Basic Information | |
---|---|
Family ID | F003582 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 478 |
Average Sequence Length | 46 residues |
Representative Sequence | MNTYKVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Number of Associated Samples | 238 |
Number of Associated Scaffolds | 478 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 14.32 % |
% of genes near scaffold ends (potentially truncated) | 25.73 % |
% of genes from short scaffolds (< 2000 bps) | 67.99 % |
Associated GOLD sequencing projects | 221 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (57.950 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (16.109 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.954 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.155 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.00% β-sheet: 0.00% Coil/Unstructured: 84.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 478 Family Scaffolds |
---|---|---|
PF05257 | CHAP | 43.10 |
PF02467 | Whib | 13.18 |
PF00082 | Peptidase_S8 | 2.51 |
PF00255 | GSHPx | 1.26 |
PF09834 | DUF2061 | 1.05 |
PF00085 | Thioredoxin | 1.05 |
PF00011 | HSP20 | 0.63 |
PF02511 | Thy1 | 0.42 |
PF00565 | SNase | 0.42 |
PF00106 | adh_short | 0.21 |
PF07691 | PA14 | 0.21 |
PF13385 | Laminin_G_3 | 0.21 |
PF03819 | MazG | 0.21 |
PF00877 | NLPC_P60 | 0.21 |
PF00436 | SSB | 0.21 |
PF01755 | Glyco_transf_25 | 0.21 |
PF00154 | RecA | 0.21 |
PF13384 | HTH_23 | 0.21 |
PF13884 | Peptidase_S74 | 0.21 |
PF00210 | Ferritin | 0.21 |
PF00227 | Proteasome | 0.21 |
PF02075 | RuvC | 0.21 |
PF13542 | HTH_Tnp_ISL3 | 0.21 |
PF04586 | Peptidase_S78 | 0.21 |
COG ID | Name | Functional Category | % Frequency in 478 Family Scaffolds |
---|---|---|---|
COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 1.26 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.42 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.21 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.21 |
COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.21 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.21 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.21 |
COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.21 |
COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.21 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.21 |
COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.21 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.64 % |
Unclassified | root | N/A | 17.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035265000|ErSWdraf_F5BXKTZ02I1I30 | Not Available | 532 | Open in IMG/M |
2166559019|stn_contig02975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300000736|JGI12547J11936_1006000 | All Organisms → cellular organisms → Bacteria | 3283 | Open in IMG/M |
3300000756|JGI12421J11937_10002811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 7008 | Open in IMG/M |
3300000882|FwDRAFT_10005231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5768 | Open in IMG/M |
3300001842|RCM30_1010027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1770 | Open in IMG/M |
3300001847|RCM41_1005037 | Not Available | 9118 | Open in IMG/M |
3300001850|RCM37_1098870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1652 | Open in IMG/M |
3300001851|RCM31_10375436 | Not Available | 633 | Open in IMG/M |
3300001968|GOS2236_1023277 | Not Available | 1669 | Open in IMG/M |
3300001968|GOS2236_1055094 | All Organisms → cellular organisms → Bacteria | 3616 | Open in IMG/M |
3300002161|JGI24766J26685_10007667 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
3300002161|JGI24766J26685_10090030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300002161|JGI24766J26685_10110778 | Not Available | 581 | Open in IMG/M |
3300002408|B570J29032_109447738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300002835|B570J40625_100014384 | Not Available | 13953 | Open in IMG/M |
3300002835|B570J40625_100015793 | Not Available | 13197 | Open in IMG/M |
3300002835|B570J40625_100050206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5956 | Open in IMG/M |
3300002835|B570J40625_100519219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300002835|B570J40625_100788912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300002835|B570J40625_101154890 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300002835|B570J40625_101214536 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300002835|B570J40625_101696943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300003277|JGI25908J49247_10009214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3097 | Open in IMG/M |
3300003430|JGI25921J50272_10010309 | All Organisms → cellular organisms → Bacteria | 2766 | Open in IMG/M |
3300003430|JGI25921J50272_10094412 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300003430|JGI25921J50272_10127325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300004112|Ga0065166_10295468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300004112|Ga0065166_10378450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300004112|Ga0065166_10523099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300004240|Ga0007787_10131414 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300004795|Ga0007756_11634138 | Not Available | 595 | Open in IMG/M |
3300004796|Ga0007763_11477558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300005417|Ga0068884_1560871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300005525|Ga0068877_10306848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300005527|Ga0068876_10040268 | All Organisms → cellular organisms → Bacteria | 2883 | Open in IMG/M |
3300005527|Ga0068876_10086935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1872 | Open in IMG/M |
3300005527|Ga0068876_10108643 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
3300005527|Ga0068876_10127304 | Not Available | 1507 | Open in IMG/M |
3300005527|Ga0068876_10130506 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
3300005527|Ga0068876_10228543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1072 | Open in IMG/M |
3300005527|Ga0068876_10233326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
3300005527|Ga0068876_10278541 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300005527|Ga0068876_10398832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300005527|Ga0068876_10432319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 730 | Open in IMG/M |
3300005527|Ga0068876_10488247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 677 | Open in IMG/M |
3300005527|Ga0068876_10676083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300005527|Ga0068876_10677879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300005527|Ga0068876_10699447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300005528|Ga0068872_10178282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
3300005528|Ga0068872_10206975 | Not Available | 1117 | Open in IMG/M |
3300005528|Ga0068872_10543590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300005528|Ga0068872_10574185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300005528|Ga0068872_10617756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300005580|Ga0049083_10038518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1700 | Open in IMG/M |
3300005581|Ga0049081_10021486 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
3300005581|Ga0049081_10044002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1693 | Open in IMG/M |
3300005582|Ga0049080_10110364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300005584|Ga0049082_10009789 | Not Available | 3225 | Open in IMG/M |
3300005662|Ga0078894_10039956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3922 | Open in IMG/M |
3300005662|Ga0078894_10071743 | All Organisms → cellular organisms → Bacteria | 2993 | Open in IMG/M |
3300005662|Ga0078894_10105453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2492 | Open in IMG/M |
3300005662|Ga0078894_10132788 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
3300005662|Ga0078894_10384948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300005662|Ga0078894_10484207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
3300005662|Ga0078894_10549263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
3300005662|Ga0078894_10647179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300005662|Ga0078894_11090000 | Not Available | 682 | Open in IMG/M |
3300005662|Ga0078894_11352666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300005805|Ga0079957_1004339 | Not Available | 11788 | Open in IMG/M |
3300005805|Ga0079957_1005510 | Not Available | 10282 | Open in IMG/M |
3300005805|Ga0079957_1029356 | All Organisms → cellular organisms → Bacteria | 3667 | Open in IMG/M |
3300005805|Ga0079957_1034204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3317 | Open in IMG/M |
3300005805|Ga0079957_1099633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1587 | Open in IMG/M |
3300005805|Ga0079957_1321208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 688 | Open in IMG/M |
3300006030|Ga0075470_10003671 | Not Available | 4774 | Open in IMG/M |
3300006030|Ga0075470_10125250 | Not Available | 759 | Open in IMG/M |
3300006030|Ga0075470_10238933 | Not Available | 514 | Open in IMG/M |
3300006484|Ga0070744_10011272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2654 | Open in IMG/M |
3300006484|Ga0070744_10043153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
3300006484|Ga0070744_10079375 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300006484|Ga0070744_10144429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 683 | Open in IMG/M |
3300006641|Ga0075471_10019912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3987 | Open in IMG/M |
3300006641|Ga0075471_10434785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300006802|Ga0070749_10030958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3340 | Open in IMG/M |
3300006875|Ga0075473_10265611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300006917|Ga0075472_10071828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1660 | Open in IMG/M |
3300007165|Ga0079302_1012483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2231 | Open in IMG/M |
3300007169|Ga0102976_1039332 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300007169|Ga0102976_1081304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
3300007171|Ga0102977_1022093 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300007177|Ga0102978_1023066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2277 | Open in IMG/M |
3300007214|Ga0103959_1196063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1774 | Open in IMG/M |
3300007216|Ga0103961_1254178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2605 | Open in IMG/M |
3300007304|Ga0102689_1854428 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300007541|Ga0099848_1117610 | Not Available | 1007 | Open in IMG/M |
3300007559|Ga0102828_1048885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 980 | Open in IMG/M |
3300007639|Ga0102865_1243973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300007708|Ga0102859_1259322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300007973|Ga0105746_1068003 | Not Available | 1139 | Open in IMG/M |
3300008055|Ga0108970_11417873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300008107|Ga0114340_1000680 | Not Available | 22424 | Open in IMG/M |
3300008107|Ga0114340_1000725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58338 | Open in IMG/M |
3300008107|Ga0114340_1001631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16716 | Open in IMG/M |
3300008107|Ga0114340_1003790 | Not Available | 8348 | Open in IMG/M |
3300008107|Ga0114340_1005131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10843 | Open in IMG/M |
3300008107|Ga0114340_1005239 | Not Available | 7764 | Open in IMG/M |
3300008107|Ga0114340_1005426 | Not Available | 6789 | Open in IMG/M |
3300008107|Ga0114340_1005834 | Not Available | 8061 | Open in IMG/M |
3300008107|Ga0114340_1008225 | Not Available | 14053 | Open in IMG/M |
3300008107|Ga0114340_1008318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5287 | Open in IMG/M |
3300008107|Ga0114340_1013303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4013 | Open in IMG/M |
3300008107|Ga0114340_1017308 | All Organisms → Viruses → Predicted Viral | 3435 | Open in IMG/M |
3300008107|Ga0114340_1017537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3410 | Open in IMG/M |
3300008107|Ga0114340_1037066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2199 | Open in IMG/M |
3300008107|Ga0114340_1041722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2048 | Open in IMG/M |
3300008107|Ga0114340_1052844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1770 | Open in IMG/M |
3300008107|Ga0114340_1056973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1691 | Open in IMG/M |
3300008107|Ga0114340_1090578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1243 | Open in IMG/M |
3300008107|Ga0114340_1103272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
3300008107|Ga0114340_1147542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1720 | Open in IMG/M |
3300008107|Ga0114340_1150108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300008107|Ga0114340_1221839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300008107|Ga0114340_1224213 | Not Available | 601 | Open in IMG/M |
3300008108|Ga0114341_10000861 | Not Available | 33097 | Open in IMG/M |
3300008108|Ga0114341_10322560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300008108|Ga0114341_10405001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300008108|Ga0114341_10492307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300008110|Ga0114343_1012962 | All Organisms → cellular organisms → Bacteria | 7275 | Open in IMG/M |
3300008110|Ga0114343_1027375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2423 | Open in IMG/M |
3300008110|Ga0114343_1048919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1645 | Open in IMG/M |
3300008110|Ga0114343_1057177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1481 | Open in IMG/M |
3300008110|Ga0114343_1090421 | Not Available | 1080 | Open in IMG/M |
3300008110|Ga0114343_1090617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1965 | Open in IMG/M |
3300008111|Ga0114344_1000371 | Not Available | 43404 | Open in IMG/M |
3300008113|Ga0114346_1011222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5092 | Open in IMG/M |
3300008113|Ga0114346_1034957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2609 | Open in IMG/M |
3300008113|Ga0114346_1037117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2517 | Open in IMG/M |
3300008113|Ga0114346_1215039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 752 | Open in IMG/M |
3300008114|Ga0114347_1014863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4482 | Open in IMG/M |
3300008114|Ga0114347_1025112 | Not Available | 4498 | Open in IMG/M |
3300008114|Ga0114347_1025989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2698 | Open in IMG/M |
3300008116|Ga0114350_1002080 | Not Available | 14792 | Open in IMG/M |
3300008116|Ga0114350_1002836 | Not Available | 9215 | Open in IMG/M |
3300008116|Ga0114350_1007686 | All Organisms → cellular organisms → Bacteria | 5060 | Open in IMG/M |
3300008116|Ga0114350_1011379 | Not Available | 3960 | Open in IMG/M |
3300008116|Ga0114350_1019035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2877 | Open in IMG/M |
3300008116|Ga0114350_1026951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2311 | Open in IMG/M |
3300008116|Ga0114350_1031955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2073 | Open in IMG/M |
3300008116|Ga0114350_1076538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
3300008117|Ga0114351_1037320 | All Organisms → Viruses → Predicted Viral | 3126 | Open in IMG/M |
3300008120|Ga0114355_1053334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1824 | Open in IMG/M |
3300008120|Ga0114355_1066000 | Not Available | 2620 | Open in IMG/M |
3300008120|Ga0114355_1178796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300008258|Ga0114840_1059087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300008259|Ga0114841_1121749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1090 | Open in IMG/M |
3300008261|Ga0114336_1025835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3328 | Open in IMG/M |
3300008261|Ga0114336_1040133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2509 | Open in IMG/M |
3300008262|Ga0114337_1078556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1605 | Open in IMG/M |
3300008264|Ga0114353_1097309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1582 | Open in IMG/M |
3300008266|Ga0114363_1064048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1418 | Open in IMG/M |
3300008266|Ga0114363_1068037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1362 | Open in IMG/M |
3300008448|Ga0114876_1154302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300008448|Ga0114876_1162373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300008450|Ga0114880_1229698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300008953|Ga0104241_1003079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
3300008953|Ga0104241_1004308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300008962|Ga0104242_1010085 | Not Available | 1665 | Open in IMG/M |
3300008962|Ga0104242_1024017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
3300008996|Ga0102831_1218768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300009009|Ga0105105_10351628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300009155|Ga0114968_10046513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2815 | Open in IMG/M |
3300009159|Ga0114978_10369479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300009164|Ga0114975_10013960 | Not Available | 4950 | Open in IMG/M |
3300009181|Ga0114969_10056940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2596 | Open in IMG/M |
3300009183|Ga0114974_10001776 | Not Available | 16906 | Open in IMG/M |
3300009183|Ga0114974_10231649 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300009183|Ga0114974_10468268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300009233|Ga0103856_10083201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300009235|Ga0103857_10033458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300009243|Ga0103860_10156673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300009419|Ga0114982_1000558 | Not Available | 19827 | Open in IMG/M |
3300009419|Ga0114982_1061972 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300010354|Ga0129333_10000685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29072 | Open in IMG/M |
3300010354|Ga0129333_10016466 | Not Available | 7028 | Open in IMG/M |
3300010354|Ga0129333_10018470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6630 | Open in IMG/M |
3300010354|Ga0129333_10033021 | All Organisms → Viruses → Predicted Viral | 4888 | Open in IMG/M |
3300010354|Ga0129333_10108813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2558 | Open in IMG/M |
3300010354|Ga0129333_10447889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1137 | Open in IMG/M |
3300010354|Ga0129333_10841566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300010354|Ga0129333_10906582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300010354|Ga0129333_11236682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
3300010370|Ga0129336_10309581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300010388|Ga0136551_1001626 | All Organisms → cellular organisms → Bacteria | 5706 | Open in IMG/M |
3300010388|Ga0136551_1005178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2946 | Open in IMG/M |
3300011268|Ga0151620_1093932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
3300011995|Ga0153800_1026737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300012000|Ga0119951_1008175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4554 | Open in IMG/M |
3300012012|Ga0153799_1087954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300012667|Ga0157208_10006326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1826 | Open in IMG/M |
3300012706|Ga0157627_1061742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300012714|Ga0157601_1152181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300012720|Ga0157613_1264710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
3300012731|Ga0157616_1002840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300012731|Ga0157616_1137182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300012733|Ga0157606_1162905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300012734|Ga0157615_1024574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
3300012962|Ga0129335_1111926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300013004|Ga0164293_10029118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4581 | Open in IMG/M |
3300013004|Ga0164293_10054115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3221 | Open in IMG/M |
3300013004|Ga0164293_10110241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2098 | Open in IMG/M |
3300013004|Ga0164293_10202415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
3300013004|Ga0164293_10208011 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
3300013004|Ga0164293_10218308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1366 | Open in IMG/M |
3300013004|Ga0164293_10302962 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300013004|Ga0164293_11002109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300013005|Ga0164292_10111703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2046 | Open in IMG/M |
3300013087|Ga0163212_1027858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1995 | Open in IMG/M |
3300013087|Ga0163212_1135015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300013087|Ga0163212_1279714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1173263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10018239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6799 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10026572 | Not Available | 5203 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10232838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10297875 | Not Available | 954 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10023313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6337 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10191465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10591356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10734838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10555425 | Not Available | 749 | Open in IMG/M |
3300013295|Ga0170791_16102964 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300013310|Ga0157622_1194625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
3300013372|Ga0177922_10010617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300013372|Ga0177922_11242566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10738726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300014819|Ga0119954_1003286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4694 | Open in IMG/M |
3300017736|Ga0181365_1145064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300017774|Ga0181358_1060796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1411 | Open in IMG/M |
3300017778|Ga0181349_1233598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300017788|Ga0169931_10014457 | Not Available | 10677 | Open in IMG/M |
3300017788|Ga0169931_10091014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2979 | Open in IMG/M |
3300017788|Ga0169931_10099540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2797 | Open in IMG/M |
3300017788|Ga0169931_10116403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2506 | Open in IMG/M |
3300017788|Ga0169931_10185018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1804 | Open in IMG/M |
3300017788|Ga0169931_10207171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1661 | Open in IMG/M |
3300017788|Ga0169931_10212472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1632 | Open in IMG/M |
3300017788|Ga0169931_10343101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
3300017788|Ga0169931_10631425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300017788|Ga0169931_10888826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300019146|Ga0188881_10003881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1765 | Open in IMG/M |
3300019146|Ga0188881_10004963 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
3300019784|Ga0181359_1024423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2306 | Open in IMG/M |
3300019784|Ga0181359_1063300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
3300020048|Ga0207193_1108683 | All Organisms → Viruses → Predicted Viral | 2489 | Open in IMG/M |
3300020048|Ga0207193_1216526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1492 | Open in IMG/M |
3300020074|Ga0194113_10049489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4093 | Open in IMG/M |
3300020074|Ga0194113_10079935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2961 | Open in IMG/M |
3300020074|Ga0194113_10165764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1814 | Open in IMG/M |
3300020074|Ga0194113_10249026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1381 | Open in IMG/M |
3300020074|Ga0194113_11045731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300020083|Ga0194111_10482520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300020083|Ga0194111_10645870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300020141|Ga0211732_1292524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300020151|Ga0211736_10223327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1832 | Open in IMG/M |
3300020151|Ga0211736_10275300 | Not Available | 546 | Open in IMG/M |
3300020151|Ga0211736_10760023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4949 | Open in IMG/M |
3300020159|Ga0211734_10005440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3151 | Open in IMG/M |
3300020159|Ga0211734_10053252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1645 | Open in IMG/M |
3300020159|Ga0211734_10315270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300020159|Ga0211734_10328286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
3300020159|Ga0211734_10552928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1079 | Open in IMG/M |
3300020159|Ga0211734_11294657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300020160|Ga0211733_10908358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1494 | Open in IMG/M |
3300020161|Ga0211726_10172922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1601 | Open in IMG/M |
3300020162|Ga0211735_10642190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300020172|Ga0211729_10341993 | Not Available | 11606 | Open in IMG/M |
3300020172|Ga0211729_10452742 | Not Available | 582 | Open in IMG/M |
3300020183|Ga0194115_10334438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300020197|Ga0194128_10163611 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300020221|Ga0194127_10088409 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
3300020222|Ga0194125_10727642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300020480|Ga0208201_101745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1953 | Open in IMG/M |
3300020487|Ga0208200_108761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300020498|Ga0208050_1001312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3549 | Open in IMG/M |
3300020501|Ga0208590_1038003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300020506|Ga0208091_1000553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6691 | Open in IMG/M |
3300020506|Ga0208091_1009544 | Not Available | 1221 | Open in IMG/M |
3300020519|Ga0208223_1013991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
3300020529|Ga0208233_1010452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
3300020530|Ga0208235_1010528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
3300020548|Ga0208856_1022996 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300020556|Ga0208486_1046529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 635 | Open in IMG/M |
3300020562|Ga0208597_1016107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1812 | Open in IMG/M |
3300020572|Ga0207909_1041955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300021093|Ga0194123_10173761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1132 | Open in IMG/M |
3300021141|Ga0214163_1075685 | Not Available | 817 | Open in IMG/M |
3300021141|Ga0214163_1088061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300021376|Ga0194130_10473537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300021424|Ga0194117_10095164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1600 | Open in IMG/M |
3300021424|Ga0194117_10335967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300021602|Ga0194060_10134386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1328 | Open in IMG/M |
3300021961|Ga0222714_10005018 | Not Available | 12727 | Open in IMG/M |
3300021961|Ga0222714_10007225 | Not Available | 10212 | Open in IMG/M |
3300021961|Ga0222714_10072621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2273 | Open in IMG/M |
3300021961|Ga0222714_10090028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1973 | Open in IMG/M |
3300021961|Ga0222714_10142874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1447 | Open in IMG/M |
3300021961|Ga0222714_10359179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300021962|Ga0222713_10017959 | All Organisms → cellular organisms → Bacteria | 6031 | Open in IMG/M |
3300021962|Ga0222713_10036901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3862 | Open in IMG/M |
3300021962|Ga0222713_10056985 | All Organisms → Viruses → Predicted Viral | 2955 | Open in IMG/M |
3300021962|Ga0222713_10093274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2173 | Open in IMG/M |
3300021962|Ga0222713_10395354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
3300021962|Ga0222713_10495068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300021963|Ga0222712_10004165 | Not Available | 15284 | Open in IMG/M |
3300021963|Ga0222712_10071149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2513 | Open in IMG/M |
3300021963|Ga0222712_10098332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2053 | Open in IMG/M |
3300021963|Ga0222712_10305953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300022179|Ga0181353_1108061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300022200|Ga0196901_1279167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300022407|Ga0181351_1050307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1741 | Open in IMG/M |
3300022752|Ga0214917_10000099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 95645 | Open in IMG/M |
3300022752|Ga0214917_10037256 | All Organisms → cellular organisms → Bacteria | 3519 | Open in IMG/M |
3300023174|Ga0214921_10004895 | Not Available | 19310 | Open in IMG/M |
3300023174|Ga0214921_10490750 | Not Available | 588 | Open in IMG/M |
3300024277|Ga0255207_1003829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2930 | Open in IMG/M |
3300024289|Ga0255147_1000266 | Not Available | 18150 | Open in IMG/M |
3300024289|Ga0255147_1001619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5548 | Open in IMG/M |
3300024289|Ga0255147_1003782 | All Organisms → cellular organisms → Bacteria | 3521 | Open in IMG/M |
3300024289|Ga0255147_1010613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2016 | Open in IMG/M |
3300024289|Ga0255147_1073359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300024298|Ga0255178_1018275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1475 | Open in IMG/M |
3300024306|Ga0255148_1009654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1945 | Open in IMG/M |
3300024306|Ga0255148_1082941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300024346|Ga0244775_10074511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2906 | Open in IMG/M |
3300024346|Ga0244775_10294047 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
3300024346|Ga0244775_10957769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300024346|Ga0244775_11027424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300024346|Ga0244775_11310761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 560 | Open in IMG/M |
3300024346|Ga0244775_11555961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300024355|Ga0255157_1046214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300024480|Ga0255223_1015680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
3300024482|Ga0255265_1046874 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300024484|Ga0256332_1087220 | Not Available | 667 | Open in IMG/M |
3300024494|Ga0255194_1050120 | Not Available | 596 | Open in IMG/M |
3300024498|Ga0255199_1055738 | Not Available | 515 | Open in IMG/M |
3300024500|Ga0255143_1083441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300024502|Ga0255181_1073029 | Not Available | 560 | Open in IMG/M |
3300024503|Ga0255152_1073177 | Not Available | 590 | Open in IMG/M |
3300024507|Ga0255176_1044046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300024513|Ga0255144_1060982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300024514|Ga0255177_1022242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1148 | Open in IMG/M |
3300024559|Ga0255284_1060341 | Not Available | 812 | Open in IMG/M |
3300024562|Ga0256336_1060544 | Not Available | 816 | Open in IMG/M |
3300024572|Ga0255268_1150603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300024573|Ga0256337_1150709 | Not Available | 578 | Open in IMG/M |
3300024867|Ga0255267_1134808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300025283|Ga0208048_1102586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300025585|Ga0208546_1010379 | Not Available | 2459 | Open in IMG/M |
3300025732|Ga0208784_1012346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2879 | Open in IMG/M |
3300025732|Ga0208784_1147673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300026435|Ga0256297_1015909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
3300026455|Ga0255155_1026664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
3300026473|Ga0255166_1007279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2545 | Open in IMG/M |
3300026478|Ga0255156_1061746 | Not Available | 677 | Open in IMG/M |
3300026562|Ga0255285_1114616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300026569|Ga0255277_1018413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1826 | Open in IMG/M |
3300026571|Ga0255289_1051876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300027114|Ga0208009_1001896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5851 | Open in IMG/M |
3300027114|Ga0208009_1010923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2231 | Open in IMG/M |
3300027139|Ga0255082_1001004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6036 | Open in IMG/M |
3300027503|Ga0255182_1081889 | Not Available | 776 | Open in IMG/M |
3300027538|Ga0255085_1096950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300027586|Ga0208966_1000739 | Not Available | 10274 | Open in IMG/M |
3300027659|Ga0208975_1081420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
3300027659|Ga0208975_1090197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300027659|Ga0208975_1200485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300027710|Ga0209599_10000189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 43138 | Open in IMG/M |
3300027710|Ga0209599_10004775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4851 | Open in IMG/M |
3300027710|Ga0209599_10058124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
3300027759|Ga0209296_1008573 | Not Available | 6264 | Open in IMG/M |
3300027759|Ga0209296_1104592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1345 | Open in IMG/M |
3300027759|Ga0209296_1135568 | Not Available | 1126 | Open in IMG/M |
3300027759|Ga0209296_1213956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300027759|Ga0209296_1352103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300027762|Ga0209288_10295779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300027769|Ga0209770_10168709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300027793|Ga0209972_10036230 | All Organisms → Viruses → Predicted Viral | 2806 | Open in IMG/M |
3300027793|Ga0209972_10069395 | Not Available | 1848 | Open in IMG/M |
3300027793|Ga0209972_10094546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1512 | Open in IMG/M |
3300027797|Ga0209107_10226880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300027804|Ga0209358_10051443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2434 | Open in IMG/M |
3300027805|Ga0209229_10000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 91329 | Open in IMG/M |
3300027805|Ga0209229_10003801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 6270 | Open in IMG/M |
3300027805|Ga0209229_10005425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5325 | Open in IMG/M |
3300027805|Ga0209229_10043668 | Not Available | 1988 | Open in IMG/M |
3300027805|Ga0209229_10065753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1624 | Open in IMG/M |
3300027805|Ga0209229_10117992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1197 | Open in IMG/M |
3300027805|Ga0209229_10291404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300027816|Ga0209990_10196039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
3300027892|Ga0209550_10099551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2176 | Open in IMG/M |
3300028025|Ga0247723_1009868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3785 | Open in IMG/M |
3300028025|Ga0247723_1010955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3501 | Open in IMG/M |
3300028025|Ga0247723_1063215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
3300028086|Ga0255201_1036651 | Not Available | 782 | Open in IMG/M |
3300028275|Ga0255174_1019949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
3300029699|Ga0255233_1013438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1542 | Open in IMG/M |
3300029930|Ga0119944_1000235 | Not Available | 9850 | Open in IMG/M |
3300031758|Ga0315907_10000127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 109458 | Open in IMG/M |
3300031758|Ga0315907_10001059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 37779 | Open in IMG/M |
3300031758|Ga0315907_10010502 | Not Available | 9209 | Open in IMG/M |
3300031758|Ga0315907_10223185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1572 | Open in IMG/M |
3300031758|Ga0315907_10235659 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
3300031758|Ga0315907_10289158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1348 | Open in IMG/M |
3300031758|Ga0315907_10315827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1279 | Open in IMG/M |
3300031758|Ga0315907_10352072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
3300031758|Ga0315907_10373299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
3300031758|Ga0315907_10410740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
3300031758|Ga0315907_10475597 | Not Available | 993 | Open in IMG/M |
3300031758|Ga0315907_10900085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300031784|Ga0315899_11302022 | Not Available | 622 | Open in IMG/M |
3300031787|Ga0315900_10510511 | Not Available | 908 | Open in IMG/M |
3300031857|Ga0315909_10054917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 3658 | Open in IMG/M |
3300031857|Ga0315909_10189674 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
3300031857|Ga0315909_10199618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1586 | Open in IMG/M |
3300031857|Ga0315909_10306175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
3300031857|Ga0315909_10562421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
3300031951|Ga0315904_10314533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1460 | Open in IMG/M |
3300031951|Ga0315904_10329006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1417 | Open in IMG/M |
3300031951|Ga0315904_10545470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
3300031951|Ga0315904_10920373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300031951|Ga0315904_10947055 | Not Available | 689 | Open in IMG/M |
3300031951|Ga0315904_11152177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300031951|Ga0315904_11191998 | Not Available | 585 | Open in IMG/M |
3300031951|Ga0315904_11213827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300031963|Ga0315901_10329560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
3300031963|Ga0315901_10906703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300032050|Ga0315906_10385600 | All Organisms → Viruses → Predicted Viral | 1226 | Open in IMG/M |
3300032050|Ga0315906_10815025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300032093|Ga0315902_11294106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300032093|Ga0315902_11321261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300032116|Ga0315903_10747672 | Not Available | 723 | Open in IMG/M |
3300033816|Ga0334980_0063383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1555 | Open in IMG/M |
3300033978|Ga0334977_0160123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1159 | Open in IMG/M |
3300033981|Ga0334982_0011751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5185 | Open in IMG/M |
3300033992|Ga0334992_0457097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300033993|Ga0334994_0315239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300034018|Ga0334985_0310259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
3300034021|Ga0335004_0339370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
3300034063|Ga0335000_0565725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300034066|Ga0335019_0000065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60076 | Open in IMG/M |
3300034068|Ga0334990_0121338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1421 | Open in IMG/M |
3300034071|Ga0335028_0262569 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300034071|Ga0335028_0555742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300034072|Ga0310127_192205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300034073|Ga0310130_0003902 | Not Available | 6235 | Open in IMG/M |
3300034073|Ga0310130_0004266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5864 | Open in IMG/M |
3300034082|Ga0335020_0290705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300034093|Ga0335012_0546710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300034101|Ga0335027_0023016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 5265 | Open in IMG/M |
3300034101|Ga0335027_0073778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2675 | Open in IMG/M |
3300034101|Ga0335027_0380187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300034101|Ga0335027_0729445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 584 | Open in IMG/M |
3300034105|Ga0335035_0224680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300034106|Ga0335036_0148938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1668 | Open in IMG/M |
3300034106|Ga0335036_0212192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
3300034112|Ga0335066_0019442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 4799 | Open in IMG/M |
3300034112|Ga0335066_0706043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300034117|Ga0335033_0337893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300034118|Ga0335053_0404977 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300034118|Ga0335053_0488350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300034122|Ga0335060_0108079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1667 | Open in IMG/M |
3300034122|Ga0335060_0350808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300034200|Ga0335065_0047528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2993 | Open in IMG/M |
3300034200|Ga0335065_0390322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300034283|Ga0335007_0501509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.11% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 12.76% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.13% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.16% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.11% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.44% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.02% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.39% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.56% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.93% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.51% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.09% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.09% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.09% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.88% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.67% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.26% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.05% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.84% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.84% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.63% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.63% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.42% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.42% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.42% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.42% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.42% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.21% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.21% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.21% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.21% |
Stentor Amethystinus | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus | 0.21% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.21% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.21% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.21% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
2166559019 | Stentor MTG 1 | Environmental | Open in IMG/M |
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300020480 | Freshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020487 | Freshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020501 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024277 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024355 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024482 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024484 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024494 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300024498 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
3300024559 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300026562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
3300027503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d | Environmental | Open in IMG/M |
3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ErSWdraft_482900 | 2035265000 | Freshwater | MNTYKVKLEVMAEVEAFDESDALDYANDIFGIDDEIKNVKSS |
stn_00428210 | 2166559019 | Stentor Amethystinus | MNTYKVKLEVMAEVEAFDESDALDYANDIFGIDDEIKNVKVVSVKEK |
JGI12547J11936_10060006 | 3300000736 | Freshwater And Sediment | MNIYKVKLEVTAEVEAFDESDALEYANDIFGVDDEIKNVKVVSVKEK* |
JGI12421J11937_1000281118 | 3300000756 | Freshwater And Sediment | MKTYLIKLEVEAHIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVKEK* |
FwDRAFT_1000523114 | 3300000882 | Freshwater And Marine | MNTYKVKLEVTAEVEAFDESDALDYANDIFGVDDEIKNVKVVSVKEK* |
RCM30_10100272 | 3300001842 | Marine Plankton | MNTYRVKLEVEAEVDAFSREDADDYVHDIFGTDDEIKSVKIISILEK* |
RCM34_10824232 | 3300001843 | Marine Plankton | MNTYSIKLELSLEIEAFNEKDAVEYVDDIFGIDDEIKNIKLISVKEK* |
RCM41_100503717 | 3300001847 | Marine Plankton | MNTYRVKLEVEAEIDAFSREDAEDYVHDIFGTDDEIKSVKIISILEK* |
RCM37_10988702 | 3300001850 | Marine Plankton | MNTYRVKLEVEAEIDAFSREDADDYVHDIFGTDDEIKSVKIISILEK* |
RCM31_103754361 | 3300001851 | Marine Plankton | MNTYKVKLDVELEIEAFSENDAKDYINDIFGVDEEIKSIKVNSIKEK* |
GOS2236_10232772 | 3300001968 | Marine | MNVYKVKLEIDAEIEAFSEDDAVDYMNDIFGIDDEVKSVKVVSVKEK* |
GOS2236_10550942 | 3300001968 | Marine | MKTYSVKLEISAEVEAFSEEDAVEYMNDIFGIDDEVKSVKVVNIKEK* |
JGI24766J26685_100076672 | 3300002161 | Freshwater And Sediment | MNTYKIKLEVDAEVEAFSSDDAVDYANDIFGVDDEVKNVKVVSVKEK* |
JGI24766J26685_100900302 | 3300002161 | Freshwater And Sediment | MAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
JGI24766J26685_101107782 | 3300002161 | Freshwater And Sediment | MNTYRVKIEIDAEVEAFSSEDAVDYANDIFGVDDEVKNVKVVSVKEK* |
B570J29032_1094477382 | 3300002408 | Freshwater | MNTYRIKIEVDAEVQAFSENDAIDYVNDIFGVDEEIKSIKVVSTKEK* |
B570J40625_10001438430 | 3300002835 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK* |
B570J40625_10001579326 | 3300002835 | Freshwater | MNNYKVKLEIDAEVQAFNENDAIDYVNDIFGVDEEIKNIKIVSVKEK* |
B570J40625_10005020615 | 3300002835 | Freshwater | MNTYRVKIEIEAEIEAFDEGDARDYASDIFGVDDEIKSAKIIEIKSK* |
B570J40625_1005192193 | 3300002835 | Freshwater | EINAEVQAFTEEDAVDYANDIFGIDDEVKNVKVVSVKEK* |
B570J40625_1007889122 | 3300002835 | Freshwater | MNTYVIKLEVEAQIEAFSEDDAKDYINDIFGVDDEVKNVKILSVKEK* |
B570J40625_1011548902 | 3300002835 | Freshwater | MNTYKVKLEVTAEVEAFDESDALEYANDIFGVDDEIKNVKVVSVKEK* |
B570J40625_1012145362 | 3300002835 | Freshwater | MNTYSIKLEINAEVQAFTEEDAVDYANDIFGIDDEVKNVKVVSVKEK* |
B570J40625_1016969432 | 3300002835 | Freshwater | MNTYRVKLEIEAEIEAFDEDDARDYANDIFGVDDEIRSAKIIEIKNK* |
JGI25908J49247_100092145 | 3300003277 | Freshwater Lake | MNTYKVKLEVMAEVEAFDESDALDYANDIFGVDDEIKNVKVVSVKEK* |
JGI25921J50272_100103094 | 3300003430 | Freshwater Lake | MNTYSVKLEVNAEVQAFSEDDATDYVNDIFGIDEEVKSVKLISIKEK* |
JGI25921J50272_100944122 | 3300003430 | Freshwater Lake | MNIYRVKLXVEAXVEAFDXXXALDYANDIFGVDDEIKNVKVVSVKEK* |
JGI25921J50272_101273252 | 3300003430 | Freshwater Lake | MNTYKIKLEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVLSVKEK* |
Ga0065166_102954681 | 3300004112 | Freshwater Lake | MNTYNIKIEINAEVQAFTEEDAVDYANDIFGIDDEVKNVKVVSVKEK* |
Ga0065166_103784502 | 3300004112 | Freshwater Lake | MKTYSVKLEINAEVEAFTEADAVDYINDIFGVDDEIKNIKVVGVKEK* |
Ga0065166_105230991 | 3300004112 | Freshwater Lake | MNTYKIKLEVDAEVEAFSSEDAVDYASDIFGVDDEVKNVKVVSVKEK* |
Ga0007787_101314142 | 3300004240 | Freshwater Lake | MKRYKVKLEVDVEVEAFDEGDALDYANDIFGVDDEIKNVKVINVKEK* |
Ga0007756_116341381 | 3300004795 | Freshwater Lake | KIKIEVDAEVEAFSSEDAVDYASDIFGVDDEVKNVKVVSVKEK* |
Ga0007763_114775581 | 3300004796 | Freshwater Lake | MKTYSVKLEVNAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKEK* |
Ga0068884_15608712 | 3300005417 | Freshwater Lake | MNTYKIKIEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK* |
Ga0068877_103068482 | 3300005525 | Freshwater Lake | MKSYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0068876_100402682 | 3300005527 | Freshwater Lake | MNTYSVKLEVSAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK* |
Ga0068876_100869352 | 3300005527 | Freshwater Lake | MKTYKVKLEVEAEVQAFDENDAVDYLNDIFGVDDEVRNVKVVSVKEK* |
Ga0068876_101086432 | 3300005527 | Freshwater Lake | MNTYKIKLEVDAEVQAFTEDDAADYINDIFGIDDEVKSVKVVTIKEK* |
Ga0068876_101273041 | 3300005527 | Freshwater Lake | EVNAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK* |
Ga0068876_101305062 | 3300005527 | Freshwater Lake | MNIYRVKLEVEAEVEAFDQDDALDYANDIFGVDDEIKNVKVVSVKEK* |
Ga0068876_102285433 | 3300005527 | Freshwater Lake | MNTYRVKLEVEAEVEAFDEGDALDYANDIFGTDDEIKNVKVVSVKEK* |
Ga0068876_102333262 | 3300005527 | Freshwater Lake | MNTYRVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVVSVKEK* |
Ga0068876_102785412 | 3300005527 | Freshwater Lake | MNTYKVKIEIDAEVEAFSSEDAVDYANDIFGIDDEVKNVKVVSVKEK* |
Ga0068876_103988321 | 3300005527 | Freshwater Lake | MKTYSVKIEVNAEVQAFSEEDAADYINDIFGVDEEVKS |
Ga0068876_104323192 | 3300005527 | Freshwater Lake | MNTYSIKIEVNAEVQAFSEQDAAEYINDIFGIDDEVKSVKVISVKEK* |
Ga0068876_104882472 | 3300005527 | Freshwater Lake | MKKYKVKLEIEAEVEAFDEGDALDYANDIFGVDDEIKNVKVVSVKEK* |
Ga0068876_106760832 | 3300005527 | Freshwater Lake | MKKYKVKLEIEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0068876_106778792 | 3300005527 | Freshwater Lake | MNTYRVKLEVMAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0068876_106994472 | 3300005527 | Freshwater Lake | MNTYRVKIEVDAEVQAFNEDDAIDYVNDIFGVDEEIKSIKVVNVKEK* |
Ga0068872_101782823 | 3300005528 | Freshwater Lake | MKFYNIKIEISAEVEAFSEEDAVEYVNDIFGIDDEVKNVKVISVKEK* |
Ga0068872_102069752 | 3300005528 | Freshwater Lake | MNTYSIKLEVNAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK* |
Ga0068872_105435902 | 3300005528 | Freshwater Lake | MKTYSIKLEINAEVQAFSEEDAIEYINDIFGIDEEVKSVKMISVKEK* |
Ga0068872_105741852 | 3300005528 | Freshwater Lake | MKNYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0068872_106177562 | 3300005528 | Freshwater Lake | VKLEVNAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKEK* |
Ga0049083_100385182 | 3300005580 | Freshwater Lentic | MNTYVIKLEVEAHIQAFSEDDAKDYINDIFGVDDEVKNVKLLSVREK* |
Ga0049081_100214863 | 3300005581 | Freshwater Lentic | MKNYKVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVVSVKEK* |
Ga0049081_100440025 | 3300005581 | Freshwater Lentic | MKNYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIK |
Ga0049080_101103642 | 3300005582 | Freshwater Lentic | MKSYKVKLEIEAEVEAFDEDDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0049082_100097897 | 3300005584 | Freshwater Lentic | MNVYKVKLEVEVEIEAFNEDDALDYSSDIFGVDDEIKNVKVVSVKEK* |
Ga0078894_100399569 | 3300005662 | Freshwater Lake | MNTYVVKLEVEAQIEAFSEDDARDYINDIFGVDDEVKNVKIVNVKEK* |
Ga0078894_100717431 | 3300005662 | Freshwater Lake | DAEVEAFSSEDAVDYASDIFGVDDEVKNVKVVSVKEK* |
Ga0078894_101054532 | 3300005662 | Freshwater Lake | MNTYVIKLEVEAHIEAFSEDDARDYINDIFGVDDEVKNVKILNVKEK* |
Ga0078894_101327886 | 3300005662 | Freshwater Lake | MKRYSVKLEISAEVEAFTEDDAVDYVNDIFGVDDEIKNIKIVAVKEK* |
Ga0078894_103849482 | 3300005662 | Freshwater Lake | MNVYKIKLEVDTEVEAFSEDDAKDYITDIFGVDDEVKNVKVISVKEK* |
Ga0078894_104842073 | 3300005662 | Freshwater Lake | MHTYSVKIEIDAEVEAFSSEDAIDYANDIFGVDDEVKNVKVVSVKEK* |
Ga0078894_105492631 | 3300005662 | Freshwater Lake | NAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKEK* |
Ga0078894_106471792 | 3300005662 | Freshwater Lake | VNAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKEK* |
Ga0078894_110900001 | 3300005662 | Freshwater Lake | MHTYSVKIEIDAEVEAFSSEDAVDYANDIFGVDDEVKNVKVVSVKEK* |
Ga0078894_113526662 | 3300005662 | Freshwater Lake | MNTYSIKIEINAEVQAFSEEDAAEYINDIFGIDEEVKSVKVISVKEK* |
Ga0079957_100433932 | 3300005805 | Lake | MNVYKVKLEIDAEVEAFSEDDAVDYMNDIFGIDDEVKSVKVVSVKEK* |
Ga0079957_100551012 | 3300005805 | Lake | MKNYKVKMEIEVEVQAFDEDDALDYANDIFGIDDEIKNVKVISVKEK* |
Ga0079957_10293567 | 3300005805 | Lake | MKIYGVKLEIDAEIQAFDEDDAADYLNDIFGIDDEVKSVKVINIKEK* |
Ga0079957_10342041 | 3300005805 | Lake | MKSYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKSVKVISVKEK* |
Ga0079957_10996334 | 3300005805 | Lake | MKKYKVKLEIEAEVEAFDEGDALDYANDIFGVDDEIKNVKVITVKEK* |
Ga0079957_13212082 | 3300005805 | Lake | MKTYKVKLEIDAEIQAFDENDAVDYLNDIFGIDDEVRNVKVVSVKEK* |
Ga0075470_100036716 | 3300006030 | Aqueous | MNTYRIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKNVKVVSVKEK* |
Ga0075470_101252501 | 3300006030 | Aqueous | MNTYKVKLEVEVEIQAFNENDAKDYVADIFGIDDEV |
Ga0075470_102389332 | 3300006030 | Aqueous | MKTYKVKLEIDAEVQAFDENDAVDYLNDIFGVDDEVRNVKVVNVKEK* |
Ga0070744_100112727 | 3300006484 | Estuarine | MKTYLIKLELEAHIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVKEK* |
Ga0070744_100431534 | 3300006484 | Estuarine | MHTYSVKIEIDAEVEAFSSEDAIDYANDIFGVDDEVKNV |
Ga0070744_100793752 | 3300006484 | Estuarine | MKTYSIKLEVNAEIQAFSEEDAADYINDIFGVDEEVKSVKVISVKEK* |
Ga0070744_101444292 | 3300006484 | Estuarine | MNTYKVKLELEAHIEAFNEDDVRDYISDIMGIDEEFKSVKIKSITAMGEK* |
Ga0075471_100199127 | 3300006641 | Aqueous | MNTYKVKLEVEVEIQAFNENDAKDYVADIFGIDDEVKSVKVVNIKEK* |
Ga0075471_104347852 | 3300006641 | Aqueous | MKTYKVKLEIDAEVQAFDENDAVDYLNDIFGIDDEVKSVKVVNVKEK* |
Ga0070749_1003095810 | 3300006802 | Aqueous | MNTYRVKLEIDAEVQAFSEDDAVDYMNDIFGIDDEVKSVKVVSVKEK* |
Ga0075473_102656112 | 3300006875 | Aqueous | MNTYSVKIEINAEIEAFSEEDAADYINDIFGVDDEVKSVKVINIKE |
Ga0075472_100718281 | 3300006917 | Aqueous | MNTYRIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKNVKV |
Ga0079302_10124837 | 3300007165 | Deep Subsurface | AEVEAFDEGDALDYANDIFGTDDEIKNVKVVSVKEK* |
Ga0102976_10393322 | 3300007169 | Freshwater Lake | MNTYKVKLEIEAEVQAFDQDDAVDYVNDIFGIDDEVKSVKVVSVKEK* |
Ga0102976_10813042 | 3300007169 | Freshwater Lake | MNTYKVKLEIEAEIQAFDEDDAVDYLNDIFGVDDEVRNVKVVSVKEK* |
Ga0102977_10220932 | 3300007171 | Freshwater Lake | MNTYRIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKSVKVINVKEK* |
Ga0102978_10230666 | 3300007177 | Freshwater Lake | MNTYRIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK* |
Ga0103959_11960632 | 3300007214 | Freshwater Lake | MNVYRVKLEIEAEVQAFDEADASDYINDIFGVDDEVKSIKVVSVKEK* |
Ga0103961_12541782 | 3300007216 | Freshwater Lake | MNVYKVKLEIEAEVQAFDEADASDYINDIFGVDDEVKSIKVVSVKEK* |
Ga0102689_18544282 | 3300007304 | Freshwater Lake | MKTYKVKLEIEAEVQAFDENDAVDYLNDIFGVDDEVRNVKVVSVKEK* |
Ga0099848_11176102 | 3300007541 | Aqueous | MNTYRVKLEIDAEVQAFSEDDAVDYMNDIFGVDDEVKSVKVVSVKEK* |
Ga0102828_10488853 | 3300007559 | Estuarine | MNTYRVKLEVIAEVEAFDESDALEYANDIFGVDDEIKNVKV |
Ga0102865_12439732 | 3300007639 | Estuarine | MKNYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKSVKVISVKEK* |
Ga0102859_12593222 | 3300007708 | Estuarine | MNTYRVKIEINAEVEAFSEEDAVDYANDIFGVDDEVKNVKVISVREK* |
Ga0105746_10680033 | 3300007973 | Estuary Water | VMAEVEAFDESDALDYANDIFGVDDEIKNVKVVSVKEK* |
Ga0108970_114178732 | 3300008055 | Estuary | MNTYKVKLEVEAEVEAFDEGDALDYANDIFGIDDEIKNVKVVSIKEK* |
Ga0114340_100068029 | 3300008107 | Freshwater, Plankton | MNTYRVKLEVTAEVQAFDEGDALDYANDIFGVDDEIKNVKVISIKEN* |
Ga0114340_100072587 | 3300008107 | Freshwater, Plankton | MNIYKVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK* |
Ga0114340_10016316 | 3300008107 | Freshwater, Plankton | MKKYKVNIEIEAEIEAFDEGDARDYANDIFGIDDEIKKVNIVEIKLK* |
Ga0114340_100379023 | 3300008107 | Freshwater, Plankton | VKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISIKEK* |
Ga0114340_100513117 | 3300008107 | Freshwater, Plankton | MKTYSIKIEVNAEVQAFSEEDAAEYINDIFGIDDEVKTVKVISIKEK* |
Ga0114340_10052397 | 3300008107 | Freshwater, Plankton | MNTYRVKLEVMAEVEAFDEGDALDYANDIFGVDDEIKSVKVISVKEK* |
Ga0114340_10054261 | 3300008107 | Freshwater, Plankton | VKLEVEVEVEAFDENDALDYANDIFGVDDEITNVKVISVKEK* |
Ga0114340_10058342 | 3300008107 | Freshwater, Plankton | MNTYVIKLEVEAQIEAFSEDDARDYINDIFGVDDEVKNVKILNVKEK* |
Ga0114340_10082251 | 3300008107 | Freshwater, Plankton | MKTYKVKLEVNAEVQAFSEDDAVEYINDIFGIDDEVKNVKVVTVKEK* |
Ga0114340_100831815 | 3300008107 | Freshwater, Plankton | MKNYKVKLEIEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114340_101330310 | 3300008107 | Freshwater, Plankton | MNTYVIKLEVEAQIEAFTEDDARDYINDIFGVDDEIKNIKILNIKEK* |
Ga0114340_10173082 | 3300008107 | Freshwater, Plankton | MHTYGIKIEINAEVEAFSEDDAVDYVNDMFGVDDEVKSVKVVSVKEK* |
Ga0114340_10175373 | 3300008107 | Freshwater, Plankton | MNTYSIKLEINAEVQAFSEEDAVDYANDIFGVDDEVKNVKVISVKEK* |
Ga0114340_10370664 | 3300008107 | Freshwater, Plankton | MKKYKVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114340_10417225 | 3300008107 | Freshwater, Plankton | MKTYKVKLEVNAEVQAFSEDDAVEYINDIFGIDDEVKNVKVISVKEK* |
Ga0114340_10528443 | 3300008107 | Freshwater, Plankton | MNTYIIKLEVEAHIEAFSEDDARDYINDIFGVDDEVKNVKILNVKEK* |
Ga0114340_10569733 | 3300008107 | Freshwater, Plankton | MNTYRVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114340_10905781 | 3300008107 | Freshwater, Plankton | MNTYKVKLEVEAEVEAFDEGDALDYANDIFGIDDEIKNVKVVSIK |
Ga0114340_11032722 | 3300008107 | Freshwater, Plankton | MNTYRVKIEIDAEVEAFSSEDAVDYANDIFGIDDEVKNVKVVSVKEK* |
Ga0114340_11475422 | 3300008107 | Freshwater, Plankton | MAAFDEGDALDYANDIFGTDDEIKNVKVVSVKEK* |
Ga0114340_11501081 | 3300008107 | Freshwater, Plankton | MKTYSVKIEVNAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKEK* |
Ga0114340_12218392 | 3300008107 | Freshwater, Plankton | MNKYSVKLEMVVEVEAFDEDDAKDYLNDIFGVDDEVKSIKIVSLKQK* |
Ga0114340_12242131 | 3300008107 | Freshwater, Plankton | VKIEIDAEVEAFSSEDAVDYANDIFGIDDEVKNVKVVSVKEK* |
Ga0114341_1000086117 | 3300008108 | Freshwater, Plankton | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEITNVKVISVKEK* |
Ga0114341_103225602 | 3300008108 | Freshwater, Plankton | MKKYKVKLEIDVEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114341_104050012 | 3300008108 | Freshwater, Plankton | MNTYRVKLEVMAEVEAFDEGDALDYAHDIFGVDDEIKNVKVISVKEK* |
Ga0114341_104923071 | 3300008108 | Freshwater, Plankton | MNTYRVKLEVEAEVEAFDEGDALDYANDSFGVDDEIKNVKVVSVKEK* |
Ga0114343_101296218 | 3300008110 | Freshwater, Plankton | MKTYAVKIEILAEVEAFDEDDALDYANDIFGVDDEIKNVKVISIKEK* |
Ga0114343_10273752 | 3300008110 | Freshwater, Plankton | MNTYKVKLEVEAEVEAFDETDALDYASDIFGIDDEIKNVRVISVKEK* |
Ga0114343_10489195 | 3300008110 | Freshwater, Plankton | MNTYRVKLEVEAEVEAFDEGDALEYANDIFGVDDEIKNVKVVSVKEK* |
Ga0114343_10571772 | 3300008110 | Freshwater, Plankton | MKKYKIKLEIEAEVEAFDEDDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114343_10904211 | 3300008110 | Freshwater, Plankton | NTYIIKLEVEAHIEAFSEDDARDYINDIFGVDDEVKNVKILNVKEK* |
Ga0114343_10906176 | 3300008110 | Freshwater, Plankton | IEIDAEVEAFSSEDAVDYANDIFGVDDEVKNVKVISIREK* |
Ga0114344_100037170 | 3300008111 | Freshwater, Plankton | MNTYSIKLEINAEVEAFSEEDAIDYANDIFGIDEEVKSVKVINVREK* |
Ga0114346_101122215 | 3300008113 | Freshwater, Plankton | KLEVEAEVEAFDEGDALDYANDIFGIDDEIKNVKVVSIKEK* |
Ga0114346_10349571 | 3300008113 | Freshwater, Plankton | QALEYAQPAESKMNTYKIKIEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114346_10371176 | 3300008113 | Freshwater, Plankton | MNTYRVKIEVDAEVQAFSENDAVDYANDIFGIDDEVKNVKVVSVKE |
Ga0114346_12150392 | 3300008113 | Freshwater, Plankton | MNTYSIKIEVNAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK* |
Ga0114347_10148633 | 3300008114 | Freshwater, Plankton | MKTYRVKLEVEAEIQAFDEDDAVDYLNDIFGVDDEVKNVKVVNVKEK* |
Ga0114347_10251127 | 3300008114 | Freshwater, Plankton | MNTYRVKIEVDAEVQAFSENDAVDYVNDIFGVDDEVKSVKLLSVKEK* |
Ga0114347_10259898 | 3300008114 | Freshwater, Plankton | MNTYRVKIEIDAEVQAFSENDAVDYVNDIFGVDDEVKSVKVVSVKEK* |
Ga0114350_100208017 | 3300008116 | Freshwater, Plankton | MNTYSIKIEVNAEVQAFTEDDAIDYVSDIFGVDDEVKSIKVVSVKEK* |
Ga0114350_10028366 | 3300008116 | Freshwater, Plankton | MNTYKIKLEVEAEVQAFTEDDAADYVNDIFGVDDEVKSVKVINIKEK* |
Ga0114350_10076868 | 3300008116 | Freshwater, Plankton | MNTYSVKIEVNAEVQAFSQDDAVDYVNDIFGIDDEVKSIKVINVKEK* |
Ga0114350_10113796 | 3300008116 | Freshwater, Plankton | MNTYRVKLEVDAEVQAFNEDDAIDYVNDIFGVDEEIKNIKIVSVKEK* |
Ga0114350_10190358 | 3300008116 | Freshwater, Plankton | MNTYRIKIEIDAEVQAFSENDAVDYVNDIFGVDDEVKNVKVVSVKEK* |
Ga0114350_10269513 | 3300008116 | Freshwater, Plankton | MKKYKVKLEVEVEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114350_10319556 | 3300008116 | Freshwater, Plankton | MNTYKVKLEIEAEVQAFDEADASDYINDIFGVDDEVKSIKVVSVKEK* |
Ga0114350_10765381 | 3300008116 | Freshwater, Plankton | EYAQPAESKMNTYKIKIEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114351_10373202 | 3300008117 | Freshwater, Plankton | MNTYRVKIEVDAEVQAFSENDAVDYVNDIFGVDDEVKSVKLVSVKEK* |
Ga0114355_10533342 | 3300008120 | Freshwater, Plankton | MNTYKIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK* |
Ga0114355_10660008 | 3300008120 | Freshwater, Plankton | MNIYKVKLEVEVEIEAFNEDDALDYSSDIFGVDDEIKNVKVVSIKEK* |
Ga0114355_11787961 | 3300008120 | Freshwater, Plankton | MKTYSVKLEVNAEVQAFSEEDAADYINDIFGVDEEVKSVK |
Ga0114840_10590872 | 3300008258 | Freshwater, Plankton | MNTYRIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKNVKVVSV |
Ga0114841_11217492 | 3300008259 | Freshwater, Plankton | DAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114336_10258355 | 3300008261 | Freshwater, Plankton | MNTYVIKLEVEAQIEAFSEDDARDYINDIFGVDDEVKNVKIVNVKEK* |
Ga0114336_10401336 | 3300008261 | Freshwater, Plankton | MNTYRVKLEVEAEVEAFDETDALDYASDIFGVDDEIKNVRVVSVKEK* |
Ga0114337_10785561 | 3300008262 | Freshwater, Plankton | IEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114353_10973094 | 3300008264 | Freshwater, Plankton | KIEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114363_10640481 | 3300008266 | Freshwater, Plankton | MKTYKVKLEVEAEVQAFDENDAVDYLNDIFGVDDEVRNVK |
Ga0114363_10680372 | 3300008266 | Freshwater, Plankton | MNTYKIKLEVEAEVQAFTEDDAADYVNGIFGVDDEVKSVKVINIKEK* |
Ga0114876_11543021 | 3300008448 | Freshwater Lake | AQPAESKMNTYKIKIEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114876_11623732 | 3300008448 | Freshwater Lake | ALEYAQPAESKMNTYKIKIEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK* |
Ga0114880_12296982 | 3300008450 | Freshwater Lake | VEVEAFDENDALDYANDIFGVDDEITNVKVISVKEK* |
Ga0104241_10030792 | 3300008953 | Freshwater | MKKYKVKLEVDVEVEAFDEGDALDYANDIFGVDDEIKNVKVINVKEK* |
Ga0104241_10043082 | 3300008953 | Freshwater | MNTYRVKLEVEAEVEAFDEGDALDYANDIFGTDDEIKNVRVVSVKEK* |
Ga0104242_10100851 | 3300008962 | Freshwater | MNTYSIKLEVNAEVQAFSEEDAIEYINDIFGIDEEVKSVKMISVKEK* |
Ga0104242_10240172 | 3300008962 | Freshwater | MKKYKVKLEVDVEVEAFDEGDALDYASDIFGIDDEVKNVKVVSVKEK* |
Ga0102831_12187682 | 3300008996 | Estuarine | EVMAEVEAFDESDALDYANDIFGVDDEIKNVKVVSVKEK* |
Ga0105105_103516282 | 3300009009 | Freshwater Sediment | MNTYVIKLEVEAQIDAFSEDDARDYVNDIFGVDDEVKNVKILSVKEK* |
Ga0114968_100465136 | 3300009155 | Freshwater Lake | MNTYKVKLELEAHIEAFKEDDVRDYISDIMGIDEEFKSVKIKSITAMGEK* |
Ga0114978_103694792 | 3300009159 | Freshwater Lake | MNIYKVKLEVDVEIEAFNEDDALDYSSDIFGVDDEIKNVKVVSIKEK* |
Ga0114975_100139607 | 3300009164 | Freshwater Lake | MNTYKVKLEVMAEVEAFDESDALDYANDIFGVDDEIKTVKVVSVKEK* |
Ga0114969_100569402 | 3300009181 | Freshwater Lake | MNTYVIKLEVEAHVQAFSEADAKDYVNDIFGVDDEIKNIKMLSVKEK* |
Ga0114974_100017766 | 3300009183 | Freshwater Lake | MNTYNIKIEINAEVQAFNEEDAVDYANDIFGIDDEVKNVKVVSVKEK* |
Ga0114974_102316492 | 3300009183 | Freshwater Lake | MNIYKVRLEVDVEIEAFNEDDALDYSSDIFGIDDEIKNVKVVSIKEK* |
Ga0114974_104682682 | 3300009183 | Freshwater Lake | MNTYKVRLEVDVEIEAFNEDDALDYSSDIFGVDDEIKNVKVVSIKEK* |
Ga0103856_100832012 | 3300009233 | River Water | MNNYKVKLEVEAEIQAFSEEDAADYINDIFGLDEEIKSIKVVSVKEK* |
Ga0103857_100334581 | 3300009235 | River Water | MNTYKVKIEVDAEIQAFSEEDAADYINDIFGVDEEIKSIKVISVKEK* |
Ga0103860_101566732 | 3300009243 | River Water | MKTYKIKLEIDAEVEAFTEEDASDYINDIFGIDEEIKNIKVASIKEK* |
Ga0114982_100055834 | 3300009419 | Deep Subsurface | MNNYRIKIEVDAEVQAFSENDAVDYVNDIFGIDEEIKNIKVVSVKEK* |
Ga0114982_10619722 | 3300009419 | Deep Subsurface | MNTYRVKLEVEAEVEAFDQNDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0129333_1000068539 | 3300010354 | Freshwater To Marine Saline Gradient | MNTYKVKLEVEAEVEAFDEGDALDYANDIFGIDDEIKNVKVISVKEK* |
Ga0129333_1001646617 | 3300010354 | Freshwater To Marine Saline Gradient | MNTYSVKLEVSAEVQAFSEEDAADYINDIFGIDDEVKSIKLIAIKEK* |
Ga0129333_1001847017 | 3300010354 | Freshwater To Marine Saline Gradient | MKTYRVKLEVDAEVQAFSEDDAVDYMNDIFGVDDEVKSVKVVSVREK* |
Ga0129333_100330212 | 3300010354 | Freshwater To Marine Saline Gradient | MNTYRIKLEVDAEIQAFSQDDAVDYVNDIFGVDDEIKSIKIVNIKG* |
Ga0129333_101088132 | 3300010354 | Freshwater To Marine Saline Gradient | MKTYKVKLEIDAEIQAFDEDDAVDYLNDIFGIDDEVRNVKVVSVKEK* |
Ga0129333_104478892 | 3300010354 | Freshwater To Marine Saline Gradient | MKKYKVKLEVDVEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0129333_108415662 | 3300010354 | Freshwater To Marine Saline Gradient | MNVYRVKLEIDAEVEAFSEDDAVDYMNDIFGIDDEVKSVKVVSVKEK* |
Ga0129333_109065822 | 3300010354 | Freshwater To Marine Saline Gradient | MKSYNIKIEINAEVEAFSEEDAAEYVNDIFGIDDEVKSVKVISVKEK* |
Ga0129333_112366822 | 3300010354 | Freshwater To Marine Saline Gradient | MKNYKVKLEIDAEVQAFDEDDAVDYINDIFGADDEVKNVKVVSVKEK* |
Ga0129336_103095813 | 3300010370 | Freshwater To Marine Saline Gradient | MNTYRIKLEVDAEIQAFSQDDAVDYVNDIFGVDDGIKSIKIVNIKG |
Ga0136551_10016262 | 3300010388 | Pond Fresh Water | MKNYKIKLDVEIEIQAFNEADAKEYVSDIFGTDEEVKSIKIVSVKEK* |
Ga0136551_10051787 | 3300010388 | Pond Fresh Water | MNTYKVKIQVEAEIQAFNEDDAADYINDIFGTDEEVKNIKISSIKEK* |
Ga0151620_10939322 | 3300011268 | Freshwater | MNTYKVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0153800_10267372 | 3300011995 | Freshwater | MKIYGVKLEIDVEIQAFDEDDAADYLNDIFGIDDEVKSVKVITIKEK* |
Ga0119951_10081754 | 3300012000 | Freshwater | MNTYKVKLEVEVEIQAFNENDATDYINDIFGVDDEIKSVKLISIKGK* |
Ga0153799_10879542 | 3300012012 | Freshwater | MKSYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISIKEK* |
Ga0157208_100063264 | 3300012667 | Freshwater | MKKYSIKIEVDAVVEAFSAEDAKEYINDIFGVDEEIVSVKVKKIEER* |
Ga0157627_10617422 | 3300012706 | Freshwater | MNTYRIKLEVDAEIQAFNEDDAVDYVSDIFGVDDEVKNVKVVSVKEK* |
Ga0157601_11521811 | 3300012714 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVYDEIKNVKIINVKEK* |
Ga0157613_12647102 | 3300012720 | Freshwater | MKSYKVKLEIEAEVEAFDEDDALDYANDIFGVDDEIKKVKVVSVKEQ* |
Ga0157616_10028401 | 3300012731 | Freshwater | AEVEAFDESDALEYANDIFGVDDEIKNVKVVSVKEK* |
Ga0157616_11371821 | 3300012731 | Freshwater | MNIYRVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK* |
Ga0157606_11629052 | 3300012733 | Freshwater | MNTYRIKLEVDAEIQAFNEDDAVDYVSDIFGVDDEVKNVKVVSVREK* |
Ga0157615_10245741 | 3300012734 | Freshwater | MKKYKVSLEIEAEVEAFDEDDALDYANDIFGVDDEIKKVKVVSVKE |
Ga0129335_11119262 | 3300012962 | Aqueous | NTYRIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKNVKVVSVKEK* |
Ga0164293_100291181 | 3300013004 | Freshwater | VEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK* |
Ga0164293_100541159 | 3300013004 | Freshwater | VDAEIQAFNEDDAVDYVSDIFGVDDEVKNVKVVSVREK* |
Ga0164293_101102412 | 3300013004 | Freshwater | MKKYKVSLEVEAEVEAFDEDDALDYANDIFGVDDEIKKVKVVSVKEQ* |
Ga0164293_102024152 | 3300013004 | Freshwater | MNKYLIKLEISAEVEAFDENDALDYANDIFGVDDEIKNVKVISVKEK* |
Ga0164293_102080112 | 3300013004 | Freshwater | MNTYRVKLEVMAEVEAFDESDALEYANDIFGVDDEIKNVKVVSVKEK* |
Ga0164293_102183081 | 3300013004 | Freshwater | MNTYRVKLEVAVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK* |
Ga0164293_103029622 | 3300013004 | Freshwater | MKTYAVKIEILAEVEAFDEDDDLDYANDIFGVDDEIKNVKVISIKEK* |
Ga0164293_110021092 | 3300013004 | Freshwater | MKTYLIKLEVEAHIQAFSEDDAKDYINDIFGVDEEVKNV |
Ga0164292_101117031 | 3300013005 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINV |
Ga0163212_10278582 | 3300013087 | Freshwater | MKTYTVKLEVQAEVEAFNEDDALDYAGDIFGVDDEIKNVKIISVKEK* |
Ga0163212_11350152 | 3300013087 | Freshwater | MNTYRVKLEVEAEVQAFDETDAADYINDILGLDDEIKSLKVVSVKEK* |
Ga0163212_12797142 | 3300013087 | Freshwater | MNIYRVKLEVEVEVQAFDESDALDYANDIFGVDDEIKNVKIISVKEN* |
(restricted) Ga0172374_11732632 | 3300013122 | Freshwater | MNTYRVKLEVEAEVQAFDEADASDYINDIFGVDDEVKSIKVVSVKEK* |
(restricted) Ga0172367_1001823911 | 3300013126 | Freshwater | MKSYKVKLEIDVEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK* |
(restricted) Ga0172367_1002657212 | 3300013126 | Freshwater | MNIYKIKIEVDAEVQAFNEDDAVDYVNDIFGVDDEIKSIKIISVKEK* |
(restricted) Ga0172367_102328383 | 3300013126 | Freshwater | MNTYIVNLEVDAEVQAFNEDDAVDYVNDIFGIDDEVTDVRVISVKERK* |
(restricted) Ga0172367_102978752 | 3300013126 | Freshwater | MNTYKIKLEIDAEIEAFDETDALDYANDIFGVDDEVKNVKVVSIKEK* |
(restricted) Ga0172373_100233134 | 3300013131 | Freshwater | MKTYRVELEVEAEVQAFDETDATDYINDIFGLDDEIKSLRVVSVKEK* |
(restricted) Ga0172373_101914652 | 3300013131 | Freshwater | MNTYKVKIEIEAEVEAFDESDALDYASDIFGTDDEIKNVKVVSVKEK* |
(restricted) Ga0172373_105913562 | 3300013131 | Freshwater | MKTYKVKLDIEAEIQAFDEADASDYINDIFGVDDEVKSVKVISVKEK* |
(restricted) Ga0172373_107348382 | 3300013131 | Freshwater | MNTYRVKLEVEAEVQAFDETDATDYINDIFGVDDEVKSVKVINVKEK* |
(restricted) Ga0172372_105554252 | 3300013132 | Freshwater | MNTYRVKLEVEAEVQAFNEEDATDYVNDIFGIDDEVKSIKIIGIKEK* |
Ga0170791_161029642 | 3300013295 | Freshwater | MNTYKVKLEVMAEVEAFDESDALEYANDIFGVDDEIKNVKVVSVKEK* |
Ga0157622_11946252 | 3300013310 | Freshwater | MKKYKVSLEIEAEVEAFDEDDALDYANDIFGVDDEIKKVKVVSVKEQ* |
Ga0177922_100106171 | 3300013372 | Freshwater | MNTYKVKLEVMAEVEAFDESDALDYANDIFGVDDEIKNVKV |
Ga0177922_112425661 | 3300013372 | Freshwater | VEAHIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVKEK* |
(restricted) Ga0172376_107387261 | 3300014720 | Freshwater | MKSYKVKLEIDVEVEAFDEGDALDYANDIFGVDDEIKNVK |
Ga0119954_10032861 | 3300014819 | Freshwater | VEVEAFDEGDALDYANDIFGVDDEIKNVKVINVKEK* |
Ga0181365_11450641 | 3300017736 | Freshwater Lake | VDVEIEAFNEDDALDYSSDIFGVDDEIKNVKVVSIKEK |
Ga0181358_10607964 | 3300017774 | Freshwater Lake | MNTYKVKLEVMAEVEAVDESDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0181349_12335981 | 3300017778 | Freshwater Lake | TYVIKLEVEAHIQAFSEDDAKDYINDIFGVDDEVKNVKLLSVREK |
Ga0169931_100144576 | 3300017788 | Freshwater | MNTYKIKIEIDAEIEAFDEADAIDYANDIFGVDDEVKNVKVVSVKEK |
Ga0169931_100910149 | 3300017788 | Freshwater | MNTYRVKLEVEAEVQAFNEEDATDYVNDIFGIDDEVKSIKIIGIKEK |
Ga0169931_100995409 | 3300017788 | Freshwater | MKTYRVELEVEAEVQAFDETDATDYINDIFGLDDEIKSLRVVSVKEK |
Ga0169931_101164032 | 3300017788 | Freshwater | MNKYSVKLEVLVEVEAFDEGDARDYINDIFGTDDEVKSIKIISLKEK |
Ga0169931_101850185 | 3300017788 | Freshwater | MNTYIVNLEVDAEVQAFNEDDAVDYVNDIFGIDDEVTDVRVISVKERK |
Ga0169931_102071712 | 3300017788 | Freshwater | MKSYKVKLEIDVEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0169931_102124723 | 3300017788 | Freshwater | MNTYRVKLEVEAEVQAFDEADASDYINDIFGVDDEVKSIKVVNVKEK |
Ga0169931_103431013 | 3300017788 | Freshwater | MNTYKVKIEIEAEVEAFDESDALDYASDIFGTDDEIKNVKVVSVKEK |
Ga0169931_106314252 | 3300017788 | Freshwater | MNTYRVKLEVEAEVQAFDEADASDYINDIFGVDDEVKSIKVVSVKEK |
Ga0169931_108888262 | 3300017788 | Freshwater | MNTYRVKLEVEAEVQAFDEADASDYINDIFGVDDEVKSVKVISVKEK |
Ga0188881_100038814 | 3300019146 | Freshwater Lake | MKKYKIKLEIEAEVEAFDEDDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0188881_100049632 | 3300019146 | Freshwater Lake | MNTYKVKLEVMAEVEAFDESDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0181359_10244237 | 3300019784 | Freshwater Lake | EAHIQAFSEDDAKDYINDIFGVDDEVKNVKLLSVREK |
Ga0181359_10633002 | 3300019784 | Freshwater Lake | MNIYKVKLEVDVEIEAFNEDDALDYSSDIFGVDDEIKNVKVVSIKEK |
Ga0207193_11086838 | 3300020048 | Freshwater Lake Sediment | MHTYSVKIEIDAEVEAFSSEDAVDYANDIFGVDDEVKNVKVVSVKEK |
Ga0207193_12165264 | 3300020048 | Freshwater Lake Sediment | MNIYRVKLEVEAEVEAFDQDDALDYANDIFGVXXXXX |
Ga0194113_100494896 | 3300020074 | Freshwater Lake | MNIYTVKLEVEAEVEAFNEDDALEYAGEIFGVDDEIKNVEVISIKEN |
Ga0194113_100799357 | 3300020074 | Freshwater Lake | MKTYKIKLDIEAEVQAFDEDDASDYINDIFGVDDEVKSVKVISVKEK |
Ga0194113_101657644 | 3300020074 | Freshwater Lake | MKKYTVKLEVLAEVEAFDENDARDYLNDIFGTDDEIKSIKIISVKEK |
Ga0194113_102490262 | 3300020074 | Freshwater Lake | MKTYTVKLEVEAEVEAFNEDDALDYAGDIFGVDDEIKNVKIISVKEK |
Ga0194113_110457312 | 3300020074 | Freshwater Lake | MKTYKVKLDIEAEIQAFDEADASDYINDIFGVDDEVKSVKVISVKEK |
Ga0194111_104825201 | 3300020083 | Freshwater Lake | MNIYRVKLEVEVEVQAFDESDALDYANDIFGVDDEI |
Ga0194111_106458702 | 3300020083 | Freshwater Lake | MKTYTVKLEVQAEVEAFNEDDALDYAGDIFGVDDEIKNVKIISVKEK |
Ga0211732_12925242 | 3300020141 | Freshwater | MKNYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0211736_102233273 | 3300020151 | Freshwater | MNTYKVKLEVEAEIEAFDEGDALDYSNDIFGTDDEIKSIKIVSIKEK |
Ga0211736_102753002 | 3300020151 | Freshwater | MKNYKVKLEVEAEVEAFDEDDALDYANDIFGVDDEIKNVKVISVK |
Ga0211736_1076002311 | 3300020151 | Freshwater | MNIYKVKLEVDVEIEAFNEDDALDYSSDIFGVDDEIKNVKVISVKEK |
Ga0211734_100054408 | 3300020159 | Freshwater | MNTYKVKIEIDAEVEAFSSEDAVDYANDIFGIDDEVKNVKVVSVKEK |
Ga0211734_100532523 | 3300020159 | Freshwater | MNTYRVKIEIEAEIEAFDEDDARDYASDIFGVDDEIRSAKIIEIKNK |
Ga0211734_103152701 | 3300020159 | Freshwater | MKNYKVKLEVEVEVEAFDESDALDYANDIFGVDDEIKN |
Ga0211734_103282863 | 3300020159 | Freshwater | MKNYKVKLEVEAEVEAFDESDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0211734_105529284 | 3300020159 | Freshwater | MKNYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISVK |
Ga0211734_112946572 | 3300020159 | Freshwater | VKRYKVKLEVEAEVEAFDEGDALDYANDIFGTDDEIKNVKVITVKEK |
Ga0211733_109083582 | 3300020160 | Freshwater | MKNYKVKLEVEAEVEAFDEDDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0211726_101729226 | 3300020161 | Freshwater | MNIYKVKLEVDVEIEAFNEDDALDYSSDIFGVDDEIKNVKV |
Ga0211735_106421901 | 3300020162 | Freshwater | MKNYRVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0211729_1034199330 | 3300020172 | Freshwater | MNTYVVKIEVEAHIEAFTEDDARDYISEIFGVDDEVKNVKVLNVKEK |
Ga0211729_104527421 | 3300020172 | Freshwater | MKNYKVKLEVEVEVEAFDESDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0194115_103344382 | 3300020183 | Freshwater Lake | MNVYRVKLEVEVEVQAFDESDALDYANDIFGVDDEIKNVKVINVKEN |
Ga0194128_101636112 | 3300020197 | Freshwater Lake | MKTYTVKLEVEAEVEAFNEDDALDYAGDIFGVDDEIKNVKIISVKEN |
Ga0194127_100884094 | 3300020221 | Freshwater Lake | MNKYNTVKLEVLAEVEAFDENDARDYLNDIFGTDDEIKSIKIISVKEK |
Ga0194125_107276421 | 3300020222 | Freshwater Lake | DIEAEVQAFDEDDASDYINDIFGVDDEVKSVKVISVKEK |
Ga0208201_1017451 | 3300020480 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKI |
Ga0208200_1087612 | 3300020487 | Freshwater | MNTYRIKIEVDAEVQAFSENDAIDYVNDIFGVDEEIKSIKVVSTKEK |
Ga0208050_10013124 | 3300020498 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK |
Ga0208590_10380031 | 3300020501 | Freshwater | MNIYRVKLEVEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0208091_100055310 | 3300020506 | Freshwater | MNTYRVKIEVDAEVQAFSENDAVDYVNDIFGVDDEVKSVKLVSVKEK |
Ga0208091_10095442 | 3300020506 | Freshwater | MNNYKVKLEIDAEVQAFNENDAIDYVNDIFGVDEEIKNIKIVSVKEK |
Ga0208223_10139914 | 3300020519 | Freshwater | MKSYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKSVKVISVKEK |
Ga0208233_10104521 | 3300020529 | Freshwater | MNIYRVKLEVEAEVEAFDQDDALDYANDIFGVDDEIKN |
Ga0208235_10105282 | 3300020530 | Freshwater | MNTYRVKIEIEAEIEAFDEGDARDYASDIFGVDDEIKSAKIIEIKSK |
Ga0208856_10229962 | 3300020548 | Freshwater | MNIYRVKLEVEAEVEAFDQDDALDYANDIFGVDDEIKKVKVVSVKEQ |
Ga0208486_10465292 | 3300020556 | Freshwater | MNIYRVKLEVEAEVEAFDQDDALDYANDIFGVDDEIKSAKIIEIKSK |
Ga0208597_10161074 | 3300020562 | Freshwater | MKKYKVSLEIEAEVEAFDEDDALDYANDIFGVDDEIKSVKVISVKEK |
Ga0207909_10419551 | 3300020572 | Freshwater | HIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVKEK |
Ga0194126_106153782 | 3300020603 | Freshwater Lake | MKTYKIKLDIEAEVQAFDEDDASDYINDIFGVDDEV |
Ga0194123_101737611 | 3300021093 | Freshwater Lake | TVKLEVLAEVEAFDENDARDYLNDIFGTDDEIKSIKIISVKEK |
Ga0214163_10756852 | 3300021141 | Freshwater | MKKYKVNIEIEAEIEAFDEGDARDYANDIFGIDDEIKKVNIV |
Ga0214163_10880612 | 3300021141 | Freshwater | MKTYLIKLEVEAHIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVKEK |
Ga0194130_104735372 | 3300021376 | Freshwater Lake | MNTYRVKLEVEAEVQAFDETDAADYINDIFGLDDEIKSLKVVSVKEK |
Ga0194117_100951644 | 3300021424 | Freshwater Lake | GIMKKYTVKLEVLAEVEAFDENDARDYLNDIFGTDDEIKSIKIISVKEK |
Ga0194117_103359671 | 3300021424 | Freshwater Lake | EAEVQAFDETDAADYINDIFGLDDEIKSLKVVSVKEK |
Ga0194060_101343862 | 3300021602 | Anoxic Zone Freshwater | MNIYVIKLEVEAHIQAFSEDDAKDYVNDIFGVDDEIKNIKMLSVKEK |
Ga0222714_1000501828 | 3300021961 | Estuarine Water | MNTYKVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0222714_1000722519 | 3300021961 | Estuarine Water | MAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0222714_100726213 | 3300021961 | Estuarine Water | MKNYKVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0222714_100900282 | 3300021961 | Estuarine Water | MKTYSIKLEINAEVQAFSEEDAIEYINDIFGIDEEVKSVKMISVKEK |
Ga0222714_101428744 | 3300021961 | Estuarine Water | MKTYSVKLEVNAEVQAFSEEDAAEYINDIFGVDEEVKSVKVTSVKEK |
Ga0222714_103591792 | 3300021961 | Estuarine Water | MKKYKVKLEVDVEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0222713_100179591 | 3300021962 | Estuarine Water | MNTYRVKLEVMAEVEAFDEGDALDYAHDIFGVDDEIKNVKVISVKEK |
Ga0222713_1003690110 | 3300021962 | Estuarine Water | MKKYRVTLEIEAEIEAFDEGDALDYTSDIFGIDDEIKKVTIINIKAK |
Ga0222713_100569858 | 3300021962 | Estuarine Water | MNTYRVKIEIDAEVEAFSSEDAVDYANDIFGIDDEVKNVKVISVKEK |
Ga0222713_100932745 | 3300021962 | Estuarine Water | MNTYKVKLEVEAEVEAFDETDALDYASDIFGIDDEIKNVKVISVKEK |
Ga0222713_101382576 | 3300021962 | Estuarine Water | MNNYKVKLEIDAEVQAFNEDDAIDYVNDIFGVDEEIK |
Ga0222713_103953542 | 3300021962 | Estuarine Water | MNTYKIKLEVDAEVEAFSSEDAVDYANDIFGVDDEVKNVKVLSVKEK |
Ga0222713_104950682 | 3300021962 | Estuarine Water | MNTYRVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0222712_1000416530 | 3300021963 | Estuarine Water | MNIYSVKIEINAEVEAFSSEDAIDYANDIFGVDDEVKSVKVISVKEK |
Ga0222712_100711497 | 3300021963 | Estuarine Water | MNTYKVKLEVEAEVEAFDENDALDYANDIFGVDDEIKNVKVISI |
Ga0222712_100983322 | 3300021963 | Estuarine Water | MNNYKVKLEIDAEVQAFNEDDAIDYVNDIFGVDEEIKNIKVVSVKEK |
Ga0222712_103059532 | 3300021963 | Estuarine Water | MNTYRVKIEVDAEVEAFNEEDAVDYINDIFGIDDEVKSIKVINVKER |
Ga0181353_11080611 | 3300022179 | Freshwater Lake | NAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKEK |
Ga0196901_12791671 | 3300022200 | Aqueous | MNTYRVKLEIDAEVQAFSEDDAVDYMNDIFGIDDEVKSVKVVSVKEK |
Ga0181351_10503073 | 3300022407 | Freshwater Lake | MNTYVIKLEVEAHIQAFSEDDAKDYINDIFGVDDEVKNVKLLSVREK |
Ga0214917_1000009935 | 3300022752 | Freshwater | MNTYKVKLEVDAEILAYSEEDARDYITDIYGLDEEILRIKIVDIKEK |
Ga0214917_100372565 | 3300022752 | Freshwater | MKKYKVKLEIDAEVEAFDEGDALDYANDIFGVDDEIKNVKVINVKEK |
Ga0214921_1000489536 | 3300023174 | Freshwater | MNTYVIKLEVEAHIQAFSEDDARDYINDIFGVDDEVKNVKLLSVKEK |
Ga0214921_104907502 | 3300023174 | Freshwater | MNTYKVKLEVEVEIQAFNENDATDYINDIFGVDDEIKSVKLISIKGK |
Ga0255207_10038299 | 3300024277 | Freshwater | MKKYEVKLEVMAEIEAFDEDDAKDYISDIFGVDDEIKFIKILNIKEK |
Ga0255147_100026613 | 3300024289 | Freshwater | MKTYKVKLEIEAEVQAFDENDAVDYLNDIFGVDDEVRNVKVVSVKEK |
Ga0255147_10016192 | 3300024289 | Freshwater | MNTYSIKLEINAEVQAFSEEDAVDYANDIFGVDDEVKNVKVVSVKEK |
Ga0255147_10037824 | 3300024289 | Freshwater | MKFYNIKIEISAEVEAFSEEDAVEYVNDIFGIDDEVKNVKVISVKEK |
Ga0255147_10106131 | 3300024289 | Freshwater | MNTYSVKLEVNAEVQAFSEEDAVDYVNDIFGIDDEVKSVKVTNIKEK |
Ga0255147_10733592 | 3300024289 | Freshwater | MNTYSIKLEVNAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK |
Ga0255178_10182752 | 3300024298 | Freshwater | MKFYNIKIEISAEVEAFSEEDAVEYVNDIFGIDDEVKSVKVISVKEK |
Ga0255148_10096541 | 3300024306 | Freshwater | YNIKIEISAEVEAFSEEDAVEYVNDIFGIDDEVKNVKVISVKEK |
Ga0255148_10829412 | 3300024306 | Freshwater | IMKFYNIKIEISAEVEAFSEEDAVEYVNDIFGIDDEVKSVKVISVKEK |
Ga0244775_100745112 | 3300024346 | Estuarine | MHTYSVKIEIDAEVEAFSSEDAIDYANDIFGVDDEVKNVKVVSVKEK |
Ga0244775_102940472 | 3300024346 | Estuarine | MKTYLIKLELEAHIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVKEK |
Ga0244775_109577692 | 3300024346 | Estuarine | MKSYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0244775_110274242 | 3300024346 | Estuarine | MNTYKVKLEVMAEVEAFDESDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0244775_113107612 | 3300024346 | Estuarine | MNTYKVKLELEAHIEAFNEDDVRDYISDIMGIDEEFKSVKIKSITAMGEK |
Ga0244775_115559612 | 3300024346 | Estuarine | MHTYSVKIEIDAEVEAFSSEDAIDYANDIFGVDDEVKN |
Ga0255157_10462142 | 3300024355 | Freshwater | MNTYKVKLEIEAEIQAFDEDDAVDYLNDIFGVDDEVRNVKVVSVKEK |
Ga0255223_10156801 | 3300024480 | Freshwater | MKTYSVKLEVNAEVQAFSEEDAADYINDILGVDEEVKSVKVTSVKEK |
Ga0255265_10468742 | 3300024482 | Freshwater | MKTYKVKLEIEAEVQAFDENDAVDYLNDIFGVDDEVRNVKVVNVKEK |
Ga0256332_10872202 | 3300024484 | Freshwater | MKFYNIKIEISAAVEAFSEEDAVEYVNDIFGIDDEVKNVKVISVKEK |
Ga0255194_10501202 | 3300024494 | Freshwater | RGRRTKSIMKNYKVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0255199_10557382 | 3300024498 | Freshwater | EAEVEAFDEGDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0255143_10834412 | 3300024500 | Freshwater | YSIKLEVNAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK |
Ga0255181_10730291 | 3300024502 | Freshwater | IMKTYKVKLEIDAEVQAFDENDAVDYLNDIFGVDDEVRNVKVVNVKEK |
Ga0255152_10731772 | 3300024503 | Freshwater | TYKVKLEIDAEVQAFDENDAVDYLNDIFGVDDEVKNVKVVSVKEK |
Ga0255176_10440463 | 3300024507 | Freshwater | MNTYKVKLEIEAEIQAFDEDDAVDYLNDIFGVDDE |
Ga0255144_10609822 | 3300024513 | Freshwater | MNTYSVKLEVNAEVQAFSEEDAVDYVNDIFGIDDEVKSVKVTNIKE |
Ga0255177_10222422 | 3300024514 | Freshwater | KFYNIKIEISAEVEAFSEEDAVEYVNDIFGIDDEVKNVKVISVKEK |
Ga0255284_10603412 | 3300024559 | Freshwater | MKTYRVKLEVEAEIQAFDENDAADYVNDIFGIDDEVRSVKVVNIKEK |
Ga0256336_10605442 | 3300024562 | Freshwater | MKTYKVKLEIDAEVQAFDENDAVDYLNDIFGVDDEVRNVKVVSVKEK |
Ga0255268_11506032 | 3300024572 | Freshwater | MKTYSVKLEVNAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVK |
Ga0256337_11507091 | 3300024573 | Freshwater | NTYSVKLEVNAEVQAFSEEDAVDYVNDIFGIDDEVKSVKVTNIKEK |
Ga0255267_11348082 | 3300024867 | Freshwater | MNTYSIKLEVNAEVQAFSEEDAVDYVNDIFGIDDEVKSVKVTNIKEK |
Ga0208048_11025861 | 3300025283 | Freshwater | MNKYTVKLEVMAEIEAFDSDDAQDYITDIFGIDDE |
Ga0208546_10103793 | 3300025585 | Aqueous | MNTYRIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKNVKVVSVKEK |
Ga0208784_10123464 | 3300025732 | Aqueous | MNTYKVKLEVEVEIQAFNENDAKDYVADIFGIDDEVKSVKVVNIKEK |
Ga0208784_11476732 | 3300025732 | Aqueous | MNTYSVKIEINAEIEAFSEEDAADYINDIFGVDDEVKSVKVINIKEK |
Ga0256297_10159093 | 3300026435 | Freshwater | MNTYKVKLEVTAEVEAFDESDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0255155_10266642 | 3300026455 | Freshwater | EISAEVEAFSEEDAVEYVNDIFGIDDEVKNVKVISVKEK |
Ga0255166_10072792 | 3300026473 | Freshwater | MNTYSVKLEVNAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK |
Ga0255156_10617462 | 3300026478 | Freshwater | EVEAFSEEDAVEYVNDIFGIDDEVKNVKVISVKEK |
Ga0255285_11146161 | 3300026562 | Freshwater | MNTYSIKLEVNAEVQAFSEEDAVDYVNDIFGIDDEVKSVKVTNIK |
Ga0255277_10184137 | 3300026569 | Freshwater | MKTYKVKLEIEAEVQAFDENDAVDYLNDIFGVDDEV |
Ga0255289_10518761 | 3300026571 | Freshwater | MNTYSVKLEVNAEVQAFSEEDAVDYVNDIFGIDDEVKSVKVINIKEK |
Ga0208009_10018966 | 3300027114 | Deep Subsurface | MNTYKVKLEVTAEVEAFDESDALEYANDIFGVDDEIKNVKVVSVKEK |
Ga0208009_10109237 | 3300027114 | Deep Subsurface | AEVEAFDEGDALDYANDIFGTDDEIKNVKVVSVKEK |
Ga0255082_10010041 | 3300027139 | Freshwater | TYSVKLEVNAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKEK |
Ga0255182_10818892 | 3300027503 | Freshwater | MKTYKVKFEIDAEVQAFDENDAVDYLNDIFGVDDEVRNVKVVNVKEK |
Ga0255085_10969502 | 3300027538 | Freshwater | MNTYKVKLEVTAEVEAFDESDALDYANDIFGVDDEIKNVKVVS |
Ga0208966_10007395 | 3300027586 | Freshwater Lentic | MNVYKVKLEVEVEIEAFNEDDALDYSSDIFGVDDEIKNVKVVSVKEK |
Ga0208975_10814201 | 3300027659 | Freshwater Lentic | MKKYKVKLEIEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0208975_10901972 | 3300027659 | Freshwater Lentic | AEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0208975_12004851 | 3300027659 | Freshwater Lentic | MKSYKVKLEIEAEVEAFDEDDALDYANDIFGVDDEIKN |
Ga0209599_1000018934 | 3300027710 | Deep Subsurface | MNNYRIKIEVDAEVQAFSENDAVDYVNDIFGIDEEIKNIKVVSVKEK |
Ga0209599_100047758 | 3300027710 | Deep Subsurface | MNTYKIKLEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVLSVKEK |
Ga0209599_100581242 | 3300027710 | Deep Subsurface | MNTYRVKLEVEAEVEAFDQNDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0209296_100857313 | 3300027759 | Freshwater Lake | MNTYNIKIEINAEVQAFNEEDAVDYANDIFGIDDEVKNVKVVSVKEK |
Ga0209296_11045922 | 3300027759 | Freshwater Lake | MNIYKVRLEVDVEIEAFNEDDALDYSSDIFGIDDEIKNVKVVSIKEK |
Ga0209296_11355682 | 3300027759 | Freshwater Lake | MNTYKVKLEVMAEVEAFDESDALEYANDIFGVDDEIKNVKVVSVKEK |
Ga0209296_12139562 | 3300027759 | Freshwater Lake | MNTYKVRLEVDVEIEAFNEDDALDYSSDIFGVDDEIKNVKVVSIKEK |
Ga0209296_13521031 | 3300027759 | Freshwater Lake | MNTYKVKLEVMAEVEAFDESDALDYANDIFGVDDEIKTVKVVSVKEK |
Ga0209288_102957792 | 3300027762 | Freshwater Sediment | MNTYVIKLEVEAQIDAFSEDDARDYVNDIFGVDDEVKNVKILSVKEK |
Ga0209770_101687091 | 3300027769 | Freshwater Lake | VDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK |
Ga0209972_100362306 | 3300027793 | Freshwater Lake | MKTYRVKLEVEAEIQAFDEDDAVDYLNDIFGVDDEVKNVKVVNVKEK |
Ga0209972_100693952 | 3300027793 | Freshwater Lake | MNTYSVKLEVSAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK |
Ga0209972_100945463 | 3300027793 | Freshwater Lake | MKTYSVKIEVNAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKEK |
Ga0209107_102268801 | 3300027797 | Freshwater And Sediment | EAEVEAFDQDDALDYANDIFGVDDEIKSVKVISVKEK |
Ga0209358_100514434 | 3300027804 | Freshwater Lake | MKRYKVKLEVDVEVEAFDEGDALDYANDIFGVDDEIKNVKVINVKEK |
Ga0209229_10000004117 | 3300027805 | Freshwater And Sediment | MNTYKIKLEVDAEVEAFSSDDAVDYANDIFGVDDEVKNVKVVSVKEK |
Ga0209229_100038015 | 3300027805 | Freshwater And Sediment | MNTYRVKIEIDAEVEAFSSEDAVDYANDIFGVDDEVKNVKVVSVKEK |
Ga0209229_100054256 | 3300027805 | Freshwater And Sediment | MKKYSVKIEIDAEVEAFSSEDAVDYANDIFGVDDEVKNVKVVSVKEK |
Ga0209229_100436684 | 3300027805 | Freshwater And Sediment | MNTYKVKLEIEAEVQAFDEADASDYINDIFGVDDEVKSIKVVSVKEK |
Ga0209229_100657533 | 3300027805 | Freshwater And Sediment | MNTYKVKIEIDAEVEAFSSEDAVDYANDIFGIDDEVKNVKVLSVKEK |
Ga0209229_101179923 | 3300027805 | Freshwater And Sediment | MKTYKVKLEVNAEVQAFSEDDAVEYINDIFGIDDEVKNVKVVTVKEK |
Ga0209229_102914041 | 3300027805 | Freshwater And Sediment | MNIYSVKIEINAEVEAFSSEDAIDYANDIFGVDDEVKNVKVISVKEKSNG |
Ga0209990_101960392 | 3300027816 | Freshwater Lake | MNTYKIKLEVDAEVQAFTEDDAADYINDIFGIDDEVKSVKVVTIKEK |
Ga0209550_100995517 | 3300027892 | Freshwater Lake | YKVKLEVLAEVEAFDESDALEYANDIFGVDDEIKNVKVISVKEK |
Ga0247723_10098688 | 3300028025 | Deep Subsurface Sediment | MNTYLVKIELNAQIDAFNENDAIEYINDIFGVDDEVKSIKVINIKQQ |
Ga0247723_10109553 | 3300028025 | Deep Subsurface Sediment | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKDK |
Ga0247723_10632152 | 3300028025 | Deep Subsurface Sediment | MNTYRVKLEVEAEVEAFDQDDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0255201_10366511 | 3300028086 | Freshwater | LELEAEVEAFDEGDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0255174_10199493 | 3300028275 | Freshwater | IEISAEVEAFSEEDAVEYVNDIFGIDDEVKNVKVISVKEK |
Ga0255233_10134385 | 3300029699 | Freshwater | MNTYKVKLEVTAEVEAFDESDALDYANDIFGVDDEIKNVKVVSVK |
Ga0119944_100023518 | 3300029930 | Aquatic | MNTYRVKLEIEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0315907_1000012755 | 3300031758 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEITNVKVISVKEK |
Ga0315907_100010593 | 3300031758 | Freshwater | MNTYRVKIEVDAEVQAFNEDDAIDYVNDIFGVDEEIKSIKVVNVKEK |
Ga0315907_1001050226 | 3300031758 | Freshwater | MHTYGIKIEINAEVEAFSEDDAVDYVNDMFGVDDEVKSVKVVSVKEK |
Ga0315907_102231855 | 3300031758 | Freshwater | MNTYKIKLEVDAEVEAFTKEDAADYINDIFGIDDEVKSVKVVTIKEK |
Ga0315907_102356592 | 3300031758 | Freshwater | MNTYSIKIEVNAEVQAFTEDDAIDYVSDIFGVDDEVKSIKVVSVKEK |
Ga0315907_102891582 | 3300031758 | Freshwater | MNTYRVKLEVMAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0315907_103158272 | 3300031758 | Freshwater | MNTYRIKIEVDAEVQAFSENDAVDYVNDIFGVDDEVKNVKVVSVKEK |
Ga0315907_103520722 | 3300031758 | Freshwater | MNTYRIKIEIDAEVQAFSENDAVDYVNDIFGVDDEVKNVKVVSVKEK |
Ga0315907_103732992 | 3300031758 | Freshwater | MKKYKVKLEVEVEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0315907_104107403 | 3300031758 | Freshwater | LEYAQPAESKMNTYKIKIEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK |
Ga0315907_104755972 | 3300031758 | Freshwater | VNAEVQAFSEQDAAEYINDIFGIDDEVKSVKVISVKEK |
Ga0315907_109000852 | 3300031758 | Freshwater | MNTYKIKLEVEAEVQAFTEDDAADYVNDIFGVDDEVKSVKVINIKEK |
Ga0315899_113020222 | 3300031784 | Freshwater | IEIDAEVEAFSSEDAVDYANDIFGIDDEVKNVKVVSVKEK |
Ga0315900_105105112 | 3300031787 | Freshwater | MNTYSVKIEVNAEVQAFSQDDAVDYVNDIFGIDDEVKSIKVINVKEK |
Ga0315909_100549173 | 3300031857 | Freshwater | MPYLRKVVMNTYSIKIEVNAEVQAFTEDDAIDYVSDIFGVDDEVKSIKVVSVKEK |
Ga0315909_101896742 | 3300031857 | Freshwater | MNTYKIKLEVDAEVQAFSEEDAADYINDIFGVDDEVKSVKVISVKEK |
Ga0315909_101996182 | 3300031857 | Freshwater | MNTYSIKIEVNAEVQAFSEQDAAEYINDIFGIDDEVKSVKVISVKEK |
Ga0315909_103061752 | 3300031857 | Freshwater | MKKYKVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0315909_105624212 | 3300031857 | Freshwater | EVEAFDQDDALDYANDIFGVDDEIKNVKVVSVKEK |
Ga0315904_103145332 | 3300031951 | Freshwater | MNTYRVKIEIDAEVQAFSENDAVDYVNDIFGVDDEVKSVKVVSVKEK |
Ga0315904_103290062 | 3300031951 | Freshwater | MNTYRVKIEVDAEVQAFSENDAVDYVNDIFGVDDEVKSVKLLSVKEK |
Ga0315904_105454702 | 3300031951 | Freshwater | MKSYNIKIEINAEVEAFSEEDATEYVNDIFGIDDEVKSVKVISVKEK |
Ga0315904_109203731 | 3300031951 | Freshwater | LSNMNTYRIKIEVDAEVQAFSENDAVDYVNDIFGVDDEVKNVKVVSVKEK |
Ga0315904_109470552 | 3300031951 | Freshwater | MNTYSIKLEVSAEIEAFSEDDAVDYINDIFGVDDEVKNVKVINVKEK |
Ga0315904_111521772 | 3300031951 | Freshwater | MNPYRVKLEVEAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0315904_111919981 | 3300031951 | Freshwater | IGKACFDRRCMPYLRKVVMNTYSIKIEVNAEVQAFTEDDAIDYVSDIFGVDDEVKSIKVVSVKEK |
Ga0315904_112138272 | 3300031951 | Freshwater | MNTYSIKIEINAEVQAFSEEDAAEYINDIFGIDEEVKSVKVISVKEK |
Ga0315901_103295601 | 3300031963 | Freshwater | MNTYRVKLEVMAEVEAFDEGDALDYANDIFGVDDEIKNV |
Ga0315901_109067031 | 3300031963 | Freshwater | EAEVEAFDEGDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0315906_103856001 | 3300032050 | Freshwater | IEVNAEVQAFSQDDAVDYVNDIFGIDDEVKSIKVINVKEK |
Ga0315906_108150252 | 3300032050 | Freshwater | MNTYVVKLEVEAQIEAFSEDDARDYINDIFGVDDEVKNVKILNVKEK |
Ga0315902_112941061 | 3300032093 | Freshwater | MKSYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKNVKVI |
Ga0315902_113212611 | 3300032093 | Freshwater | EYAQPAESKMNTYKIKIEVDAEVEAFSSEDAVDYANDIFGVDDEIKNVKVISVKEK |
Ga0315903_107476722 | 3300032116 | Freshwater | MNTYSIKLEVSAEIQAFSEDDAVDYINDIFGVDDEVKNVKVINVKEK |
Ga0334980_0063383_1146_1289 | 3300033816 | Freshwater | MKKYKVSLEIEAEVEAFDEDDALDYANDIFGVDDEIKKVKVVSVKEQ |
Ga0334977_0160123_19_162 | 3300033978 | Freshwater | MNTYRVKLEIEAEIEAFDEDDARDYANDIFGVDDEIRSAKIIEIKNK |
Ga0334982_0011751_3109_3252 | 3300033981 | Freshwater | MNIYRVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK |
Ga0334992_0457097_106_249 | 3300033992 | Freshwater | MNKYLIKLEISAEVEAFDENDALDYANDIFGVDDEIKNVKVISVKEK |
Ga0334994_0315239_302_445 | 3300033993 | Freshwater | MNTYRIKLEVDAEIQAFNEDDAVDYVSDIFGVDDEVKNVKVVSVKEK |
Ga0334985_0310259_1_108 | 3300034018 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEI |
Ga0335004_0339370_356_499 | 3300034021 | Freshwater | MNIYRVKLEVEAEVEAFDQDDALDYANDIFGVDDEIKNVKVVSVKEQ |
Ga0335000_0565725_521_643 | 3300034063 | Freshwater | LEVEAEVEAFDQDDALDYANDIFGVDDEIKNVKVVSVKEQ |
Ga0335019_0000065_3768_3911 | 3300034066 | Freshwater | MNTYRVKIEIDAEVEAFSSEDAVDYANDIFGIDDEVKNVKVVSVKEK |
Ga0334990_0121338_88_231 | 3300034068 | Freshwater | MNNYKVKLEIDAEVQAFNENDAIDYVNDIFGLDEEIKNIKIVSVKEK |
Ga0335028_0262569_599_742 | 3300034071 | Freshwater | MKNYKVKLEIEAEVEAFDQDDALDYANDIFGVDDEIKSVKVISVKEK |
Ga0335028_0555742_486_623 | 3300034071 | Freshwater | MKTYSVKLEVNAEVQAFSEEDAADYINDIFGVDEEVKSVKVTSVKE |
Ga0310127_192205_586_729 | 3300034072 | Fracking Water | MKTYRVKLEVDAEVQAFSEDDAVDYMNDIFGVDDEVKSVKVVSVREK |
Ga0310130_0003902_2516_2659 | 3300034073 | Fracking Water | MNTYRVKLEVDAEVQAFSEDDAVDYINDIFGVDDEVKSVKIVNVKEK |
Ga0310130_0004266_831_974 | 3300034073 | Fracking Water | MNTYSVKIEVNAEVQAFNEDDAVDYVNDIFGVDDEVKSIKVVSVKEK |
Ga0335020_0290705_599_742 | 3300034082 | Freshwater | MKSYKVKLEIEAEVEAFDQDDALDYAKDIFGVDDEIKSVKVISVKEK |
Ga0335012_0546710_408_542 | 3300034093 | Freshwater | MNTYVIKLEVEAHIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVK |
Ga0335027_0023016_354_497 | 3300034101 | Freshwater | MNNYKVKLEIDAEVQAFNENDAVDYVNDIFGVDEEIKNIKIVSVKEK |
Ga0335027_0073778_1157_1300 | 3300034101 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYSNDIFGVDDEIKNVKIINVKEK |
Ga0335027_0380187_814_921 | 3300034101 | Freshwater | MNIYRVKLEVEAEVEAFDQDDALDYANDIFGVDDEI |
Ga0335027_0729445_448_582 | 3300034101 | Freshwater | YRVKIEIEAEIEAFDEGDARDYASDIFGVDDEIKSAKIIEIKSK |
Ga0335035_0224680_880_1023 | 3300034105 | Freshwater | MNIYVIKLEVEAHIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVKEK |
Ga0335036_0148938_180_323 | 3300034106 | Freshwater | MNIYRVKLEVEVEVEAFDENDALDYSNDIFGIDDEIKNVKVLNVKEK |
Ga0335036_0212192_2_136 | 3300034106 | Freshwater | MNTYRVKLEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVK |
Ga0335066_0019442_4685_4798 | 3300034112 | Freshwater | EVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK |
Ga0335066_0706043_2_121 | 3300034112 | Freshwater | EVNAEVQAFTEDDAIDYVSDIFGVDDEVKSIKVVSVKEK |
Ga0335033_0337893_2_142 | 3300034117 | Freshwater | NTYVIKLEVEAHIQAFSEDDAKDYINDIFGVDDEVKNVKLLSVREK |
Ga0335053_0404977_442_585 | 3300034118 | Freshwater | MNTYVIKLEVEAHIEAFSEDDARDYINDIFGVDDEVKNVKILNVKEK |
Ga0335053_0488350_611_727 | 3300034118 | Freshwater | VEAHIQAFSEDDAKDYINDIFGVDEEVKNVKIVSVKEK |
Ga0335060_0108079_1_117 | 3300034122 | Freshwater | VEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK |
Ga0335060_0350808_379_522 | 3300034122 | Freshwater | MKKYKVSLEIEAEVEAFDEDDALDYANDIFGVDDEIKKVKVVSVKEK |
Ga0335065_0047528_2205_2348 | 3300034200 | Freshwater | MNTYRIKIEVDAEVQAFSENDAIDYVNDIFGVDEEIKSIKVVNVKEK |
Ga0335065_0390322_89_232 | 3300034200 | Freshwater | MNTYSVKLEVNAEVQAFSEDDATDYVNDIFGIDEEVKSVKLISIKEK |
Ga0335007_0501509_604_726 | 3300034283 | Freshwater | LEVEVEVEAFDENDALDYANDIFGVDDEIKNVKIINVKEK |
⦗Top⦘ |