTEFQNKARIGRNDYREVLGSELIRELILK |
Ga0187883_102420401 | 3300018037 | Peatland | VAKKVIGSTEVQNKARAGRNEYRKVLGTEYVRELILK |
Ga0187784_104754931 | 3300018062 | Tropical Peatland | VEQEDVAKKVIGSTEVQDKARIGRNEYRKVLGVEYVRELILK |
Ga0187772_110261571 | 3300018085 | Tropical Peatland | KKVIGSTEFQNKARVARSEYRKVLGTELIREIILK |
Ga0187772_114619541 | 3300018085 | Tropical Peatland | VAKKVIGRTRVQNEARVARNEYRKLLGGELIRELILK |
Ga0066655_100700923 | 3300018431 | Grasslands Soil | VARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0066655_101517891 | 3300018431 | Grasslands Soil | NIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELVREIILR |
Ga0066655_105940611 | 3300018431 | Grasslands Soil | EYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK |
Ga0066655_106007182 | 3300018431 | Grasslands Soil | ARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0066655_106333432 | 3300018431 | Grasslands Soil | IEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR |
Ga0066655_107102073 | 3300018431 | Grasslands Soil | VEEEEIAKKVIGSTEVQNKARVGRNEYRTALRREYVRELILK |
Ga0066667_107171001 | 3300018433 | Grasslands Soil | MAALDRGVEEEAVAKKVICSTECQNKARVGRNEYRKVTRREYIRELILK |
Ga0066667_109249162 | 3300018433 | Grasslands Soil | KGIEQEYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK |
Ga0066662_100921323 | 3300018468 | Grasslands Soil | GGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0066669_117119762 | 3300018482 | Grasslands Soil | GDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELTREIILK |
Ga0182031_12093144 | 3300019787 | Bog | MAALDKGVELEAVAKKVICSTECQNKARVARSQYRKVLGTEYIRELILK |
Ga0193723_10941821 | 3300019879 | Soil | IEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0193729_10471091 | 3300019887 | Soil | GEIGDKGIEAEYVARKVIGSTEFQNKKRVERTGYRKVLGTELIREIILK |
Ga0179592_102526182 | 3300020199 | Vadose Zone Soil | IGDKGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0179592_103935471 | 3300020199 | Vadose Zone Soil | AVAKKVIGSTEVQNKARVGRNEYRKLLGSELIRELILK |
Ga0210407_102616831 | 3300020579 | Soil | AKQVIGSTEFQNKARVHRNDYRKVLGTEYIRELILK |
Ga0210403_102466492 | 3300020580 | Soil | AKKVIGSTEFQNKARVARSEYRKVLGTELIREIILK |
Ga0210403_112644982 | 3300020580 | Soil | GDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLQ |
Ga0210395_112361591 | 3300020582 | Soil | YAGDNGDKGVELEAVAKKVICSTECQNEARVHRNEYRKVLGTELIRELILK |
Ga0210401_101027684 | 3300020583 | Soil | DKGVELEDVAKKVIGSTEVQNKARVFRNEYRKVLGTELIRELILK |
Ga0210401_104371721 | 3300020583 | Soil | ALDKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGTEYIRELILK |
Ga0210401_105348113 | 3300020583 | Soil | ARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR |
Ga0210401_105577971 | 3300020583 | Soil | AALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK |
Ga0210401_113287111 | 3300020583 | Soil | AKKVICSTECQNKARVARNEYRKVLGTEYVRELILK |
Ga0215015_106340212 | 3300021046 | Soil | MAGLDKGVEEEEVAKKVICSTECQNKARVARNEYRKVLGYELFREIILK |
Ga0210408_100360526 | 3300021178 | Soil | LDRGVEQEEVAKKVIGSIEVQNKARVGRNEYRKNMGVDLFREIILK |
Ga0210396_107577283 | 3300021180 | Soil | DKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGSEYIRELILK |
Ga0210388_102449004 | 3300021181 | Soil | VAKKVIGSTEVQNKARVFRNEYRKVLGTELIRELILK |
Ga0210388_114628801 | 3300021181 | Soil | GMAAFDKGAELEDVAKQVIGSTEFQNKARVHRNDYRKVLGTEYIRELILK |
Ga0213874_101372681 | 3300021377 | Plant Roots | QEYVARNVIGSTEVQNKARVARGAYRKVLGIELIREIILK |
Ga0210389_105271932 | 3300021404 | Soil | NAAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK |
Ga0210389_109680252 | 3300021404 | Soil | FKNAAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK |
Ga0210386_105849751 | 3300021406 | Soil | AKKVIGSTEVQNKARVFRNEYRKVLGTELIRELILK |
Ga0210386_112101271 | 3300021406 | Soil | AAALDKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGSEYIRELILK |
Ga0210394_100074941 | 3300021420 | Soil | AVAKKVICSTECQNKARVARSEYRKVLGNEYVRELILK |
Ga0210391_101307031 | 3300021433 | Soil | NAAAALDKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGTEYIRELILK |
Ga0213878_105290512 | 3300021444 | Bulk Soil | EAALDKGAELEDVAKQVIGSTEYQNKARQFRNQYRKVLGTELIRELILK |
Ga0210390_104101763 | 3300021474 | Soil | AAALDKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGTEYIRELILK |
Ga0210390_106902762 | 3300021474 | Soil | ITYKNAAAALDKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGSEYIRELILK |
Ga0210390_108007211 | 3300021474 | Soil | LDKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGSEYIRELILK |
Ga0210398_105471071 | 3300021477 | Soil | KNAAAALDKGVELEAVAKKVIGSTEFQNKARVARSEYRKVLGTELIRELILK |
Ga0210402_106537701 | 3300021478 | Soil | AAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGTELIRELLLK |
Ga0210402_111553841 | 3300021478 | Soil | ALDRGVEEEEIAKKVIGSTEVQNKARVGRNEYRKVLRREYVRELILK |
Ga0210402_116258511 | 3300021478 | Soil | MAALDKSGEEEVVAKTVIGSTEVQNKARVVRSEYRKVLGTEYIRELILK |
Ga0210409_106803971 | 3300021559 | Soil | EDVDKKVIGSTEVQNKARVFRNEYRKVLGTELIRELILK |
Ga0210409_112816861 | 3300021559 | Soil | TFKNAAAALDKGVELEGVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK |
Ga0210409_114075372 | 3300021559 | Soil | KGAEEEDVAKKVIGSTDFQNKARIGRNDYREILGSELLRELILK |
Ga0126371_101178512 | 3300021560 | Tropical Forest Soil | DVAKKVIGSTEVQNKARVGRNEYRKVLGTEYIRELVLK |
Ga0126371_110835641 | 3300021560 | Tropical Forest Soil | EYVARKVIGSTEFQNKKRVERNQYRKILGIELIREVVLK |
Ga0126371_119852811 | 3300021560 | Tropical Forest Soil | EEEVAKKVIGSTDFQNKARIGRNDYREVLGSELLRELILK |
Ga0126371_123452462 | 3300021560 | Tropical Forest Soil | GDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGTELIREIILR |
Ga0126371_125863212 | 3300021560 | Tropical Forest Soil | DKGVEQEEVAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0126371_127485642 | 3300021560 | Tropical Forest Soil | ELENVAKKTLGSTEVQNKTRAARSKYRKVLGTEYIRELVLQMK |
Ga0126371_129596841 | 3300021560 | Tropical Forest Soil | NGAAALDKGVELEEVAKKVIGSTEVQNKARVGRNEYRKVLGIEYVREIILK |
Ga0126371_130339421 | 3300021560 | Tropical Forest Soil | LEEVAKKVIGSTEVQNKARVGRNEYRKVLGTEYVRELVLK |
Ga0213880_100099871 | 3300021953 | Exposed Rock | LWIAFKNGMAALDKGADIEDVAKKVICSTECQNKARVFRNQYRKVLGTQLIREIILH |
Ga0213880_102072951 | 3300021953 | Exposed Rock | DKGVELEEVAKKVIGSTDVQNKARVGRNEYRKVLGTEYVREIILN |
Ga0242660_12397201 | 3300022531 | Soil | EVAKKVIGSTELQNKARVGRNEYRKVLGNEYVREVILK |
Ga0212123_103977441 | 3300022557 | Iron-Sulfur Acid Spring | DKGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0247693_10617852 | 3300024181 | Soil | VAKKVIGSTEFQNKARVARSEYRKVLGTELIREIILK |
Ga0179589_100394751 | 3300024288 | Vadose Zone Soil | VAKKVICSTECQIKARVARSEYRKVLGDEYIRELILK |
Ga0207656_105932142 | 3300025321 | Corn Rhizosphere | ALDRGVEEEAVAKKVICSTECQNKARVGRNEYRKVTRREYIRELILK |
Ga0208935_10611601 | 3300025414 | Peatland | VEQEEVAKKVICNTECQNKARVVRNGYRKVLGTELIREIILK |
Ga0207692_108599051 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KKVIGSTEVQNKARVARNEYRKVLGDELIRELILK |
Ga0207647_100176786 | 3300025904 | Corn Rhizosphere | DNGVELEEVAKKVIGSTELQNKARVGRNEYRKVFGNEYVREVILK |
Ga0207647_102608692 | 3300025904 | Corn Rhizosphere | DNGVELEEVAKKVIGSTELQNKARVGRNEYRKVLGNEYVREVILK |
Ga0207699_114246291 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LWITYKNMADLDRGVEEEEVAKKVICSTECQNKARVGRNEYRKVLRREYIRELILK |
Ga0207671_113429872 | 3300025914 | Corn Rhizosphere | EDVAKKVIGGTDFQNKARIGRNDYREVLGSELLRELILK |
Ga0207693_103209281 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGVELIRELILK |
Ga0207693_104402731 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0207693_107133323 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0207693_107729822 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GNIGDKGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0207663_116485712 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LEDVAKKVIGSTDLQNKARVGRNDYRKVLGNEYIRELILK |
Ga0207652_106989631 | 3300025921 | Corn Rhizosphere | KGVEQEEVAKKVIGSTEVQNKARVGRNDYRKVLGIEYVRELILK |
Ga0207687_103247223 | 3300025927 | Miscanthus Rhizosphere | VAKQVIGSTEVQNKARVHRNDYRKVMGTELIRELILK |
Ga0207700_102198432 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EQEEVAKKVIGSTEFQNKARVARSEYRKVLGTELIREIILK |
Ga0207700_104569763 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | NMAALDRGVEEEAVAKKVICSTECQNKARVGRNEYRKVTRREYIRELILK |
Ga0207664_105831883 | 3300025929 | Agricultural Soil | AVAEKVIGSTEVQNQARVGRNEYRTVLGAELIRELVLK |
Ga0207664_119707142 | 3300025929 | Agricultural Soil | GVEEEAVAKKVICSTECQNKARAGRNEYRKVTRREYIRELILK |
Ga0207701_100987121 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR |
Ga0207665_100953712 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EEVAKKVIGSTEFQNKARVSRNQYRKVLGIEYVRELILK |
Ga0207711_108270951 | 3300025941 | Switchgrass Rhizosphere | VAKKVIGSTEVQNKARVGRSAYRKVLRRYYIRELILK |
Ga0207661_105694781 | 3300025944 | Corn Rhizosphere | AALDNGVELEEVAKKVIGSTELQNKARVGRNEYRKVLGNEYVREVILK |
Ga0207667_101066834 | 3300025949 | Corn Rhizosphere | AALDNGVELEEVAKKVIGSTELQNKARVGRNEYRKVFGNEYVREVILK |
Ga0207651_115526321 | 3300025960 | Switchgrass Rhizosphere | IEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0207712_115264021 | 3300025961 | Switchgrass Rhizosphere | LDKSVELEDVARKVIGSTEVQNKARIDRNDYRKVLGIEHIREIILE |
Ga0207640_100903694 | 3300025981 | Corn Rhizosphere | VAKKVIGSTELQNKARVGRNEYRKVFGNEYVREVILK |
Ga0207708_106873922 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | KGAELEDVAKQVIGSTEFQNKARVHRNDYRKVLGTEYIRELILK |
Ga0207641_124764552 | 3300026088 | Switchgrass Rhizosphere | MAALDRSVEEEEIAKKVIGSTEYQNKARVARNEYRKVLRREYVRELILK |
Ga0209265_10179933 | 3300026308 | Soil | RKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK |
Ga0209265_10558143 | 3300026308 | Soil | NIGDKGVEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0209268_11667441 | 3300026314 | Soil | QEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0209155_11969292 | 3300026316 | Soil | GNIGDKGIEQEYVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK |
Ga0209801_100059226 | 3300026326 | Soil | GGNIGDKGIEGEYVARKVIGSTEFQNKKRVQRSEYRKVLGIELIREIILK |
Ga0209375_11334702 | 3300026329 | Soil | VARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0209375_11903361 | 3300026329 | Soil | GNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0209473_11989052 | 3300026330 | Soil | GIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR |
Ga0209803_11838702 | 3300026332 | Soil | QEYVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK |
Ga0209377_13459632 | 3300026334 | Soil | GGNIGDKGIEQEYVARKVIGSTEVQNKKRVERSAYRKVLGIELIREIILK |
Ga0209159_11800391 | 3300026343 | Soil | YVARKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK |
Ga0257171_10317232 | 3300026377 | Soil | EEVAKKVICSTECQNKARVGRNQYRKVLGIEYVRELILK |
Ga0257155_10113221 | 3300026481 | Soil | AYGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK |
Ga0257157_10070272 | 3300026496 | Soil | MAALDKGVELEAVAKQVIGTTEVQNKARVHRNDYRKVMGGELFRELILK |
Ga0209808_12088301 | 3300026523 | Soil | GKVIGSTEFQNKKRVERSGYRKVLGIELIREIILK |
Ga0209378_12140911 | 3300026528 | Soil | EYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK |
Ga0209805_12260551 | 3300026542 | Soil | DKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK |
Ga0209577_108669701 | 3300026552 | Soil | LEEVAKKVIGSTDVQNKARVGRNEYRKVLGTEYIRELILK |
Ga0207777_10903242 | 3300027330 | Tropical Forest Soil | MGVELEEVAKKVIGSTEVQNKARVGRNEYRKVLDIEFIRELILK |
Ga0209418_10004671 | 3300027371 | Forest Soil | KKVIGSTEFQNKARVGRNEYRKVLRREYVRELILK |
Ga0209004_10589722 | 3300027376 | Forest Soil | MAALDNRNKLEAVAEETIDSTEVQNKARVGRSEYRKVLGTELIREAILK |
Ga0209684_10135201 | 3300027527 | Tropical Forest Soil | GAAALDKGVELEEVAKKMIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0209008_10067284 | 3300027545 | Forest Soil | EEAVAKKVICSTECQNKARVARSEYRKVLGSEYIRELYLK |
Ga0209116_10981392 | 3300027590 | Forest Soil | KNAAAALDKGVELEAVAKKVICSTECQNKARVGRSEYRKVLGTEYIRELILK |
Ga0209528_10549552 | 3300027610 | Forest Soil | EEEEVAKKVICSTECQNAARVHRSEYRKILRREYIRELFLK |
Ga0209007_10304211 | 3300027652 | Forest Soil | ALDKGVELEAVAKKVIGSTEVQNKARVARNEYRKVLGNEYIRELILK |
Ga0209073_105064231 | 3300027765 | Agricultural Soil | EEEDVARKVIRTTEVQNKARVARNGYRKLLGSELIRELILK |
Ga0209811_100858693 | 3300027821 | Surface Soil | GNIGDKGIEQEYVARKVIGSTELQNKKRVERSAYRKVLGIELIREVILK |
Ga0209060_100017126 | 3300027826 | Surface Soil | MAEKVIGSLELQNKRRVERTQYRTVLGSELVRELVLS |
Ga0209517_106056852 | 3300027854 | Peatlands Soil | GVEEEEVAKKVIGSTPVQNKARVARNEYRKVLGYELFRELILK |
Ga0209275_101184271 | 3300027884 | Soil | ITYKNAAAALDKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGTEYIRELILK |
Ga0209275_103143821 | 3300027884 | Soil | EEEAVAKKVICSTECQNKARVGRNEYRKVLRREYIRELILK |
Ga0209068_104067222 | 3300027894 | Watersheds | EEEEVAKKVICNTECQNKARVGRNEYRKVLRREYIRELILK |
Ga0209006_101221571 | 3300027908 | Forest Soil | AAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK |
Ga0209006_106519181 | 3300027908 | Forest Soil | KGVEEEAVAKKVIGSTEVQNKARVGRNEYRRLLGSELIRELILK |
Ga0209006_108136421 | 3300027908 | Forest Soil | AALDKGVELEAVAKKVICSTECQNKARVGRNDYRRVLGTEYIRELILK |
Ga0209006_110626961 | 3300027908 | Forest Soil | AAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK |
Ga0209168_102081822 | 3300027986 | Surface Soil | SGITYKNMGALDRGVEEEEVAKKVICSTECQNAARVHRNEYRKVLRREYIRELFLK |
Ga0247683_10012573 | 3300027991 | Soil | EAVAREVIGSTEVQNKARVARNEYRKLLGSELIRELILK |
Ga0268266_102460541 | 3300028379 | Switchgrass Rhizosphere | ARKVIGSTEFQNKKRVERTGYRKVLGIELIREIILK |
Ga0302147_103351551 | 3300028566 | Bog | IELEAVSKKVIGSTKVKNKARVARNEYRKLLGSELIREVILK |
Ga0302233_100264531 | 3300028746 | Palsa | VELEDVAKKVICSTECQNKARVARSEYRKVLGTEYIRELILK |
Ga0302231_101795112 | 3300028775 | Palsa | AALDKGVEEEAVAKKVIGSTEVQNKARVARTEYRKVLGSEYIRELILK |
Ga0302227_103549831 | 3300028795 | Palsa | WITFKNAAAALDKGVELEDVAKKVICSTECQNKARVARSEYRKVLGTEYIRELILK |
Ga0302221_103808091 | 3300028806 | Palsa | GIEEEAVAKKVIGSTEFQNKARVARNEYRKVLSREYIRELILK |
Ga0302228_102120262 | 3300028808 | Palsa | DGEQDEVAKKVICSTECQDKARVARNGYRKVLGIELIRELILK |
Ga0302235_102380712 | 3300028877 | Palsa | REAVAKKVIGRTEVQNKARVARNEYRKLLGSELIREVILK |
Ga0307308_104142262 | 3300028884 | Soil | NIGDKGIEQEYVARKVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0308309_110930661 | 3300028906 | Soil | VAKKVICSTECQNKARVGRNEYRKVLGSEYIRELILK |
Ga0222749_104857542 | 3300029636 | Soil | VARKVIGSTEFQNKKRVERSEYRKVLGIELIREIFLK |
Ga0311368_103358063 | 3300029882 | Palsa | EEEVAKKVIGSTPVQDKARVARNEYRKVLGYELFRELILK |
Ga0311368_108892532 | 3300029882 | Palsa | RVELEDVAKKVICSTECQNKARVARSEYRKVLGEEYIRELILK |
Ga0311352_115081382 | 3300029944 | Palsa | ELEAVAKKVICSTECQNKARVARSEYRRVLGIEYIRELYLK |
Ga0311371_104116163 | 3300029951 | Palsa | ALDKGVEQEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK |
Ga0311371_109558542 | 3300029951 | Palsa | YKNAAAALDKGVELEAVAKKVIGSTEVQNKARVARSEYRKVLGNEYIRELILK |
Ga0311371_126705992 | 3300029951 | Palsa | AVAGKVICSTECQNKARVVRNGYRKVLGTELVRELILK |
Ga0311339_1001179815 | 3300029999 | Palsa | KNAAAALDNGIEIEYVARNVICSTECQNKARVGRNEYRKVLGTELIRELILK |
Ga0311339_117696781 | 3300029999 | Palsa | AVARKVICSTECQNKARVGRNEYRKLLGTELIRELILK |
Ga0311338_104289532 | 3300030007 | Palsa | KNAAAALDKGVELEAVAKKVICSTECQNKARVARSEYRRVLGIEYIRELYLK |
Ga0302177_106191111 | 3300030053 | Palsa | GLDKGVEEEEVAKKVIGSTPVQDKARVARNEYRKVLGYELFRELILK |
Ga0311353_100476244 | 3300030399 | Palsa | KGVELEAVAKKVIGSTEVQNKARVARSEYRKVLGNEYIRELILK |
Ga0311353_113420331 | 3300030399 | Palsa | DKGVEEEAVAKKVIGSTEVQNKARVARTEYRKVLGTEYIRELILK |
Ga0311370_1001197415 | 3300030503 | Palsa | NGIEIEYVARNVICSTECQNKARVGRNEYRKVLGTELIRELILK |
Ga0311370_100746661 | 3300030503 | Palsa | VAKKVICSTECQNKARVARSEYRKVLGTEYIRELILK |
Ga0311370_102925126 | 3300030503 | Palsa | AAALDKGVELEEVAAQVICSTECQNKARVARGEYRRVLGTELIREVILK |
Ga0311372_100203781 | 3300030520 | Palsa | LWITFKNAAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKLLGSEYIRELILK |
Ga0311372_103680533 | 3300030520 | Palsa | KGVELEAVAKKVICSTECQNKGRVARSEYRKVMGSEYIREIILK |
Ga0311372_129446891 | 3300030520 | Palsa | VAKKVIGSTELQNKARVGRNEYRKVLGTEVIRELILK |
Ga0311357_103356301 | 3300030524 | Palsa | DAVARKVICSTECQNKARVGRNEYRKLLGTELIRELILK |
Ga0311355_114953141 | 3300030580 | Palsa | ALDKGVELEAVAKKVICSTECQNKARVGRNEYRKVLGTEYVRELILK |
Ga0316363_104354852 | 3300030659 | Peatlands Soil | EEVAKKVIGSTPVQNKARVARNEYRKVLGYELFRELILK |
Ga0302310_100884206 | 3300030737 | Palsa | AELEAVAKKVICSTECQNKARVGRNEYRKVLGTEYIRELILK |
Ga0302311_104964812 | 3300030739 | Palsa | EAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK |
Ga0265750_10120881 | 3300030813 | Soil | RKVIGSTEFQNKKRVERTGYRKVLGTELIREVILK |
Ga0075395_100321491 | 3300030973 | Soil | AAYGGNIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR |
Ga0170834_1039204702 | 3300031057 | Forest Soil | GDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0170823_109311501 | 3300031128 | Forest Soil | RKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR |
Ga0170824_1078558001 | 3300031231 | Forest Soil | FKDAAAALDKGVELEEVARQVIGSTEVQNKARVARSEYRKALGTEYIRELILK |
Ga0170824_1149697212 | 3300031231 | Forest Soil | KNAAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKVLGTEYIRELILR |
Ga0302307_100677411 | 3300031233 | Palsa | LDKGVELEAVAKKVIGSTEVQNKARVARSEYRKVLGNEYIREVILK |
Ga0302325_113122841 | 3300031234 | Palsa | KKVIGSTEVQNKARVGRNEYRKVLGSELIRELILK |
Ga0302325_115870903 | 3300031234 | Palsa | GVELEEVAKKVIGSTEVQNKARVFRNEYRKVLGTELIRELILR |
Ga0302324_1011874691 | 3300031236 | Palsa | TYKNAAAALDKGVELEAVAKKVICSTECQNKARVARSEYRKLLGNEYIRELILK |
Ga0302324_1016129641 | 3300031236 | Palsa | VELEAVAKKVICSTECQNKARVARSEYRKVMGSEYIREIILK |
Ga0170820_170135992 | 3300031446 | Forest Soil | ARKVIGSTEFQNKKRVERTGYRKVLGIELIREVILK |
Ga0170819_168955121 | 3300031469 | Forest Soil | RNVIGSTEFQNKKRVERSEYRKVLGIELIREIILR |
Ga0170819_170186044 | 3300031469 | Forest Soil | ARNVIGSTEFQNKKRVERSVYRKVLGIELIREIILK |
Ga0170818_1050846472 | 3300031474 | Forest Soil | LEAVAKKVICTTECQNKARVGRNEYRKVLGTELIRELILK |
Ga0170818_1057043163 | 3300031474 | Forest Soil | RKVIGSTEFQNKKRVKRSEYRKVLGIELIREIILR |
Ga0302326_100047831 | 3300031525 | Palsa | AVAKKVICSTECQNKARVGRNEYRKVLRREYIRELILK |
Ga0302326_105577442 | 3300031525 | Palsa | NAAAAFDKGVELEDVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK |
Ga0302326_112590401 | 3300031525 | Palsa | ELEAVAKTVICSTECQNKARVGRNEYRKVLGIEYIRELILK |
Ga0302326_135573131 | 3300031525 | Palsa | MAALDKGVELEAVARKVICSTECQNKARVARSAYRKVLGNEYIRELILK |
Ga0318541_100389021 | 3300031545 | Soil | EQEEVAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0307508_105542111 | 3300031616 | Ectomycorrhiza | GGNIGDKGIEAEYVARKVIGSTELQNKKRVERTGYRKVLGTELIREVILK |
Ga0318561_106613922 | 3300031679 | Soil | YGGNIGDKGIEAEYVARKVIGSTEFQNKKRVERSEYRKVLGSELIREIILR |
Ga0318560_102116691 | 3300031682 | Soil | NMAAALDKVVEQEEVAKKVIGTTEVQNKARVGRNQYRTVLGTEYVREIILK |
Ga0310686_1033447511 | 3300031708 | Soil | KGVELEAVAKQVICSTECQNKARVARSEYRKVLGTDYIRELILK |
Ga0307476_106995992 | 3300031715 | Hardwood Forest Soil | GVELEAVAKKVIGSTEVQNKARVARSEYRKVLGTEYIRELILR |
Ga0306917_107322472 | 3300031719 | Soil | AKKVIGTTEVQNKARVGRNQYRTVLGTEYVREIILK |
Ga0307469_101342641 | 3300031720 | Hardwood Forest Soil | LDKGVELEAVAKQVIGTTEVQNKARVHRNDYRKVMGGELFRELILK |
Ga0318500_101927421 | 3300031724 | Soil | LEEVAKRVIGSTEVQNKARVGRNEYRKVLGTEYVREILLK |
Ga0307473_114919881 | 3300031820 | Hardwood Forest Soil | VEEEDVAKKVIGSTEFQNKARVGRNEYRKVLRREYIRELILK |
Ga0318564_104518181 | 3300031831 | Soil | LDKVVEQEEVAKKVIGTTEVQNKARVGRNQYRTVLGTEYVREIILK |
Ga0310917_103050311 | 3300031833 | Soil | RGVEEEAIAKRVIGSTEVQNKARVGRNEYRKVLRREYIREIILK |
Ga0310917_106957241 | 3300031833 | Soil | AKRVIGSTEVQNKARVGRNEYRKVLGTEYVREILLK |
Ga0302315_102237493 | 3300031837 | Palsa | DKGIELEAVAKKVIGGTEVQNKARLARNEYRKLLGSELIREIILR |
Ga0318520_104738162 | 3300031897 | Soil | EYVARNVIGSTEFQNKKRVERSAYRKVLGIELIREIILK |
Ga0306923_103081693 | 3300031910 | Soil | AFDKGVALEDVAKKVIGSTEVQNKARVGRNDYRKVLGIEYVRELILK |
Ga0306923_108778771 | 3300031910 | Soil | RNVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0306921_123506133 | 3300031912 | Soil | VELEEVAKKVIGSTEVQNKARVGRSQYRKVLGIEYVRELILK |
Ga0310912_114415721 | 3300031941 | Soil | TAALDKGVEQEEVAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0310913_102262033 | 3300031945 | Soil | RKVIGSTEFQNKKRVERSEYRKVLGTELIREIILK |
Ga0310913_110438442 | 3300031945 | Soil | MDKVVEQEEVAKKVIGTTEVQNKARVGRNQYRTVLGTEYVREIILK |
Ga0310910_110154501 | 3300031946 | Soil | EEEVAKKVIGSTDLQNKARIGRNDYREVLGSELFRELILK |
Ga0310910_110248462 | 3300031946 | Soil | VAKRVIGSTEVQNKARVGRNEYRKVLGTEYVREILLK |
Ga0310909_104219582 | 3300031947 | Soil | DKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILR |
Ga0307479_102660583 | 3300031962 | Hardwood Forest Soil | ALDKGVELEAVAKQVIGTTEVQNKARVHRNDYRKVMGGELFRELILK |
Ga0307479_109796633 | 3300031962 | Hardwood Forest Soil | EYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0306922_101560654 | 3300032001 | Soil | DNGVELEDVAKKVIGSTDVQNKARVGRNEYRKVLGTEYIRELTLK |
Ga0306922_119237871 | 3300032001 | Soil | EEEDVAKRVIGNTEFQNKARIGRNDYREVLGSELIRELILK |
Ga0306922_124282882 | 3300032001 | Soil | NGAAALDNDVELEDVAKKVIGSTDVQNKARVGRNEYRKVLGTEYIRELILK |
Ga0318507_103498972 | 3300032025 | Soil | EYVARKVIGSTEFQNKKRVERSEYRKVLGSELIREIILR |
Ga0310911_102905561 | 3300032035 | Soil | AAALDKGVEQEEVAKKVIGSTEVQNKARVGRNQYRKVLGIEYVRELILK |
Ga0310911_107721992 | 3300032035 | Soil | LDKGVELEEVAKRVIGSTEVQNKARVGRNEYRKVLGTEYVREILLK |
Ga0310911_108211921 | 3300032035 | Soil | DKVVEQEEVAKKVIGTTEVQNKARVGRNQYRTVLGTEYVREIILK |
Ga0318545_103583642 | 3300032042 | Soil | IEAEYVARKVIGSTEFQNKKRVERSEYRKVLGSELIREIILR |
Ga0318506_104049301 | 3300032052 | Soil | KKVIGTTEVQNKARVGRNQYRTVLGTEYVREIILK |
Ga0318505_102124622 | 3300032060 | Soil | EVAKKVIGTTEAQNKARVGRNQYRTVLGTEYVREIILK |
Ga0306924_107435671 | 3300032076 | Soil | NIGDKGIEQEYVARKVIGSTEFQNKKRVERSEYRKVLGTELIREIILK |
Ga0306924_116727333 | 3300032076 | Soil | QEYVARKVIGSTEFQNKKRVERSEYRKVLGIELIREIILK |
Ga0307471_1002114604 | 3300032180 | Hardwood Forest Soil | GDKGIEQEYVARKVIGSTEFQNKKRVERSEYRRVLGIELIREIILR |
Ga0307471_1003697054 | 3300032180 | Hardwood Forest Soil | KGVELEAVAKKVICSTECQNKARVGRNEYRKVLGTEYIRELILK |
Ga0307471_1024358411 | 3300032180 | Hardwood Forest Soil | LEEVAKKVICNTECQNKARVVRNGYRKVLGTEYVRELVLK |
Ga0307471_1026086361 | 3300032180 | Hardwood Forest Soil | KGVELEAVAKKVICSTECQNKARVARSEYRKVLGNEYIRELILK |
Ga0307472_1007016413 | 3300032205 | Hardwood Forest Soil | ITFKNGAAALDNGVALEDVAKKVIGSTDVQNKGRVGRNEYRTVLGSEYIRELVLK |
Ga0310914_111932401 | 3300033289 | Soil | FKNGAAALDKGVELEEVAKRVIGSTEVQNKARVGRNEYRKVLGTEYVREILLK |
Ga0310914_117039601 | 3300033289 | Soil | EEEDVAKKVIGSTEFQNKARIGRNDYREVLGSELIRELILK |
Ga0310811_106027623 | 3300033475 | Soil | GVELEEVAKKVIGSTELQNKARVGRNEYRKVFGNEYVREVILK |
Ga0334854_033711_1016_1165 | 3300033829 | Soil | MAALDRGVEEGAVAKKVICSTECQNKARVGRNEYRKVLRREYIRELILK |
⦗Top⦘ |