NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F004162

Metagenome Family F004162

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F004162
Family Type Metagenome
Number of Sequences 450
Average Sequence Length 73 residues
Representative Sequence MGKTQKVATLLGERQKIEKEIEKIQKSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNDELQNYLKQ
Number of Associated Samples 178
Number of Associated Scaffolds 450

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.11 %
% of genes near scaffold ends (potentially truncated) 21.78 %
% of genes from short scaffolds (< 2000 bps) 77.11 %
Associated GOLD sequencing projects 158
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(40.889 % of family members)
Environment Ontology (ENVO) Unclassified
(92.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(96.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 16.67%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 450 Family Scaffolds
PF10544T5orf172 10.44
PF00856SET 3.56
PF13585CHU_C 0.67
PF00535Glycos_transf_2 0.44
PF00583Acetyltransf_1 0.44
PF00085Thioredoxin 0.44
PF13508Acetyltransf_7 0.44
PF05728UPF0227 0.22
PF05050Methyltransf_21 0.22
PF13673Acetyltransf_10 0.22
PF01467CTP_transf_like 0.22



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.78 %
UnclassifiedrootN/A14.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10010457All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5990Open in IMG/M
3300000101|DelMOSum2010_c10022716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3616Open in IMG/M
3300000101|DelMOSum2010_c10035453All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2681Open in IMG/M
3300000115|DelMOSum2011_c10006575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6599Open in IMG/M
3300000115|DelMOSum2011_c10089726Not Available1039Open in IMG/M
3300000115|DelMOSum2011_c10181919All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300000116|DelMOSpr2010_c10003466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium8999Open in IMG/M
3300000116|DelMOSpr2010_c10048724Not Available1866Open in IMG/M
3300000116|DelMOSpr2010_c10065528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1503Open in IMG/M
3300000148|SI47jul10_100mDRAFT_c1004626All Organisms → cellular organisms → Bacteria3176Open in IMG/M
3300000929|NpDRAFT_10120337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1542Open in IMG/M
3300000929|NpDRAFT_10147929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1430Open in IMG/M
3300000930|BpDRAFT_10278953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1236Open in IMG/M
3300000973|BBAY93_10196864Not Available504Open in IMG/M
3300001450|JGI24006J15134_10010767All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4495Open in IMG/M
3300001450|JGI24006J15134_10010816All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4481Open in IMG/M
3300001450|JGI24006J15134_10011181All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4396Open in IMG/M
3300001450|JGI24006J15134_10015810All Organisms → cellular organisms → Bacteria3570Open in IMG/M
3300001450|JGI24006J15134_10016985All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3416Open in IMG/M
3300001450|JGI24006J15134_10018982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3196Open in IMG/M
3300001450|JGI24006J15134_10019374All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3160Open in IMG/M
3300001450|JGI24006J15134_10019422All Organisms → Viruses → Predicted Viral3156Open in IMG/M
3300001450|JGI24006J15134_10022311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2890Open in IMG/M
3300001450|JGI24006J15134_10024521All Organisms → Viruses → Predicted Viral2724Open in IMG/M
3300001450|JGI24006J15134_10025679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2648Open in IMG/M
3300001450|JGI24006J15134_10042093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1927Open in IMG/M
3300001450|JGI24006J15134_10042845All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1904Open in IMG/M
3300001450|JGI24006J15134_10056834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1567Open in IMG/M
3300001450|JGI24006J15134_10065052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1423Open in IMG/M
3300001450|JGI24006J15134_10069148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1362Open in IMG/M
3300001450|JGI24006J15134_10079762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1228Open in IMG/M
3300001450|JGI24006J15134_10085988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1163Open in IMG/M
3300001450|JGI24006J15134_10093636All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1093Open in IMG/M
3300001450|JGI24006J15134_10094028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1090Open in IMG/M
3300001450|JGI24006J15134_10127840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium866Open in IMG/M
3300001450|JGI24006J15134_10128845All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium860Open in IMG/M
3300001450|JGI24006J15134_10137041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium821Open in IMG/M
3300001450|JGI24006J15134_10154828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium747Open in IMG/M
3300001450|JGI24006J15134_10156759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium739Open in IMG/M
3300001450|JGI24006J15134_10201156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300001450|JGI24006J15134_10209098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300001460|JGI24003J15210_10023239All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2335Open in IMG/M
3300001472|JGI24004J15324_10034512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1613Open in IMG/M
3300001472|JGI24004J15324_10047056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1303Open in IMG/M
3300001589|JGI24005J15628_10098971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium984Open in IMG/M
3300001589|JGI24005J15628_10135385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium770Open in IMG/M
3300004448|Ga0065861_1124508Not Available737Open in IMG/M
3300004448|Ga0065861_1130823All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1045Open in IMG/M
3300004460|Ga0066222_1154070All Organisms → Viruses → Predicted Viral1519Open in IMG/M
3300004460|Ga0066222_1160313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium605Open in IMG/M
3300004460|Ga0066222_1217234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium794Open in IMG/M
3300004461|Ga0066223_1022403All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1212Open in IMG/M
3300006165|Ga0075443_10088471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1061Open in IMG/M
3300006190|Ga0075446_10002161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium7707Open in IMG/M
3300006190|Ga0075446_10005264All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4826Open in IMG/M
3300006190|Ga0075446_10025122All Organisms → Viruses → Predicted Viral1964Open in IMG/M
3300006190|Ga0075446_10042076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1441Open in IMG/M
3300006190|Ga0075446_10045370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1376Open in IMG/M
3300006190|Ga0075446_10070829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1051Open in IMG/M
3300006190|Ga0075446_10084506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium944Open in IMG/M
3300006484|Ga0070744_10162699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300006484|Ga0070744_10210241Not Available553Open in IMG/M
3300006735|Ga0098038_1008864All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3986Open in IMG/M
3300006735|Ga0098038_1024526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2279Open in IMG/M
3300006735|Ga0098038_1041579All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1685Open in IMG/M
3300006735|Ga0098038_1043499All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1640Open in IMG/M
3300006735|Ga0098038_1048180All Organisms → Viruses → Predicted Viral1545Open in IMG/M
3300006735|Ga0098038_1266044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300006735|Ga0098038_1272861Not Available530Open in IMG/M
3300006737|Ga0098037_1029290All Organisms → Viruses → Predicted Viral2033Open in IMG/M
3300006737|Ga0098037_1116101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium918Open in IMG/M
3300006750|Ga0098058_1038570All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1370Open in IMG/M
3300006752|Ga0098048_1047955All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1348Open in IMG/M
3300006754|Ga0098044_1142003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium966Open in IMG/M
3300006754|Ga0098044_1269988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium655Open in IMG/M
3300006789|Ga0098054_1302769All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium571Open in IMG/M
3300006789|Ga0098054_1341913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium532Open in IMG/M
3300006793|Ga0098055_1365296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300006803|Ga0075467_10703424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300006921|Ga0098060_1031077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1625Open in IMG/M
3300006921|Ga0098060_1206451Not Available536Open in IMG/M
3300006925|Ga0098050_1024389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1667Open in IMG/M
3300007229|Ga0075468_10027659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2041Open in IMG/M
3300007229|Ga0075468_10118787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium823Open in IMG/M
3300007231|Ga0075469_10019601All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2311Open in IMG/M
3300007231|Ga0075469_10062064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1098Open in IMG/M
3300007231|Ga0075469_10171529Not Available586Open in IMG/M
3300007555|Ga0102817_1124852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium570Open in IMG/M
3300007558|Ga0102822_1064688All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium863Open in IMG/M
3300007665|Ga0102908_1129318All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium520Open in IMG/M
3300007692|Ga0102823_1162449All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium594Open in IMG/M
3300007962|Ga0102907_1002612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5773Open in IMG/M
3300008050|Ga0098052_1017043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3557Open in IMG/M
3300008050|Ga0098052_1342305All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300008050|Ga0098052_1372072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300008961|Ga0102887_1183924Not Available640Open in IMG/M
3300008999|Ga0102816_1205826Not Available616Open in IMG/M
3300009049|Ga0102911_1070380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1012Open in IMG/M
3300009054|Ga0102826_1159560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300009071|Ga0115566_10488380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium699Open in IMG/M
3300009074|Ga0115549_1110310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium915Open in IMG/M
3300009077|Ga0115552_1094023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1303Open in IMG/M
3300009193|Ga0115551_1373094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium616Open in IMG/M
3300009423|Ga0115548_1053177All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1432Open in IMG/M
3300009428|Ga0114915_1078650Not Available1011Open in IMG/M
3300009433|Ga0115545_1047684Not Available1657Open in IMG/M
3300009449|Ga0115558_1381812All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300009785|Ga0115001_10238674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1166Open in IMG/M
3300009785|Ga0115001_10558091Not Available702Open in IMG/M
3300010148|Ga0098043_1121739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium751Open in IMG/M
3300010148|Ga0098043_1191951All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
3300010149|Ga0098049_1153482All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium712Open in IMG/M
3300010150|Ga0098056_1307297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300010151|Ga0098061_1142214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium874Open in IMG/M
3300010153|Ga0098059_1022262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2591Open in IMG/M
3300010153|Ga0098059_1125184Not Available1016Open in IMG/M
3300010153|Ga0098059_1231191All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium715Open in IMG/M
3300010153|Ga0098059_1273265All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300010153|Ga0098059_1351989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium559Open in IMG/M
3300011128|Ga0151669_101952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2390Open in IMG/M
3300011253|Ga0151671_1006160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium725Open in IMG/M
3300011258|Ga0151677_1015322All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5008Open in IMG/M
3300012953|Ga0163179_12162037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300012954|Ga0163111_10661342All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium982Open in IMG/M
3300017702|Ga0181374_1022886All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1108Open in IMG/M
3300017702|Ga0181374_1041906All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium789Open in IMG/M
3300017703|Ga0181367_1006513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2167Open in IMG/M
3300017703|Ga0181367_1069884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300017704|Ga0181371_1003430All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2918Open in IMG/M
3300017704|Ga0181371_1040561All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium761Open in IMG/M
3300017704|Ga0181371_1047795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium697Open in IMG/M
3300017705|Ga0181372_1001370All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5687Open in IMG/M
3300017705|Ga0181372_1008053All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300017705|Ga0181372_1009097All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1813Open in IMG/M
3300017705|Ga0181372_1019018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1180Open in IMG/M
3300017705|Ga0181372_1070793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium590Open in IMG/M
3300017706|Ga0181377_1006611All Organisms → cellular organisms → Bacteria3010Open in IMG/M
3300017706|Ga0181377_1007116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2864Open in IMG/M
3300017706|Ga0181377_1022761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1357Open in IMG/M
3300017706|Ga0181377_1025316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1266Open in IMG/M
3300017706|Ga0181377_1026402All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1231Open in IMG/M
3300017706|Ga0181377_1044841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium864Open in IMG/M
3300017708|Ga0181369_1114626All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300017709|Ga0181387_1012158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1664Open in IMG/M
3300017709|Ga0181387_1018462All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1352Open in IMG/M
3300017709|Ga0181387_1027754All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1107Open in IMG/M
3300017709|Ga0181387_1074295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium685Open in IMG/M
3300017710|Ga0181403_1002538All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4143Open in IMG/M
3300017710|Ga0181403_1023908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1295Open in IMG/M
3300017710|Ga0181403_1045388All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium921Open in IMG/M
3300017710|Ga0181403_1105833Not Available588Open in IMG/M
3300017713|Ga0181391_1005479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3402Open in IMG/M
3300017713|Ga0181391_1007852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2798Open in IMG/M
3300017713|Ga0181391_1017929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1776Open in IMG/M
3300017713|Ga0181391_1030243All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1321Open in IMG/M
3300017713|Ga0181391_1034175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1231Open in IMG/M
3300017713|Ga0181391_1052779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium956Open in IMG/M
3300017713|Ga0181391_1070883All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium803Open in IMG/M
3300017714|Ga0181412_1035597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1318Open in IMG/M
3300017717|Ga0181404_1008999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2659Open in IMG/M
3300017717|Ga0181404_1010515All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2441Open in IMG/M
3300017717|Ga0181404_1100896Not Available707Open in IMG/M
3300017718|Ga0181375_1078901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300017719|Ga0181390_1004413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5490Open in IMG/M
3300017719|Ga0181390_1032481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1624Open in IMG/M
3300017719|Ga0181390_1036010All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1520Open in IMG/M
3300017719|Ga0181390_1059887All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1095Open in IMG/M
3300017719|Ga0181390_1063537All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1053Open in IMG/M
3300017719|Ga0181390_1092998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium817Open in IMG/M
3300017720|Ga0181383_1031835All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1421Open in IMG/M
3300017720|Ga0181383_1040240All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1257Open in IMG/M
3300017720|Ga0181383_1167863All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300017721|Ga0181373_1031548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium977Open in IMG/M
3300017721|Ga0181373_1068099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium637Open in IMG/M
3300017724|Ga0181388_1016818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1846Open in IMG/M
3300017724|Ga0181388_1028817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1372Open in IMG/M
3300017725|Ga0181398_1009170All Organisms → cellular organisms → Bacteria2546Open in IMG/M
3300017725|Ga0181398_1028085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1386Open in IMG/M
3300017725|Ga0181398_1043668All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1090Open in IMG/M
3300017725|Ga0181398_1164400All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium524Open in IMG/M
3300017726|Ga0181381_1024582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1366Open in IMG/M
3300017726|Ga0181381_1089359All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium656Open in IMG/M
3300017726|Ga0181381_1109232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium582Open in IMG/M
3300017727|Ga0181401_1061309All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1008Open in IMG/M
3300017727|Ga0181401_1071861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium913Open in IMG/M
3300017728|Ga0181419_1162143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium532Open in IMG/M
3300017729|Ga0181396_1011129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1798Open in IMG/M
3300017729|Ga0181396_1049914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium834Open in IMG/M
3300017730|Ga0181417_1003014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4747Open in IMG/M
3300017730|Ga0181417_1033777All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1260Open in IMG/M
3300017730|Ga0181417_1095206All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium720Open in IMG/M
3300017731|Ga0181416_1029515All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1287Open in IMG/M
3300017731|Ga0181416_1032424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1227Open in IMG/M
3300017731|Ga0181416_1047805Not Available1008Open in IMG/M
3300017731|Ga0181416_1109593Not Available660Open in IMG/M
3300017732|Ga0181415_1004130All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3628Open in IMG/M
3300017733|Ga0181426_1057406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium771Open in IMG/M
3300017734|Ga0187222_1012312All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2105Open in IMG/M
3300017735|Ga0181431_1058775Not Available867Open in IMG/M
3300017735|Ga0181431_1155603All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300017737|Ga0187218_1011139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2416Open in IMG/M
3300017737|Ga0187218_1048023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1067Open in IMG/M
3300017737|Ga0187218_1129376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium600Open in IMG/M
3300017738|Ga0181428_1037307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1129Open in IMG/M
3300017738|Ga0181428_1045884All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1018Open in IMG/M
3300017739|Ga0181433_1009372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2723Open in IMG/M
3300017739|Ga0181433_1041480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1182Open in IMG/M
3300017739|Ga0181433_1075915All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium832Open in IMG/M
3300017739|Ga0181433_1093445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium734Open in IMG/M
3300017739|Ga0181433_1152315All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300017740|Ga0181418_1015895Not Available2000Open in IMG/M
3300017740|Ga0181418_1030809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1372Open in IMG/M
3300017740|Ga0181418_1122475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium628Open in IMG/M
3300017741|Ga0181421_1023902Not Available1663Open in IMG/M
3300017741|Ga0181421_1083705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium834Open in IMG/M
3300017741|Ga0181421_1084971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium827Open in IMG/M
3300017742|Ga0181399_1021689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1791Open in IMG/M
3300017742|Ga0181399_1043556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1187Open in IMG/M
3300017742|Ga0181399_1095542Not Available738Open in IMG/M
3300017742|Ga0181399_1116256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium656Open in IMG/M
3300017742|Ga0181399_1154351Not Available551Open in IMG/M
3300017743|Ga0181402_1023732Not Available1740Open in IMG/M
3300017743|Ga0181402_1077026All Organisms → Viruses875Open in IMG/M
3300017744|Ga0181397_1028713All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1605Open in IMG/M
3300017744|Ga0181397_1088283Not Available823Open in IMG/M
3300017746|Ga0181389_1015963All Organisms → cellular organisms → Bacteria2405Open in IMG/M
3300017746|Ga0181389_1018870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2180Open in IMG/M
3300017746|Ga0181389_1022645All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1958Open in IMG/M
3300017746|Ga0181389_1039120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1418Open in IMG/M
3300017746|Ga0181389_1133786Not Available667Open in IMG/M
3300017746|Ga0181389_1156264All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium604Open in IMG/M
3300017748|Ga0181393_1011716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2655Open in IMG/M
3300017748|Ga0181393_1014546All Organisms → cellular organisms → Bacteria2353Open in IMG/M
3300017748|Ga0181393_1042689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1258Open in IMG/M
3300017750|Ga0181405_1013681All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2302Open in IMG/M
3300017750|Ga0181405_1021258All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1797Open in IMG/M
3300017750|Ga0181405_1050196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1100Open in IMG/M
3300017750|Ga0181405_1075437Not Available866Open in IMG/M
3300017751|Ga0187219_1012507All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3250Open in IMG/M
3300017751|Ga0187219_1026167All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2081Open in IMG/M
3300017751|Ga0187219_1064761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1173Open in IMG/M
3300017751|Ga0187219_1115053All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium803Open in IMG/M
3300017751|Ga0187219_1138683Not Available708Open in IMG/M
3300017752|Ga0181400_1194445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium562Open in IMG/M
3300017753|Ga0181407_1017073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2026Open in IMG/M
3300017753|Ga0181407_1030026All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1469Open in IMG/M
3300017753|Ga0181407_1039234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1259Open in IMG/M
3300017755|Ga0181411_1078166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium993Open in IMG/M
3300017756|Ga0181382_1025912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1807Open in IMG/M
3300017757|Ga0181420_1004017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5249Open in IMG/M
3300017757|Ga0181420_1004596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4897Open in IMG/M
3300017757|Ga0181420_1056116Not Available1256Open in IMG/M
3300017757|Ga0181420_1075254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1058Open in IMG/M
3300017757|Ga0181420_1236836Not Available521Open in IMG/M
3300017758|Ga0181409_1028693Not Available1776Open in IMG/M
3300017758|Ga0181409_1042943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1405Open in IMG/M
3300017758|Ga0181409_1234675Not Available523Open in IMG/M
3300017759|Ga0181414_1067916All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium948Open in IMG/M
3300017759|Ga0181414_1126427Not Available670Open in IMG/M
3300017759|Ga0181414_1132087Not Available654Open in IMG/M
3300017759|Ga0181414_1178501Not Available552Open in IMG/M
3300017760|Ga0181408_1004023All Organisms → Viruses → Predicted Viral4306Open in IMG/M
3300017760|Ga0181408_1084387Not Available832Open in IMG/M
3300017760|Ga0181408_1100996All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium751Open in IMG/M
3300017760|Ga0181408_1111020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium711Open in IMG/M
3300017762|Ga0181422_1013397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2727Open in IMG/M
3300017762|Ga0181422_1259705Not Available513Open in IMG/M
3300017763|Ga0181410_1013007All Organisms → cellular organisms → Bacteria2860Open in IMG/M
3300017763|Ga0181410_1108647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium799Open in IMG/M
3300017763|Ga0181410_1158410All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium634Open in IMG/M
3300017764|Ga0181385_1004494All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4713Open in IMG/M
3300017764|Ga0181385_1022832Not Available1996Open in IMG/M
3300017765|Ga0181413_1019310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2135Open in IMG/M
3300017765|Ga0181413_1027763Not Available1775Open in IMG/M
3300017765|Ga0181413_1067996Not Available1095Open in IMG/M
3300017765|Ga0181413_1119472Not Available800Open in IMG/M
3300017765|Ga0181413_1154286Not Available692Open in IMG/M
3300017767|Ga0181406_1013811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2587Open in IMG/M
3300017767|Ga0181406_1155180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium686Open in IMG/M
3300017768|Ga0187220_1007403All Organisms → Viruses → Predicted Viral3328Open in IMG/M
3300017768|Ga0187220_1015236All Organisms → cellular organisms → Bacteria2314Open in IMG/M
3300017768|Ga0187220_1028246Not Available1689Open in IMG/M
3300017768|Ga0187220_1036858All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1475Open in IMG/M
3300017768|Ga0187220_1058820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1156Open in IMG/M
3300017770|Ga0187217_1030162Not Available1922Open in IMG/M
3300017770|Ga0187217_1066475All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1244Open in IMG/M
3300017770|Ga0187217_1074345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1169Open in IMG/M
3300017770|Ga0187217_1206086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300017771|Ga0181425_1040387All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1528Open in IMG/M
3300017771|Ga0181425_1049139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1374Open in IMG/M
3300017771|Ga0181425_1165935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium698Open in IMG/M
3300017771|Ga0181425_1171665Not Available684Open in IMG/M
3300017772|Ga0181430_1017622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2370Open in IMG/M
3300017772|Ga0181430_1052302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1266Open in IMG/M
3300017772|Ga0181430_1183748Not Available600Open in IMG/M
3300017772|Ga0181430_1213536Not Available549Open in IMG/M
3300017773|Ga0181386_1027846Not Available1864Open in IMG/M
3300017775|Ga0181432_1004520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3174Open in IMG/M
3300017775|Ga0181432_1007809All Organisms → cellular organisms → Bacteria2536Open in IMG/M
3300017775|Ga0181432_1011575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2156Open in IMG/M
3300017775|Ga0181432_1011845All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2137Open in IMG/M
3300017775|Ga0181432_1014625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1964Open in IMG/M
3300017775|Ga0181432_1020655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1699Open in IMG/M
3300017775|Ga0181432_1021053All Organisms → Viruses → Predicted Viral1686Open in IMG/M
3300017775|Ga0181432_1022482All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1642Open in IMG/M
3300017775|Ga0181432_1026198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1540Open in IMG/M
3300017775|Ga0181432_1026692All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1529Open in IMG/M
3300017775|Ga0181432_1028533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1485Open in IMG/M
3300017775|Ga0181432_1055030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1121Open in IMG/M
3300017775|Ga0181432_1067357Not Available1028Open in IMG/M
3300017775|Ga0181432_1070715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1007Open in IMG/M
3300017775|Ga0181432_1077908All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium965Open in IMG/M
3300017775|Ga0181432_1091514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium898Open in IMG/M
3300017775|Ga0181432_1098634Not Available868Open in IMG/M
3300017775|Ga0181432_1113525Not Available815Open in IMG/M
3300017775|Ga0181432_1116982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium803Open in IMG/M
3300017775|Ga0181432_1144840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium728Open in IMG/M
3300017775|Ga0181432_1177276All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium663Open in IMG/M
3300017775|Ga0181432_1235782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium576Open in IMG/M
3300017775|Ga0181432_1267566All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium540Open in IMG/M
3300017775|Ga0181432_1294782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300017776|Ga0181394_1043192All Organisms → Viruses → Predicted Viral1539Open in IMG/M
3300017776|Ga0181394_1109100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium879Open in IMG/M
3300017779|Ga0181395_1142973All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium755Open in IMG/M
3300017779|Ga0181395_1260467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium529Open in IMG/M
3300017781|Ga0181423_1077153All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1316Open in IMG/M
3300017782|Ga0181380_1022914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2316Open in IMG/M
3300017782|Ga0181380_1089516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1073Open in IMG/M
3300017783|Ga0181379_1192354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium716Open in IMG/M
3300017786|Ga0181424_10077526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1435Open in IMG/M
3300020165|Ga0206125_10006396All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9524Open in IMG/M
3300020165|Ga0206125_10017455All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4479Open in IMG/M
3300020165|Ga0206125_10024748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3453Open in IMG/M
3300020165|Ga0206125_10159616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium901Open in IMG/M
3300020175|Ga0206124_10041597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2071Open in IMG/M
3300020175|Ga0206124_10186699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium823Open in IMG/M
3300020175|Ga0206124_10411823All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300020335|Ga0211690_1100625All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium621Open in IMG/M
3300020347|Ga0211504_1090933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium692Open in IMG/M
3300020352|Ga0211505_1075619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium811Open in IMG/M
3300020379|Ga0211652_10002833All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5480Open in IMG/M
3300020382|Ga0211686_10264121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium707Open in IMG/M
3300020385|Ga0211677_10116530Not Available1155Open in IMG/M
3300020396|Ga0211687_10182416All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium856Open in IMG/M
3300020421|Ga0211653_10086528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1397Open in IMG/M
3300020438|Ga0211576_10440978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium662Open in IMG/M
3300020438|Ga0211576_10623238All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300020451|Ga0211473_10085592All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1603Open in IMG/M
3300020452|Ga0211545_10314213Not Available716Open in IMG/M
3300020468|Ga0211475_10560395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300020469|Ga0211577_10062112All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2681Open in IMG/M
3300020469|Ga0211577_10333032Not Available953Open in IMG/M
3300020470|Ga0211543_10041888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2447Open in IMG/M
3300020595|Ga0206126_10352913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium655Open in IMG/M
3300021957|Ga0222717_10234279All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1074Open in IMG/M
3300021959|Ga0222716_10129407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1671Open in IMG/M
3300022164|Ga0212022_1001204All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2691Open in IMG/M
3300022164|Ga0212022_1003783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1865Open in IMG/M
3300022164|Ga0212022_1005961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1600Open in IMG/M
3300022164|Ga0212022_1006319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1568Open in IMG/M
3300022164|Ga0212022_1068780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300022164|Ga0212022_1075117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium518Open in IMG/M
(restricted) 3300022920|Ga0233426_10064930All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1695Open in IMG/M
(restricted) 3300022920|Ga0233426_10222287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium764Open in IMG/M
(restricted) 3300022920|Ga0233426_10357740Not Available551Open in IMG/M
(restricted) 3300023109|Ga0233432_10129743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1359Open in IMG/M
(restricted) 3300024255|Ga0233438_10230298All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium744Open in IMG/M
3300024346|Ga0244775_10544945All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium945Open in IMG/M
3300024346|Ga0244775_10593659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium899Open in IMG/M
3300024348|Ga0244776_10150923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1692Open in IMG/M
3300025072|Ga0208920_1094347Not Available553Open in IMG/M
3300025086|Ga0208157_1016793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2292Open in IMG/M
3300025086|Ga0208157_1043052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1245Open in IMG/M
3300025086|Ga0208157_1081299All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium808Open in IMG/M
3300025099|Ga0208669_1079039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium709Open in IMG/M
3300025102|Ga0208666_1087305All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium791Open in IMG/M
3300025102|Ga0208666_1101364Not Available709Open in IMG/M
3300025103|Ga0208013_1162071All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300025120|Ga0209535_1003576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium9886Open in IMG/M
3300025120|Ga0209535_1035548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2294Open in IMG/M
3300025120|Ga0209535_1056967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1623Open in IMG/M
3300025120|Ga0209535_1160891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium691Open in IMG/M
3300025120|Ga0209535_1195348Not Available576Open in IMG/M
3300025132|Ga0209232_1147651Not Available753Open in IMG/M
3300025133|Ga0208299_1015651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3522Open in IMG/M
3300025137|Ga0209336_10036066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1625Open in IMG/M
3300025137|Ga0209336_10094997All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium851Open in IMG/M
3300025137|Ga0209336_10132334Not Available674Open in IMG/M
3300025137|Ga0209336_10139268All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium650Open in IMG/M
3300025138|Ga0209634_1008632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6290Open in IMG/M
3300025138|Ga0209634_1013707All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4751Open in IMG/M
3300025138|Ga0209634_1013888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4709Open in IMG/M
3300025138|Ga0209634_1014757All Organisms → cellular organisms → Bacteria4538Open in IMG/M
3300025138|Ga0209634_1059803All Organisms → Viruses → Predicted Viral1838Open in IMG/M
3300025138|Ga0209634_1063025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1775Open in IMG/M
3300025138|Ga0209634_1086137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1429Open in IMG/M
3300025138|Ga0209634_1091638All Organisms → Viruses → Predicted Viral1367Open in IMG/M
3300025138|Ga0209634_1094998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1333Open in IMG/M
3300025138|Ga0209634_1107286All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1221Open in IMG/M
3300025138|Ga0209634_1186573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium807Open in IMG/M
3300025138|Ga0209634_1325006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium517Open in IMG/M
3300025151|Ga0209645_1074120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1143Open in IMG/M
3300025168|Ga0209337_1004849All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes9254Open in IMG/M
3300025168|Ga0209337_1006596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7783Open in IMG/M
3300025168|Ga0209337_1008745All Organisms → cellular organisms → Bacteria6551Open in IMG/M
3300025168|Ga0209337_1009132All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6389Open in IMG/M
3300025168|Ga0209337_1012708All Organisms → cellular organisms → Bacteria5212Open in IMG/M
3300025168|Ga0209337_1013496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5027Open in IMG/M
3300025168|Ga0209337_1028246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3149Open in IMG/M
3300025168|Ga0209337_1030212All Organisms → cellular organisms → Bacteria3014Open in IMG/M
3300025168|Ga0209337_1032292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2887Open in IMG/M
3300025168|Ga0209337_1042339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2427Open in IMG/M
3300025168|Ga0209337_1048202All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2228Open in IMG/M
3300025168|Ga0209337_1065451All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300025168|Ga0209337_1074804All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1662Open in IMG/M
3300025168|Ga0209337_1093037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1426Open in IMG/M
3300025168|Ga0209337_1133438All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1101Open in IMG/M
3300025168|Ga0209337_1137076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1079Open in IMG/M
3300025168|Ga0209337_1137803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1075Open in IMG/M
3300025168|Ga0209337_1139245Not Available1067Open in IMG/M
3300025168|Ga0209337_1194536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium831Open in IMG/M
3300025168|Ga0209337_1215347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium767Open in IMG/M
3300025168|Ga0209337_1231846All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium722Open in IMG/M
3300025632|Ga0209194_1061342Not Available1041Open in IMG/M
3300025696|Ga0209532_1095306All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1033Open in IMG/M
3300025806|Ga0208545_1053424All Organisms → Viruses → Predicted Viral1187Open in IMG/M
3300025806|Ga0208545_1089935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium821Open in IMG/M
3300025873|Ga0209757_10096189All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium904Open in IMG/M
3300025890|Ga0209631_10160166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1201Open in IMG/M
3300025894|Ga0209335_10250889All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium779Open in IMG/M
3300025897|Ga0209425_10485584Not Available572Open in IMG/M
3300027077|Ga0208941_1050237All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium539Open in IMG/M
3300027234|Ga0208170_1027236All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1247Open in IMG/M
3300027522|Ga0209384_1002958All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium7551Open in IMG/M
3300027522|Ga0209384_1003040All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium7446Open in IMG/M
3300027522|Ga0209384_1016117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2482Open in IMG/M
3300027522|Ga0209384_1023643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1912Open in IMG/M
3300027522|Ga0209384_1057547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1025Open in IMG/M
3300027522|Ga0209384_1123086Not Available593Open in IMG/M
3300027685|Ga0209554_1232073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300027791|Ga0209830_10156764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1087Open in IMG/M
3300028123|Ga0256372_1002496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2139Open in IMG/M
3300031621|Ga0302114_10227956All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium767Open in IMG/M
3300031622|Ga0302126_10199110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium715Open in IMG/M
3300031622|Ga0302126_10280044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium568Open in IMG/M
3300031627|Ga0302118_10278274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium779Open in IMG/M
3300031675|Ga0302122_10061769All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1667Open in IMG/M
3300031675|Ga0302122_10211224All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium727Open in IMG/M
3300032277|Ga0316202_10356636All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium683Open in IMG/M
3300033742|Ga0314858_122352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium665Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater40.89%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine33.33%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.67%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.11%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.44%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.78%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.78%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.33%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.11%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.89%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.67%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.67%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.44%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.44%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.44%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean0.22%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.22%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.22%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.22%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.22%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000148Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100mEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017702Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaGEnvironmentalOpen in IMG/M
3300017703Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaGEnvironmentalOpen in IMG/M
3300017704Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaGEnvironmentalOpen in IMG/M
3300017705Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017718Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaGEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027077Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes)EnvironmentalOpen in IMG/M
3300027234Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027685Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300028123Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1001045753300000101MarineMEDSQKIATLLAERQNIEREIAKIQQLCHHPSTSLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK*
DelMOSum2010_1002271683300000101MarineMGKPLKVAILLEKRQKIEKEIEELQKSCPHPTKSVKFTRERLDSTVMVIRYVCDMCYLPVGYPNNKEQQDYLKQ*
DelMOSum2010_1003545363300000101MarineMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLNQ*
DelMOSum2011_1000657553300000115MarineMEDSQKIATLLAERQNIEREIAKIQQLCHHSSTSIKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK*
DelMOSum2011_1008972643300000115MarineMGMNKKIDNLHKEKLKIEKEIENLQKICKHPTKSLKNVRERLDSTTMVIRWTCNICSSVVGIPNNNELQEYLKQ*
DelMOSum2011_1018191923300000115MarineMGKSQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ*
DelMOSpr2010_10003466123300000116MarineMGKSQKIAKLLGERQKIEKKIEELQQSCQHPTKSIKNVRERLDSTTMVVRWTCNTCSSILGIPNNDELQNYLKQ*
DelMOSpr2010_1004872413300000116MarineMTPMKSFNKVEGLLSSRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTAMVTRYVCDECSLIIGIPNN
DelMOSpr2010_1006552853300000116MarineMGKSQKVATLLGERQKIEKEIEKIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ*
SI47jul10_100mDRAFT_100462623300000148MarineMGKTPKVAILLEKRQKIEKEIEELQKSCGHPSKSVKFTRERLDSTTMVIRYVCDMCYLPIGYPNNKEQQDYLKQ*
NpDRAFT_1012033713300000929Freshwater And MarineMGKSQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYVCGECSLIIGIPNNDELQNFLKQ*
NpDRAFT_1014792923300000929Freshwater And MarineMEDSQKIATLLAERQNIEREIAKIQQLCHHSSTSLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK*
BpDRAFT_1027895343300000930Freshwater And MarineMGKPQKVAILLGERQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDFLKQ*
BBAY93_1019686413300000973Macroalgal SurfaceMGKSQKVAALLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNFLKQ*
JGI24006J15134_1001076783300001450MarineMGQPQKVATLLGERQKIEKEIEILQKACYHPTKSIKYVRERLDSTAMVVRWTCDECCLIVGIPNNDKLQNFLKQ*
JGI24006J15134_10010816133300001450MarineMGNTQKIAKLLGERQKIEKEIEELQRSCQHTTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ*
JGI24006J15134_1001118193300001450MarineMGKPQKVANLLEKRQKIEKEIEELQRSCQHSTKSIKFIRERLDSTITVIRYVCNDCYLIVGIPDNNKLQNFLKQ*
JGI24006J15134_1001581013300001450MarineMGKTQKVATLLGERQKIEKEIEKIQKACQHPTKSIKNVRERLDSQTMVTRYVCDECSLIIGIPNNNELQNFLKQ*
JGI24006J15134_1001698523300001450MarineMGKTQKVATLLGERQKIEKKIEKIQKSCQHPTKSIKNVRERLDSTAIVTRYVCDECYLILGIPNNDELQIFLKQ*
JGI24006J15134_1001898263300001450MarineMIFKKPHNKVEGLLSTRKEIEKEIEEIQNSCQHSTKSIKYVRERLDSTIMVVRYVCDKCYLIIGIPNNDNLQNFLKK*
JGI24006J15134_1001937463300001450MarineMGKSKKMAVLFSERQKIEKEIKELQGSCNHPTKSIKNVRERLDSTTTVIRHVCDVCSSVVGIP*
JGI24006J15134_1001942293300001450MarineMTPKKSFNKVEGLLSTRRKIEKEIEEIQNNCKHSSKSIKQVQERLGTPTLVTRYVCDECSLIIGIPNNDELQNFLKQ*
JGI24006J15134_1002231113300001450MarineMGKPQKVATLLGERQKIEKEIEELQRSCQHSTRSVKFVRERLDSTTMVVRYVCDECLSIIGYPSKEETQNYLKQ*
JGI24006J15134_1002452113300001450MarineMGKSQKVATLLGERQKIEKEIENIQKSCQHPTKSIKNVRERLDSTIMVIRWTCDTCSSTLGIPNNNELQNYLKQ*
JGI24006J15134_1002567913300001450MarineFMGQPQKVATLLGERQKIEKEIEILQKACYHPTKSIKYVRERLDSTAMVVRWTCDECCLIVGIPNNDKLQNFLKQ*
JGI24006J15134_1004209333300001450MarineMTLKKPFNKVEGLLSTRKEIDKEIEGIQKLCQHPTKSIKNVRERLDSTSMVIRYVCDECSLTIGIPNNNELQKYLKQ*
JGI24006J15134_1004284523300001450MarineMGKSQKIAKLLGERQKIEKEIEELQRSCQHTTKSIKSVRERLDSTIMVVRWTCDTCSSTLGVPNNNELQNYLKQ*
JGI24006J15134_1005683463300001450MarineMGKPQKVATLLGERQKIEKKIEEIQKSCEHPTKSIKSVRERLDSTTIIIRYICDECCLIVGIPDNNKLQDFLKK*
JGI24006J15134_1006505223300001450MarineMILKKPFNKVEGLLSTRKEIDKEIEGIQKLCQHPTKSIKNVRERLDSTSMVIRYVCDECSLTIGIPNNNELQKYLKQ*
JGI24006J15134_1006914833300001450MarineMDNSQKIAALLGERQKIEKEIAKIQQLCQHLTKSIKCVRERLDSTTMVVRWTCDTCFSIVGIPNNEEINGFFRE*
JGI24006J15134_1007976253300001450MarineMGKPQKVAALLGERQKIEKEIEELQRSCEHPTKSIKSVRERLDTTTIVIRYVCDTCLLPIGYPNDKEQQNYLKK*
JGI24006J15134_1008598813300001450MarineMGRIPKVATLLGERQKIEKEIENLQKSCQHSTKSIKSVRERLDSTSMVIRYVCDECLLSIGYPNDEEQQNYLKQ*
JGI24006J15134_1009363633300001450MarineYFMGQPQKVATLLGERQKIEKEIEILQKACHHPTKSIKYVRERLDSTAMVVRYVCDGCYLIVGIPNNDNLQNFLKQ*
JGI24006J15134_1009402813300001450MarineVATLLGERQKIEKEIEEIQKLCQHSQKSIKSVRERLDSSTLVIRYVCDECYLIVGIPNNNKLQNFLKQ*
JGI24006J15134_1012784013300001450MarineMGKTQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTTVIRYVCDECSLIIGIPNNDELQNFLKQ*
JGI24006J15134_1012884543300001450MarineMGKSQKVATLLGERQKIEKEIEEIQKACQHSTKSIKNVRERLGSTSIVTRYVCDECSLIIGIPNNNELQNFLKQ*
JGI24006J15134_1013704113300001450MarineMGKSQKVATLLGERQKIEKEIEKIQKSCQHLTKSIRNVRERLDSQTTVVRYVCNECSLIIGIPNNDELQNFLKQ*
JGI24006J15134_1015482813300001450MarineMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSQITVVRYVCDECSLIIGIPNNDELQNYLKQ*
JGI24006J15134_1015675913300001450MarineMGRIPKVATLLGERQKIEKEIENLQKSCQHPAKSIKYVRERLDSTAMVIRYVCDECCLIVGIPNNDKLQNFLKQ*
JGI24006J15134_1020115613300001450MarineMGKTQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTSMVIRYVCGECLLPIGYPNNEEIQKYLKQ*
JGI24006J15134_1020909833300001450MarineMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLSIGYPNAKEIENFLNQ*
JGI24003J15210_1002323933300001460MarineMGKSKKMAVLFSERQKIEKEIKELQGSCNHPTKSIKNVRERLDSTTTVIRHVCDACSSVVGIPNNDELQNYLKQ*
JGI24004J15324_1003451263300001472MarinePKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ*
JGI24004J15324_1004705623300001472MarineMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ*
JGI24005J15628_1009897123300001589MarineMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPVGYPNIDDLENFLKQ*
JGI24005J15628_1013538513300001589MarineLLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPVGYPNIDDLENFLKQ*
Ga0065861_112450813300004448MarineMEDSQKIATLLAERQNIEREIAKIQQLCYHSSASLKFVRERLDSTIMVVRHTCDGCSSIVGIPNALDLENFLKK*
Ga0065861_113082333300004448MarineMGKSQKVAALFGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ*
Ga0066222_115407013300004460MarineMGKSQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNFLKQ*
Ga0066222_116031323300004460MarineMGKSQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSPTMVIRWTCDTCSSVVGIPNNNELQNYLKQ*
Ga0066222_121723423300004460MarineMEDSQKIATLLAERQNIEREIAKIQQLCHHSSASLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK*
Ga0066223_102240323300004461MarineMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSPTMVIRWTCDTCSSVVGIPNNNELQNYLKQ*
Ga0075443_1008847123300006165MarineMGETQKVATLLGEKQKIEKEIAKIQQLCDHTSNSVKSVRERLDSTSTVIRHVCDECSSIVGIPNNNDLQIFLKQ*
Ga0075446_10002161143300006190MarineMGKTQKVATLLGERQKIEKEIEKIQNSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNNELQNFLKQ*
Ga0075446_1000526433300006190MarineMGETQKVATLLGEKQKIEKEIAKIQQLCDHTSNSVKSVRERLDSTSTVIRHVCDECSSIVGIPNNNDLQNFLKQ*
Ga0075446_1002512233300006190MarineMGTIQNITTLLKEKQKIEKEIEKLQNLCQHPTKSIKYVRERLDSTIMVIRYVCDGCSLIIGIPNNDNLQNFLKQ*
Ga0075446_1004207663300006190MarineMGRIPKVVTLLGERQKIEKEIENLQKSCQHSTKTIKYVRERLDATTMVVRYVCDECCLIVGIPNNDKLQNFLKQ*
Ga0075446_1004537033300006190MarineMGKPQKVATLLEERQKIEREIEKLQKSCQHSQKSIKSIRERLDSTTMVIRYTCDECSSIVGIPNTNDLENFLKQ*
Ga0075446_1007082933300006190MarineMEDSQKIATLLRERQKIESKIAKLQKLCDHPSASVKSVRERLDSTTTVIRYVCDECFSIVGIPNNKDLQKFLRQ*
Ga0075446_1008450633300006190MarineMGNSQKVATLLGERQKIEREIAKIQQLCDHPSNSVKSVRERLDSTTTVIRHVCDECSSIVGIPNNNDLQIFLKQ*
Ga0070744_1016269923300006484EstuarineMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ*
Ga0070744_1021024113300006484EstuarineMGKSQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0098038_100886493300006735MarineMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNNELQNFLKQ*
Ga0098038_102452633300006735MarineMGKPQKIAKLLGEKQKIEQEIEELQRSCKHLTKSIKNVRERLDSTTTVVRWTCDICSSIIGIPNNDELQDYLKQ*
Ga0098038_104157943300006735MarineMGKSQKIAKLLGEKQKIEKKIEELQRSCKHPAKSIRGVREHLDSTEVVIRWTCDVCFSIVGIPNKDELTNYLKQ*
Ga0098038_104349913300006735MarineLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0098038_104818013300006735MarineMGNAQKIAKLLGERQKIEKEIEELQKSCQHLTKSVKSVRERLDSTEISVRWVCDTCSSIVGIPNNDELTNYLKQ*
Ga0098038_126604413300006735MarineMTPKKPFNKVEGLFSVRREIDKEIEEIQKVCQHPTKSIRNVRERLDSTAMVTRYVCNECSLIIGIPNNDELQNFLKQ*
Ga0098038_127286113300006735MarineMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECLMVLGYPNQQDIKNFFKE*
Ga0098037_102929013300006737MarineQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNNELQNFLKQ*
Ga0098037_111610113300006737MarineQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0098058_103857023300006750MarineMGKPQKVATLLEERQKIEREIEKLQKSCGHPSKSIKSVRERLDSTTMVIRYVCDECLLSIGYPSEKEIQNYLKQ*
Ga0098048_104795543300006752MarineMGKSQKVTTLLGERQKIEKEIERLQTLCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNNELQNFLKQ*
Ga0098044_114200323300006754MarineMGIFKRITDLFAKKQEIEKEIWGLQKSCPHPTKSVKFTRERLDSTVMVIRYVCDECLLSIGYPSEKEIQNYLKK*
Ga0098044_126998823300006754MarineMGKPQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNIRERLDSQTMVVRWTCDTCFSIVGIPNDDELRNYLKK*
Ga0098054_130276923300006789MarineMGKTQKVATLLEKRQKIEKEIEELQRSCQHPTKSVKFTRERLDSTVMVIRYVCDECLLSIGYPSEKEIQNYLKK*
Ga0098054_134191313300006789MarineMGKPQKVAALLGERQKIEKEIEKIQKSCEHSTKSIKFVRERLDSTAMVIRYVCDTCLLPIGYPNEKEIQNYLKK*
Ga0098055_136529623300006793MarineMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLSIGYPNIKEIEDFLKQ*
Ga0075467_1070342413300006803AqueousMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTSMVVRYVCDECSLIIGIPNNDELQNYLKQ*
Ga0098060_103107743300006921MarineMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGIPNNNELQNYLKQ*
Ga0098060_120645113300006921MarineMGKTQKVATLLEKRQKIEKEIEELQRSCQHPTKSIKNVRERLDSTEISVRWVCDTCSSIVGIPNNDELTNYLKQ*
Ga0098050_102438953300006925MarineMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLSIGYPSEKEIQNYLKK*
Ga0075468_1002765933300007229AqueousMTPMKSFNKVEGLLSSRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTAMVTRYVCDDCCLIVGIPNNDDLENFLKK*
Ga0075468_1011878713300007229AqueousQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ*
Ga0075469_1001960143300007231AqueousMTPMKSFNKVEGLLSSRRKIEKEIEEIQKLCQHSTKSIKNVRERLDSTAMVTRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0075469_1006206453300007231AqueousMGMNKKIDNLHKEKLKIEKEIEILQKICKHPTKSLKNVRERLDSTTMVIRWTCNICSSVVGIPNNNELQEYLKQ*
Ga0075469_1017152923300007231AqueousMGKTQKVATLLGERQKIEKEIEKIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ*
Ga0102817_112485213300007555EstuarineMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0102822_106468813300007558EstuarineMGKTQKVATLLGERQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLNQ*
Ga0102908_112931833300007665EstuarineERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRWTCDTCFFIVGIPNNNELQNYLKQ*
Ga0102823_116244933300007692EstuarineMGKTQKVATLLGERQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK*
Ga0102907_1002612113300007962EstuarineMGKPQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDECLLPIGYPNIKEIEDFLKQ*
Ga0098052_101704313300008050MarineMEMNKKIDNLHKERLKIEKEIENLQKTCKHPTKSLKNVRERLDSTTMVIRWTCNICSSVVGIPNNNELQEYLKQ*
Ga0098052_134230513300008050MarineMGKASKVVALLEKRQKIEKEIEELQKSCGHPSKSVKFTRERLDSTIMVIRYVCDMCYLPIGYPNDKEQQDFLKQ*
Ga0098052_137207213300008050MarineMGIFKRITDLFAKKQKIEKEIWGLQKSCPHPTKSVKFTRERLDSTVMVIRYVCDECLLSIGYPSEKEIQNYLKK*
Ga0102887_118392413300008961EstuarineMENSQKIATLLAERQNIEREIAKIQQLCHHSSTSLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK*
Ga0102816_120582613300008999EstuarineMGKSQKVATLLGERQKIEKEIEKIQELCQHPTKSIKNVRERLDSQIMVIRYVCDNCCLIEGIPNNDNLENFLKQ*
Ga0102911_107038013300009049EstuarineTLLAERQNIEREIAKIQQLCHHSSTSLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK*
Ga0102826_115956023300009054EstuarineMENSQKIATLLAERQNIEREIAKIQQLCHHSSTSIKFVRERLDSTMMVVRHTCDECSSLVGIPNTNDLENFLKK*
Ga0115566_1048838033300009071Pelagic MarineMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTTVVRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0115549_111031033300009074Pelagic MarineMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0115552_109402333300009077Pelagic MarineMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTTVVRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0115551_137309423300009193Pelagic MarineMTLKKSFNKVEGLLSTRKEIEKEIEKIQKTCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0115548_105317743300009423Pelagic MarineMTLKKSFNKVEGLLSTRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTAMVTRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0114915_107865013300009428Deep OceanMGKSQKIAKLLGERQKIEKEIEELQRSCQHTTKSIKSVRERLDSTIMVVRWTCDTCSSTLGVPSNNELQNYLKQ*
Ga0115545_104768433300009433Pelagic MarineMTLKKPFNKVEGLLSTRKEIEKEIEKIQKTCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0115558_138181223300009449Pelagic MarineMTLKKPFNKVEGLLSTRKEIDKEIEELQKSCQHPTKSIKNVRERLDSTTMVVRWTCDTCSLIIGIPNNNELQNYLNQ*
Ga0115001_1023867433300009785MarineMGKTPKIATLLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ*
Ga0115001_1055809123300009785MarineMKKVAKLLEERQKIDKKIEDIQKECPHFNVSIKFVRERLDSTMMVVRHTCGECSSIVGIPNTNDLENFLKK*
Ga0098043_112173923300010148MarineMGKSQKIAKLLGEKQKIEKKIEELQRSCKHPAKSIRGVREHLDSTEVVIRWTCDVCFSIVGIQNNDELTNYLKQ*
Ga0098043_119195113300010148MarineMGKSQKIAKLLGEKQKIEKEIEKLQRSCQHPIKSIKNVRERLDSQTMVIRYVCDTCSSIIGIPNSNELKNYLKQ*
Ga0098049_115348213300010149MarineMTLKKPFNKVEGLLSTRKEIEKEIEEIQKSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNNELQNFLKQ*
Ga0098056_130729723300010150MarineMGKTQKVATLLEKRQKIEELQRSCQHPTKSVKFTRERLDSTVMVIRYVCDECLLSIGYPSEKEIQNYLKK*
Ga0098061_114221423300010151MarineMGKAQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLSIGYPNIKEIEDFLKQ*
Ga0098059_102226243300010153MarineMTLKKPFNKVEGLLSTRKEIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDKCSLIIGIPNNDELQNFLKQ*
Ga0098059_112518423300010153MarineMGKIPKVATLLEKRQKIEKEIEKLQKSCEHPTKSVKFVRERLDSTTVVIRYVCDECLLLIGYPSKEETHNYLKQ*
Ga0098059_123119113300010153MarineMGKSQKVATLLGEKQKIEKEIEEIQKSCQHSNKSIKSVRERVDSTTLIIRYVCDECSKIIGYPSNEEIKNFFKE*
Ga0098059_127326523300010153MarineMGKTQKVATLLEKRQKIEKEIEELQRSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ*
Ga0098059_135198923300010153MarineMGKPQKVAALLGERQKIEKEIEKIQKSCEHSTKSVKFVRERLDSTAMVIRYVCDTCLLPIGYPNEKEIQNYLKK*
Ga0151669_10195263300011128MarineMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNDELQNYLKQ*
Ga0151671_100616023300011253MarineMTPMKSFNKVEGLLSSRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTTMVTRYVCDKCLLPIGYPNKKEIKNFLKQ*
Ga0151677_101532233300011258MarineMGKSQKVATLLGERKKIEKEIEKIQNSCQHLTKSIKNVRERLDSQIMVIRYVCDDCYLIVGIPNNDKLQNFLKQ*
Ga0163179_1216203713300012953SeawaterYFMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSHTMVTRYVCDECSLIIGIPNNDELQNYLKQ*
Ga0163111_1066134213300012954Surface SeawaterMGKSQKIAKLLGERQKIEKEIEELQRSCKHPTKSIKNVRERLDSTTMVIRWTCNICFSVVGIPNNDELQNFLKQ*
Ga0181374_102288623300017702MarineMGIFKRITDLFAKKQEIEKEIWGLQKSCPHPTKSVKFTRERLDSTVMVIRYVCDECLLSIGYPSEKEIQNYLKK
Ga0181374_104190613300017702MarineMGKSQKVATLLGEKQKIEKEIEEIQKSCQHSNKSIKSVRERVDSTTLIIRYVCDECSKIIGYPSNEEIKNFYKE
Ga0181367_100651353300017703MarineMGKSQKVATLLGEKQKIEKEIEEIQKSCQHSNKSIKSVRERVDSTTLIIRYVCDECSKIIGYPSNEEIKIFLKNK
Ga0181367_106988413300017703MarineMGIFKRITDLFAKKQEIEKEIWGLQKSCPHPTKSVKFTRERLGSTVMVIRYVCDECLLSIGYPSEKEIQNYLKK
Ga0181371_100343033300017704MarineMGKSQKVATLLGEKQKIEKEIEEIQKSCQHSNKSIKSVRERVDSTTLIIRYVCDECSKIIGYPSNEEIKNFFKE
Ga0181371_104056123300017704MarineMGKPQKVATLLGERQKIEKEIEKLQKLCKHPTKSIKSVRKRLDSQTMVIRYVCDDCYLIVGIPNNNELQNFLKQ
Ga0181371_104779513300017704MarineMGKPQKVAALLGERQKIEKEIEKIQKSCEHSTKSVKFVRERLDSTAMVIRYVCDTCLLPIGYPNEKEIQNYLKK
Ga0181372_100137073300017705MarineMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLSIGYPNIKEIEDFLKQ
Ga0181372_100805343300017705MarineMTLKKPFNKVEGLLSTRKEIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDKCSLIIGIPNNDELQNFLKQ
Ga0181372_100909723300017705MarineMGKIPKVATLLEKRQKIEKEIEELQRSCQHPTKSIKNVRERLDSTTMVIRYVCNECLLIIGYPTEKEIQNYLKK
Ga0181372_101901813300017705MarineMGKPQKVATLLGERQKIEKEIERLQTLCQHPKKTIKSVRERLDSTTTVIRYVCDECYLIVGIPNNDKLQNFLKK
Ga0181372_107079313300017705MarineLGERQKIEKEIEEIQRSCKHPTKSIKNVRERLDSQTMVVRWTCDTCFSIVGIPSDNELQNYLKQ
Ga0181377_100661193300017706MarineMGKSQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSQTMVTRYVCDECSLIIGIPNNNELQNFLKQ
Ga0181377_100711613300017706MarineMGKTQKVATLLGERQKIEKEIEEIQKSCQHPTKSIRNVRERLDSTIIVIRYVCDTCLLPIGYPDIKEIKNFLKNDIRQTVDSKNIFT
Ga0181377_102276133300017706MarineMGKPQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181377_102531653300017706MarineMGKSQKIAKLLGERQKIEKKIEELQRSCQHPTKSIKSVRERLDSTIMVVRWTCDTCSSILGIPNNDELQNYLKQ
Ga0181377_102640253300017706MarineMGKSQKIAKLLGEKQKIEKEIEKLQRSCQHPIKSIKNVRERLDSQTMVIRYVCDTCSSIIGIPNSNELKNYLKQ
Ga0181377_104484133300017706MarineMGKTQKVAILLGERQKIEKEIEELQKSCKHTTKSIKSVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDFLKQ
Ga0181369_111462623300017708MarineMGKTQKVATLLEKRQKIEKEIEELQRSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181387_101215813300017709SeawaterYFMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181387_101846263300017709SeawaterMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0181387_102775423300017709SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNNELQNFLKQ
Ga0181387_107429513300017709SeawaterMGKSQKIAKLLGERQKIEKKIEELQKSCKHTTKSVKSVRERLDSTTMVVRWTCNTCSSILGIPNNDELTNYLKQ
Ga0181403_100253853300017710SeawaterMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181403_102390813300017710SeawaterMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181403_104538813300017710SeawaterVCVKASKLTYIFLFMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0181403_110583323300017710SeawaterMGKSQKVATLLGERQKIEKEIEKIQESCQHPTKSIKNVRERLDSTAIVTRYVCDECSLIIDIPNNDELQNFLKQ
Ga0181391_100547983300017713SeawaterMGKSQKIAALFKERQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGIPNNNELQNYLKQ
Ga0181391_100785213300017713SeawaterMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTAMVIRWTCDICSSVVGIPNNNELQNYLKQ
Ga0181391_101792963300017713SeawaterMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181391_103024353300017713SeawaterMGKTQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQIMVIRYVCNECYLIIGIPNNDDLQNFLKQ
Ga0181391_103417553300017713SeawaterMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181391_105277923300017713SeawaterMGKTQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPN
Ga0181391_107088333300017713SeawaterMGKSQKVATLLGERQKIEKEIEKIQKSCQHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGILNNNELQNYLKQ
Ga0181412_103559723300017714SeawaterMKMNKKIDNLHKERPKIEKEIENLQKTCKHPTKSLKNVRERLDSTTMVIRWTCNTCSSVVGIPNNNELQEYLKQ
Ga0181404_100899913300017717SeawaterTPKKSFNKVEGLLSTRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTAMVTRYVCDECSSIIGIPNNDELQNFLKQ
Ga0181404_101051543300017717SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNNELQNFIKQ
Ga0181404_110089613300017717SeawaterMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPDIKEIKNFLGLKLKLIKNNPIIINNKR
Ga0181375_107890113300017718MarineRKEIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDKCSLIIGIPNNDELQNFLK
Ga0181390_100441343300017719SeawaterMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGIPSNNELQNYLKQ
Ga0181390_103248123300017719SeawaterMGKTQKVATLLGERQKIEKEIEKIQKSCQHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGILNNNELQNYLKQ
Ga0181390_103601023300017719SeawaterMGKSQKVATLLEKRQKIEKEIEELQRSCQHPTKSVKFTRERLDSTVMVIRYVCDECLLSIGYPSEKEIQNYLKK
Ga0181390_105988723300017719SeawaterMGKTQKVAILLGEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0181390_106353723300017719SeawaterMGKSQKVATLLGERQKIEKEIEKIQKACQHPTKSIKNVRERLDSTTTVVRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181390_109299833300017719SeawaterQKIEEEIEEIHKSCQHPTKSIKNVRERLDSTSMVTRYVCDECFLIIGIPNNDELQNFLKQ
Ga0181383_103183513300017720SeawaterMGKTQKVATLLGERQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLSIGYPNIKEIEDFLKQ
Ga0181383_104024013300017720SeawaterMGKSQKIAKLLGERQKIEKKIEELQQSCQHPTKSIKSVRERLDSTTMVVRWTCNTCSSILGIPNNDELTNYLKQ
Ga0181383_116786323300017720SeawaterLFMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0181373_103154813300017721MarineLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTAMVIRWTCDICSSVVGIPNNNELQNYLKQ
Ga0181373_106809913300017721MarineMGKSQKIAKLLGEKQKIEKKIEELQRSCKHLTKSIKNVRERLDSTTTVVRWTCDICSSIIGIPNNDELQDYLKQ
Ga0181388_101681853300017724SeawaterMGKSQKIAALFKERQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGIPSNNELQNYLKQ
Ga0181388_102881713300017724SeawaterQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDFLKQ
Ga0181398_100917083300017725SeawaterMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECFLIIGIPNNDELQNFLKQ
Ga0181398_102808533300017725SeawaterMGKSQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSQTMVTRYVCNECSLIIGIPNNDELQNFLKQ
Ga0181398_104366833300017725SeawaterMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGILNNNELQNYLKQ
Ga0181398_116440023300017725SeawaterMGKTQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ
Ga0181381_102458253300017726SeawaterFMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181381_108935913300017726SeawaterMGKSQKIAKLLGERQKIEKEIEELQRSCQHTTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0181381_110923213300017726SeawaterMGKSQKVATLLGERQKIEKEIEELQRLCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181401_106130913300017727SeawaterMGKTQKVATLLGERQKIEKEIERLQTSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181401_107186123300017727SeawaterMGKTPKVAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0181419_116214313300017728SeawaterTLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTAMVIRWTCDICSSVVGIPNNNELQNYLKQ
Ga0181396_101112933300017729SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCQHSTKSIKNVRERLDSQTMVIRWTCDTCFSIVGIPNDNELQNYLKK
Ga0181396_104991433300017729SeawaterMGKSQKVATLLGERQKIEKEIEDIQKSCQHLTKSIKNVRERLDSTEISVRWVCDTCSSVVGILNNNELQNYLKQ
Ga0181417_100301413300017730SeawaterQKVATLLGERQKIEKEIEDIQKSCQHLTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181417_103377713300017730SeawaterMGKPQKVAALLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181417_109520623300017730SeawaterMGKPQKVATLLGERQKIEKEIERLQTLCQHPKKTIKSVRERLDSTTTVIRYVCDECLLPIGYPNNEEIQKYLKQ
Ga0181416_102951523300017731SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCQHLTKSIKNVRERLDSQTMVIRWTCDTCFSIVGIPNDNELQNYLKK
Ga0181416_103242443300017731SeawaterMGKSQKVAALLGERQKIEKEIEKLQKSCQHPTKSIKNVRERLDSTTMVIRWTCDTCSLIVGIPNNNELQNYLKQ
Ga0181416_104780523300017731SeawaterMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGIPNNNELQNYL
Ga0181416_110959313300017731SeawaterMGKTQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGI
Ga0181415_100413063300017732SeawaterMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMVTRYVCDECLLIIGIPNNDELQNFLKQ
Ga0181426_105740613300017733SeawaterMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTIVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0187222_101231263300017734SeawaterFLYFMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181431_105877513300017735SeawaterMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLSIGYPNIKE
Ga0181431_115560313300017735SeawaterQKVATLLGERQKIEKEIEKIQKACQHPTKSIKNVRERLDSTTTVVRYVCDECSLIIGIPNNDELQNYLKQ
Ga0187218_101113963300017737SeawaterSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0187218_104802343300017737SeawaterFMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0187218_112937633300017737SeawaterSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTAMVIRWTCDICSSVVGIPNNNELQNYLKQ
Ga0181428_103730713300017738SeawaterMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSLIVGIPNNNELQNYLKQ
Ga0181428_104588423300017738SeawaterMANTKKVASLIEEKRKITKEIEEIQRSCKHPTKSIKNVRERLDSQTMVVRWTCDTCFSIVGIPSDNELQNYLKQ
Ga0181433_100937213300017739SeawaterATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTAMVIRWTCDICSSVVGIPNNNELQNYLKQ
Ga0181433_104148013300017739SeawaterQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181433_107591543300017739SeawaterMGKTQKVATLLGERQKIEKEIEKIQKSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181433_109344523300017739SeawaterMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLNQ
Ga0181433_115231513300017739SeawaterSQKVATLLGERQKIEKEIEDIQKSCQHSTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181418_101589543300017740SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTTVVRYVCNECSLIIGIPNNDELQNFLKQ
Ga0181418_103080953300017740SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSQTMVTRYVCNECSLIIGIPNNDELQNFLKQ
Ga0181418_112247513300017740SeawaterGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLNQ
Ga0181421_102390233300017741SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181421_108370523300017741SeawaterMGKSQKIAKLLGERQKIEKKIEELQKSCKHTTKSIKSVRERLDSTIMVVRWTCDTCSSTLGVPSNNELQNYLKQ
Ga0181421_108497113300017741SeawaterMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLSIGYPNIKEIEDFLKQ
Ga0181399_102168913300017742SeawaterMGKSQKVATLLEKRQKIEKEIGELQRSCQHPTKSVRFVKERLDSTTMVIRYVCDECLLPIGYPNNEEIQKYLKQ
Ga0181399_104355633300017742SeawaterMGKSQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181399_109554213300017742SeawaterMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTAIVTRYVCNECSLIIGIPNNDEL
Ga0181399_111625613300017742SeawaterKKSFNKVEGLLSTRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTAMVTRYVCDECSSIIGIPNNDELQNFLKQ
Ga0181399_115435113300017742SeawaterVCVKASKLTYIFLFMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNY
Ga0181402_102373233300017743SeawaterMTLKKPFNKVEGLLSTRKEIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMVTRYVCDECSLIIGIPNNDELQNFL
Ga0181402_107702623300017743SeawaterMGKSQKIAKLLGERQKIEKKIEELQKSCKHTTKSVKSVRERLDSTEISVRWVCDTCSSIVGIPNNDEL
Ga0181397_102871323300017744SeawaterMGKPQKIAFLLGEKQKIEKEIEELQRSCQHPTKSIKNVRERLDSTTMVIRYVCNECLLIIGYPTEKEIQNYLKK
Ga0181397_108828313300017744SeawaterMGKPQKVATLLGERQKIEKEIEEIQRSCKHPTKSIKNVRERLDSQTMVVRWTCDTCFSIVGIPSDNELQNYLKQ
Ga0181389_101596373300017746SeawaterMGKSQKVATLLGVRQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCNECSLIIGIPNNDELQNFLKQ
Ga0181389_101887073300017746SeawaterMGKSQKVATLLGVRQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181389_102264553300017746SeawaterMGKPQKVATLLGERQKIEKEIERLQTLCQHPKKTIKSVRERLDSTTTVIRYVCDECYLIVGIPNNDKLQNFLKQ
Ga0181389_103912063300017746SeawaterFMGKTQKVATLLGERQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDFLKQ
Ga0181389_113378633300017746SeawaterMGRPQKVAALLGKRQKIEKEIEKLQKSCQHPTKSVRFVKERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLN
Ga0181389_115626423300017746SeawaterMGKSQKIAKLLGERQKIEKKIEELQKSCKHTTKSIKSVRERLDSTTMVVRWTCNTCSSILGIPNNDELQNYLKQ
Ga0181393_101171623300017748SeawaterMTPMKSFNKVEGLLSSRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTAMVTRYVCDECSSIIGIPNNDELQNFLKQ
Ga0181393_101454673300017748SeawaterGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCNECSLIIGIPNNDELQNFLKQ
Ga0181393_104268913300017748SeawaterQKVATLLEKRQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ
Ga0181405_101368163300017750SeawaterTLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181405_102125813300017750SeawaterMGNAQKIAKLLGERQKIEKKIEELQKSCKHTTKSIKSVRERLDSTTMVVRWTCNTCSSILGIPNNDELTNYLKQ
Ga0181405_105019613300017750SeawaterQKIEKEIEELQRSCQHPTKSIKNVRERLDSQTMVTRYVCNECSLIIGIPNNDELQNFLKQ
Ga0181405_107543733300017750SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCEHRTKSIKSVRERLDSTAMVIRYVCDECLLSIGYPSEKEIQ
Ga0187219_101250773300017751SeawaterMGNAQKIAKLLGERQKIEKEIEELQKSCQHLTKSVKSVRERLDSTEISVRWVCDTCSSIVGIPNNDELTNYLK
Ga0187219_102616713300017751SeawaterLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0187219_106476113300017751SeawaterQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0187219_111505343300017751SeawaterLYFMGKTQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQIMVIRYVCNECYLIIGIPNNDDLQNFLKQ
Ga0187219_113868313300017751SeawaterMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNTKEIENFLNQ
Ga0181400_119444513300017752SeawaterMGKTQKVATLLGERQKIEKEIEELQRSCQHLTKSIKNVRERLDSQTMVIRWTCDTCFSIVGIPNDNELQNYLKK
Ga0181407_101707313300017753SeawaterPQKVATLLGERQKIEKEIERLQTLCQHPKKTIKSVRERLDSTTTVIRYVCDECCLIVGIPNNDKLQNFLKQ
Ga0181407_103002653300017753SeawaterFMGKSQKVAALLGERQKIEKEIEELQRSCEHPTKSVKFTRERLDSTAMVIRYVCDTCLLSIGYPSKKEIQNYLKK
Ga0181407_103923423300017753SeawaterMGKTQKIAKLFEKRQKIEKEIEELQRSCQHPTKSIKNVRERLDSTVMVIRYVCDTCSKIVGYPNNKDIENYLKQ
Ga0181411_107816643300017755SeawaterMGKPQKVATLLGERQKIEKKIEELQKSCKHTTKSVKSVRERLDSTTMVVRWTCNTCSSILGIPNNDELTNYLKQ
Ga0181382_102591213300017756SeawaterMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLPIGYPNTKEIENFLNQ
Ga0181420_100401773300017757SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCEHRTKSIKSVRERLDSTAMVIRYVCDECLLSIGYPSEKEIQKYLKK
Ga0181420_1004596113300017757SeawaterMGKSQKVATLLGERQKIEKEIYKLQKSCQHSTKSIKNIRERLDSTTMVIRYVCDECYLIVGIPNNGDLQKFLKQ
Ga0181420_105611613300017757SeawaterMGKPQKVATLLGERQKIEKEIEKLQKSCEHPTKSVKFVRERLDSTTVVIRYVCDGCLLLIGYPSKEETHNYLKQ
Ga0181420_107525423300017757SeawaterMGRPQKVAALLGKRQKIEKEIEKLQKSCQHPTKSVRFVKERLDSTTMVIRYVCDECLLPIGYPNNEEIQKYLKQ
Ga0181420_123683613300017757SeawaterMGKPQKVVTLLRERQKIEKEIENIQKSCEHPTKSLKSVRERLDSTTIFIRYVCDECLSIIRYPNKEETQNY
Ga0181409_102869313300017758SeawaterKIAKLLGERQKIEKKIEELQKSCKHTTKSIKSVRERLDSTTMVVRWTCNTCSSILGIPNNDELQNYLKQ
Ga0181409_104294313300017758SeawaterMGKTQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181409_123467523300017758SeawaterMGKSQKVANLLGERQKIEKEIKDLQRSCKHPTKSIKFTRERLDSTTMVVRWICNECLLPIGYPSKKEIQNFLNNKYEG
Ga0181414_106791643300017759SeawaterQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181414_112642713300017759SeawaterMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIKNVRERLDSTTIVIRYVCDTCLLSIGYPNIKEIEDFLKQ
Ga0181414_113208723300017759SeawaterMGKSQKIAKLLGERQKIEKKIEELQQSCQHPTKSIKSVRERLDSTTMVVRWTCNTCSSILGIPNNDEL
Ga0181414_117850113300017759SeawaterMGKSQKVATLLGERQKIEKEIEDIQKSCQHLTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDE
Ga0181408_100402383300017760SeawaterMGKSQKVATLLEKRQKIEKEIEELQRSCQHPTKSVKFTRERLDSTIMVIRYVCDECLLSIGYPSEKEIQNYLKK
Ga0181408_108438713300017760SeawaterMGKSQKVATLLGERQKIEKEIEDIQKSCQHLTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181408_110099613300017760SeawaterMGKTQKVATLLGERQKIEKEIENIQKSCQHSTKSIKNVRERLDSQTTVVRYVCDECFLIIGIPNNDELQNFLKQ
Ga0181408_111102033300017760SeawaterYFMGKPQKVATLLGERQKIEKEIEELQRSCEHRTKSIKSVRERLDSTAMVIRYVCDECLLSIGYPSEKEIQKYLKK
Ga0181422_101339713300017762SeawaterMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCNECSLIIGIPNNDELQNFLKQ
Ga0181422_125970523300017762SeawaterMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGI
Ga0181410_101300713300017763SeawaterLGERQKIEKEIENIQKSCQHSTKSIKNVRERLDSQTMVTRYVCDTCSLIIGIPNNDELQNFLKQ
Ga0181410_110864733300017763SeawaterMGKTQKVATLLGERQKIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDFLKQ
Ga0181410_115841013300017763SeawaterMGKSQKIAKLLGERQKIEKKIEELQKSCKHTTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0181385_100449473300017764SeawaterMGKSQKVATLLGERQKIEKEIEEIQKSCQHPTKSIRNVRERLDSQTTVIRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181385_102283243300017764SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLRIGIPNNNELQNFLKQ
Ga0181413_101931053300017765SeawaterMGKSQKIAALFKERQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSLIVGIPNNNELQNYLKQ
Ga0181413_102776333300017765SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKHVRERLDSQTTVVRYVCDECSLIIGIPNNDELQN
Ga0181413_106799613300017765SeawaterMKMNKKIDNLHKERLKIEKEIENLQKTCKHPTKSLKNVRERLDSTTMVIRWTCNTCSSVVGIPNNNGLQEYLKQ
Ga0181413_111947213300017765SeawaterMGKSQKIAKLLGERQKIEKKIEELQQSCQHPTKSIKSVRERLDSTTMVVRWICNECLLPIGYPSKKEIQNFLNNKYEG
Ga0181413_115428623300017765SeawaterMGKTQKVATLLGERQKIEKEIENIQKSCQHSTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPN
Ga0181406_101381163300017767SeawaterMGKTQKIAKLFEKRQKIEKEIEELQRSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181406_115518033300017767SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSQTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0187220_100740373300017768SeawaterMGNAQKIAKLLGERQKIEKEIEELQKSCQHLTKSVKSVRERLDSTEISVRWVCDTCSSIVGIPNNDEITNYLKQ
Ga0187220_101523613300017768SeawaterVDLYFLFMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ
Ga0187220_102824633300017768SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIRNVRERLDSQTTVIRYVCDECSLIIGIPNNDELQNFLKQ
Ga0187220_103685813300017768SeawaterVDLYFLFMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0187220_105882053300017768SeawaterQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0187217_103016213300017770SeawaterMTLKKSFNKVEGLLSTRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSQTTVVRYVCDECFLIIGI
Ga0187217_106647553300017770SeawaterMGKPQKVANLLEKRQKIEKEIEELQRSCQHSTKSIKNVRERLDSQTTVVRWTCDTCFSIVGIPNNNELQNYLKQ
Ga0187217_107434523300017770SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0187217_120608623300017770SeawaterMGKSQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTTMVTRWTCDTCFSIVGIPNNNELQNFLKQ
Ga0181425_104038733300017771SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCQHLTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181425_104913923300017771SeawaterMGKSRKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTIVTRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181425_116593513300017771SeawaterTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNNELQNFLKQ
Ga0181425_117166523300017771SeawaterMKMNKKIDNLHKERLKIEKEIENLQKTCKHPTKSLKNVRERLDSTTKVVRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181430_101762253300017772SeawaterMGKPQKVATLLGERQKIEKEIERLQTSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181430_105230253300017772SeawaterMGTSQKVAKLIEKRQKIEKEIEELQRSCQHPTKSVKFTRERLDSTIMVIRYVCDECLLSIGYPSEKEIQNYLKK
Ga0181430_118374813300017772SeawaterMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGIP
Ga0181430_121353623300017772SeawaterVCVKASKLTYIFLFMGKTPKIAILLMEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSITMVIRYVCDTCLLPIGYPNAKEIENFLNQ
Ga0181386_102784613300017773SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSQIMVIRYVCDECSLIIGIPNNNELQKY
Ga0181432_100452033300017775SeawaterMGKIPKVAALFEERQKIEKEIGDLQRSCPHPTKSVKFTRERLDSTTMVIRYVCDACLLSIGYPSEKEIQNYLKK
Ga0181432_100780913300017775SeawaterVEGLLSTRKEIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181432_101157563300017775SeawaterMGKSQKVAKLFEKRQKIEKEIEKLQGSCEHSTKSVKFTRERWDTTTMVIRYVCDTCLLSIGYPSEKEIQNYLKK
Ga0181432_101184513300017775SeawaterMGKPQKVATLLGERQKIEKEIEELQRSCEHRTKSIKSVRERLDSTAMVIRYVCDECLLSIGYPSEKEITKYLKK
Ga0181432_101462563300017775SeawaterMGKPQKIAKLFEKRQKIEKEIEELQRSCKHSTKSIKYVRERLDSTTMVVRYICDECFSVVGIPNDNELQNYLKQ
Ga0181432_102065533300017775SeawaterMGKPQKVATLLGERQKIEKEIEKLQKSCKHPTKSIKSVRKRLDSQTMVIRYVCDDCYLIVGIPNNNELQNFLKQ
Ga0181432_102105353300017775SeawaterMGKTPKVATLLEERQKIEKEIEKLKKSCQHPTKSIKFVRERLDSTTMVIRYVCDKCLLPIGYPNKKETQNYLKQ
Ga0181432_102248223300017775SeawaterMGKSQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYVCGECSLIIGIPNNDELQNFLKQ
Ga0181432_102619833300017775SeawaterMGKTQKVATLLGERQKIEKEIEKIQNLCNHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGILNNNELQNYLKQ
Ga0181432_102669243300017775SeawaterMGKPQKVATLLGERQKIEKEIEEIQKLCQHSTKSIKYVRERLDSTTMVVRWTCDTCFLIVGIPNNDKLQNFLKQ
Ga0181432_102853333300017775SeawaterMGKSQKVANLLEKRQKIEKEIRDLQRSCQHLTKSIKSVRERLDSQTMVIKYVCDECLLPIGYPNDKEIQNYLNQ
Ga0181432_105503033300017775SeawaterMGKIPKVATLLEERQKIEKEIEKLQKLCQHPQKSIKSVRERLDSPTMSIRYICDECYLIVGIPNNDNIQKFLKQ
Ga0181432_106735723300017775SeawaterMGRSQKVATLLGERQKIEKEIEELQRSCQHSIKSIKNVRERLDSQTMVIRWTCDTCFSIVGIPSDNELQNYLRK
Ga0181432_107071533300017775SeawaterMGKASKVVALLEKRQKIEKEIEELQKSCGHPSKSVKFTRERLDSTVMVIRYVCDMCYLSIGYPNNKEQQDYLKQ
Ga0181432_107790843300017775SeawaterMYFMGRSQKVAALFEKRQKIEREIEKLQRSCQHPTKSVKNVRERLDSTTMVIRYVCDECLAIIGYPSKEETQNYLKQ
Ga0181432_109151433300017775SeawaterMGRSQKVANLLEKRQKIEREIEKLQKSCKHPTKSIKNVRERLDSTTMVIRYVCDECLLIIGYPSKEETQNYLKQ
Ga0181432_109863423300017775SeawaterMGKSQKVANLHEKRQKIEKEIEKLQKSCEHPTKTIKFVRERLDSTTMVVRYVCDKCFLPIGYPNKKEIQNYLKQ
Ga0181432_111352513300017775SeawaterMGKIPKVAALIEKRQKIEREIEKLQGSCQHPIKSVKFVRERLDSTTMVIRYVCDECLLIIGYPSKK
Ga0181432_111698233300017775SeawaterMGKSQKVAALFEKRQKIEREIEKLQKSCQHPTKSVKNVRERLDSTTMVIRYVCDECLLIIGYPSKEETQNYLKQ
Ga0181432_114484033300017775SeawaterMGKPQKVATLLGERQKIEKEIEEIQKSCHHSQKSIKYVRERLDSTIMVVRYVCDECYLIVSIPNNDELQKFLKQ
Ga0181432_117727633300017775SeawaterMGKPQKVANLFEKRQKIEKEIETLQKSCQHQTKSIKSVRERLDSTTMVIRYVCDECFLPIGYPNKKETQNYLKQ
Ga0181432_123578233300017775SeawaterKRQKIEKEIEKLQKSCQHPTKSVKFVRERLDSTTMVVRYVCDECLLIIGYPSKEETQNYLKQ
Ga0181432_126756633300017775SeawaterVEGLLSTRKEIEKEIEEIQKSCQHPTKSIKNVRERLDSQTMITRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181432_129478213300017775SeawaterMGKIPKVAALFEKRQKIEREIEEIQKSCEHSTKSVKLTRERLDSTTMVIRYVCDECLLSIGYPSKEEIQNYLKK
Ga0181394_104319213300017776SeawaterFLYFMGKTQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0181394_110910023300017776SeawaterMTLKKPFNKVEGLLSTRKKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNDELQNYLKQ
Ga0181395_114297313300017779SeawaterQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTAMVIRWTCDICSSVVGIPNNNELQNYLKQ
Ga0181395_126046723300017779SeawaterMGKSQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ
Ga0181423_107715323300017781SeawaterMGKTQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYVCDECFLIIGIPNNDELQNYLKQ
Ga0181380_102291413300017782SeawaterMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLNQ
Ga0181380_108951623300017782SeawaterMGKIPKVATLLEKRQKIEKEIEELQRSCQHPTKSIKNVRERLDSTTMVIRYVCNECLLIIGYPTEKEIQNYLKQ
Ga0181379_119235423300017783SeawaterMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCSSTLGVPSNNELQNYLKQ
Ga0181424_1007752653300017786SeawaterMGKSQKVATLQGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCNECSLIIGIPNNDELQNFLKQ
Ga0206125_10006396183300020165SeawaterMGNTQKIAILLGERQKIEKEIEKLQRSCKHTTKSIKSVRERLDSTTMVVRWTCDTCSSIVGIPNNDELTNYLKQ
Ga0206125_1001745533300020165SeawaterMTLKKSFNKVEGLLSTRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTAMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0206125_1002474893300020165SeawaterMGKTQKVATLLGERQKIEKEIEDIQKSCQHPTKSIRNVRERLDSQTTVVRYVCSECSLIIGIPNNDELQNFLKQ
Ga0206125_1015961643300020165SeawaterFMGNTQKIAKLLGERQKIEKEIEELQKSCQHLTKSLKSVRERLDSTEINVRWVCNACSSIVGIPNNDELTNYLK
Ga0206124_1004159713300020175SeawaterKVATLLGERQKIEKEIEKIQKSCQHPTKSIRNVRERLDSQTTVVRYVCSECSLIIGIPNNDELQNFLKQ
Ga0206124_1018669923300020175SeawaterMGKSQKIAKLLGERQKIEKKIEELQKSCKHTTKSIKSVRERLDSTTMVIRWTCNTCSSILGVPNNDELQNYLKQ
Ga0206124_1041182313300020175SeawaterMGNTQKIAKLLGERQKIEKEIEELQKSCQHLTKSLKSVRERLDSTEINVRWVCNACSSIVGIPNNDELTNYLK
Ga0211690_110062523300020335MarineMTLKKPFNKVEGLLSTRKEIEKEIEDIQKSCQHPTKSIKNVRERLDSQIMVIRYVCDECSLTIGIPNNNELQKYLKQ
Ga0211504_109093323300020347MarineMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIDDFLKQ
Ga0211505_107561923300020352MarineMGKTQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDFLKQ
Ga0211652_1000283353300020379MarineMTPKKPFNKVEGLFSARREIDKEIQKIQKVCQHPTKSIRSVRERLDSQTMVIRWTCDTCSSVIGIPNNNELQNYLKQ
Ga0211686_1026412123300020382MarineMTPKKPFNKVEGLLFARKEIEKEIEELQSICHHPIKSIKNVRERLDSTLMVIRYVCDECSSVIGIPNHDDLQNYLKQ
Ga0211677_1011653023300020385MarineMTLKKPFNKVEGLLSTRKEIEKEIEKIQKACQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNFLKQ
Ga0211687_1018241613300020396MarineMGNTQKIAKLLGERQKIEKEIEELQRSCQHTTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0211653_1008652853300020421MarineKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNNELQNFLKQ
Ga0211576_1044097833300020438MarineMGKPQKVATLLGERQKIEKEIERLQTLCQHPKKTIKSVRERLDSTTTVIRYVCDECCLIVGIPNNDKLQNFLKQ
Ga0211576_1062323813300020438MarineMKMNKKIDNLHKERLKIEKEIENLQKTCKHPTKSLKNVRERLDSTTMVIRWTCNTCSSVVGIPNNNELQEYLKQ
Ga0211473_1008559233300020451MarineMTPMKPFNKVEGLFSARREIEKEIEDIQKSCQHPTKSIKNVRERLDSQTMVTRYVCDKCSLIIGIPNDNELQNYLKQ
Ga0211545_1031421313300020452MarineMGKSQKIAKLLGERQKIEKKIEELQKSCKHTTKSIKSVRERLDSTTMVVRWTCNTCSSILGIPNNDELTNYLKQ
Ga0211475_1056039523300020468MarineLYFMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVVRYVCDECSLIIGIPNNDELQNYLKQ
Ga0211577_1006211243300020469MarineMTLKKSFNKVEGLLSTRRKIEKEIEEIQKLCQHPTKSIKNVRERLDSTAMVTRYVCDECSSIIGIPNNDELQNFLKQ
Ga0211577_1033303213300020469MarineMGKTQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ
Ga0211543_1004188853300020470MarineMGKSQKIAKLLGEKQKIEKKIEELQRSCEHPTKSVKFTRERLDSTIMVIRYVCDECLLSIGYPTQQEIKKYLNG
Ga0206126_1035291333300020595SeawaterMTLKKPFNKVEGLLSTRKEIDKEIEELQKSCQHPTKSIKNVRERLDSTTMVVRWTCDTCSLIIGIPNNNELQNYLNQ
Ga0222717_1023427913300021957Estuarine WaterMGKTQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYVCGECSLIIGIPNNDELQNFLKQ
Ga0222716_1012940753300021959Estuarine WaterMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLSIGYPNIKEIEDFLKQ
Ga0212022_100120453300022164AqueousMGKSQKIAKLLGERQKIEKKIEELQQSCQHPTKSIKNVRERLDSTTMVVRWTCNTCSSILGIPNNDELQNYLKQ
Ga0212022_100378323300022164AqueousMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIKSVRERLDSTTTVIRYVCDDCCLIVGIPNNDDLENFLKK
Ga0212022_100596133300022164AqueousMGKTQKVATLLGERQKIEKEIEKIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ
Ga0212022_100631933300022164AqueousMGMNKKIDNLHKEKLKIEKEIENLQKICKHPTKSLKNVRERLDSTTMVIRWTCNICSSVVGIPNNNELQEYLKQ
Ga0212022_106878023300022164AqueousMGKPQKMARLLGERQKIEKEIEELQRLCKHPTKSIKNVRERLDSTTTVVRWTCDTCSSIIGIPNNDELQNYLKQ
Ga0212022_107511723300022164AqueousMEDSQKIATLLAERQNIEREIAKIQQLCHHPSTSLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK
(restricted) Ga0233426_1006493013300022920SeawaterMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLNQ
(restricted) Ga0233426_1022228723300022920SeawaterMEDSQKIATLLAERQKIEREIAKIQQLCHHSSTSLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK
(restricted) Ga0233426_1035774023300022920SeawaterMGKTQKVATLLGERQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDF
(restricted) Ga0233432_1012974353300023109SeawaterMGKTQKVATLLGERQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDFLKQ
(restricted) Ga0233438_1023029813300024255SeawaterMGKTQKVATLLGERQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0244775_1054494543300024346EstuarineMEDSQKIATLLAERQNIEREIAKIQQLCHHSSTSLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK
Ga0244775_1059365913300024346EstuarineMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPVGYPNIDDLENFLKQ
Ga0244776_1015092333300024348EstuarineMGKPQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDECLLPIGYPNIKEIEDFLKQ
Ga0208920_109434713300025072MarineMGKPQKVATLLEERQKIEREIEKLQKSCGHPSKSIKSVRERLDSTTMVIRYVCDECLLSIGYPSEKEIQNYLKQ
Ga0208157_101679323300025086MarineMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNNELQNFLKQ
Ga0208157_104305253300025086MarineMGKSQKIAKLLGEKQKIEKKIEELQRSCKHPAKSIRGVREHLDSTEVVIRWTCDVCFSIVGIPNKDELTNYLKQ
Ga0208157_108129913300025086MarineLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0208669_107903913300025099MarineMGKSQKIAALFKEKQKIEKEIEELQGSCKHPTKSIKNVRERLDSTTMVIRWTCDTCSSVVGIPNNNELQNYLKQ
Ga0208666_108730513300025102MarineMGKPQKIAKLLGEKQKIEQEIEELQRSCKHLTKSIKNVRERLDSTTTVVRWTCDICSSIIGIPNNDELQDYLKQ
Ga0208666_110136413300025102MarineMGNAQKIAKLLGERQKIEKEIEELQKSCQHLTKSVKSVRERLDSTEISVRWVCDTCSSIVGIPNNDELTNYLKQ
Ga0208013_116207113300025103MarineMGKTQKVATLLEKRQKIEKEIEELQRSCQHPTKSVKFTRERLDSTVMVIRYVCDECLLSIGYPSEKEIQNYLKK
Ga0209535_1003576123300025120MarineMGKSKKMAVLFSERQKIEKEIKELQGSCNHPTKSIKNVRERLDSTTTVIRHVCDACSSVVGIPNNDELQNYLKQ
Ga0209535_103554863300025120MarineMTLKKPFNKVEGLLSTRKEIEKEIEGIQKSCQHPTKSIKNVRERLDSQIMVIRYVCDECSLTIGIPNNNELQKYLKQ
Ga0209535_105696753300025120MarineMGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ
Ga0209535_116089133300025120MarineILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLNQ
Ga0209535_119534813300025120MarineMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEI
Ga0209232_114765113300025132MarineMGKSQKVAALLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTTTVVRWTCDICSSIIGIPNNDELQNYLKQ
Ga0208299_101565193300025133MarineMEMNKKIDNLHKERLKIEKEIENLQKTCKHPTKSLKNVRERLDSTTMVIRWTCNICSSVVGIPNNNELQEYLKQ
Ga0209336_1003606613300025137MarineGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQNYLKQ
Ga0209336_1009499713300025137MarineGKTPKIAILLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ
Ga0209336_1013233413300025137MarineMGNTQKIAKLLGERQKIEKEIEELQRSCQHTTKSIKSVRERLDSTIMVVRWTCDTCFSTLGIPNNNELQ
Ga0209336_1013926833300025137MarineTRKEIDKEIEGIQKLCQHPTKSIKNVRERLDSTSMVIRYVCDECSLTIGIPNNNELQKYLKQ
Ga0209634_100863263300025138MarineMTPKKSFNKVEGLLSTRRKIEKEIEEIQNNCKHSSKSIKQVQERLGTPTLVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0209634_101370743300025138MarineMGKTQKVATLLGERQKIEKKIEKIQKSCQHPTKSIKNVRERLDSTAIVTRYVCDECYLILGIPNNDELQIFLKQ
Ga0209634_101388843300025138MarineMGKSQKIAKLLGERQKIEKEIEELQRSCQHTTKSIKSVRERLDSTIMVVRWTCDTCSSTLGVPNNNELQNYLKQ
Ga0209634_101475733300025138MarineMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSQITVVRYVCDECSLIIGIPNNDELQNYLKQ
Ga0209634_105980363300025138MarineMGKSQKVATLLGERQKIEKEIENIQKSCQHPTKSIKNVRERLDSTIMVIRWTCDTCSSTLGIPNNNELQNYLKQ
Ga0209634_106302553300025138MarineMIFKKPHNKVEGLLSTRKEIEKEIEEIQNSCQHSTKSIKYVRERLDSTIMVVRYVCDKCYLIIGIPNNDNLQNFLKK
Ga0209634_108613713300025138MarineMGKSQKVATLLGERQKIEKEIEEIQKACQHSTKSIKNVRERLGSTSIVTRYVCDECSLIIGIPNNNELQNFLKQ
Ga0209634_109163813300025138MarineMGKTQKVATLLGERQKIEKEIEDIQKACQHPTKSIKNVRERLDSQTMVTRYVCDECSLIIGIPNNNELQNFLKQ
Ga0209634_109499813300025138MarineMGKSQKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ
Ga0209634_110728643300025138MarineMGKTQKVATLLGERQKIEKEIEKIQNSCQHLIKSIKNVRERLDSTTIVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0209634_118657333300025138MarineMTLKKPFNKVEGLLSTRKEIDKEIEGIQKLCQHPTKSIKNVRERLDSTSMVIRYVCDECSLTIGIPNNNELQKYLKQ
Ga0209634_132500623300025138MarineMGKTQKVATLLGERQKIEKEIEKIQKSCQHPTKSIKNVRERLDSTTMVTRYVCDECSLIIGIPNNDELQNYLKQ
Ga0209645_107412033300025151MarineMGKPQKMARLLGERQKIEKEIEKLQRLCKHPTKSIKNVRERLDSTTTVVRWTCDTCSSIIGIPNNDELQNYLKQ
Ga0209337_1004849103300025168MarineMGQPQKVATLLGERQKIEKEIEILQKACYHPTKSIKYVRERLDSTAMVVRWTCDECCLIVGIPNNDKLQNFLKQ
Ga0209337_1006596123300025168MarineMGKPQKVATLLGERQKIEKEIEELQRSCQHSTRSVKFVRERLDSTTMVVRYVCDECLSIIGYPSKEETQNYLKQ
Ga0209337_1008745123300025168MarineMGQPQKVATLLGERQKIEKEIEILQKACHHPTKSIKYVRERLDSTAMVVRYVCDGCYLIVGIPNNDNLQNFLKQ
Ga0209337_100913253300025168MarineMGRIPKVATLLGERQKIEKEIEEIQKLCQHSQKSIKSVRERLDSSTLVIRYVCDECYLIVGIPNNNKLQNFLKQ
Ga0209337_101270813300025168MarineMGKTQKVATLLGERQKIEKEIEKIQKACQHPTKSIKNVRERLDSQTMVTRYVCDECSLIIGIPNNNELQNFLKQ
Ga0209337_101349673300025168MarineMGRIPKVATLLGERQKIEKEIENLQKSCQHSTKSIKSVRERLDSTSMVIRYVCDECLLSIGYPNDEEQQNYLKQ
Ga0209337_102824673300025168MarineMDNSQKIAALLGERQKIEKEIAKIQQLCQHLTKSIKCVRERLDSTTMVVRWTCDTCFSIVGIPNNEEINGFFRE
Ga0209337_103021263300025168MarineMGKPQKVANLLEKRQKIEKEIEELQRSCQHSTKSIKFIRERLDSTITVIRYVCNDCYLIVGIPDNNKLQNFLKQ
Ga0209337_103229213300025168MarineMGKSQKVATLLRERQKIEKEIEILQKSCQHLTKSIKYVRERLDSTTMVVRYVCDDCCLIVGIPNNDKLQNFLKQ
Ga0209337_104233973300025168MarineMGKPQKVATLLGERQKIEKKIEEIQKSCEHPTKSIKSVRERLDSTTIIIRYICDECCLIVGIPDNNKLQDFLKK
Ga0209337_104820223300025168MarineMGKSQKVATLLGERQKIEKEIEKIQKSCQHLTKSIRNVRERLDSQTTVVRYVCNECSLIIGIPNNDELQNFLKQ
Ga0209337_106545113300025168MarineMGKPQKVAALLGERQKIEKEIEELQRSCEHPTKSIKSVRERLDTTTIVIRYVCDTCLLPIGYPNDKEQQNYLKK
Ga0209337_107480413300025168MarineMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLSIGYPNAKEIENFLNQ
Ga0209337_109303713300025168MarineMGKTQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTTVIRYVCDECSLIIGIPNNDELQNFLKQ
Ga0209337_113343843300025168MarineMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPVGYPNIDDLENFLKQ
Ga0209337_113707613300025168MarinePQKVATLLGERQKIEKEIEEIQKSCQHSTKSIKYVRERLDSTIMVVRWTCDTCCLIVGIPNNDKLQNFLKQ
Ga0209337_113780313300025168MarineMGRIPKVATLLGERQKIEKEIENLQKSCQHPAKSIKYVRERLDSTAMVIRYVCDECCLIVGIPNNDKLQNFLKQ
Ga0209337_113924513300025168MarineMGKPQKVATLLGERQKIEKEIEKLQKSCEHPTKSVKFVRERLDSTTVVIRYVCDECLLLIGYPSKEEIHNYLKQ
Ga0209337_119453643300025168MarineMGKTQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTSMVIRYVCGECLLPIGYPNNEEIQKYLKQ
Ga0209337_121534733300025168MarineMGKSQKVATLLGERQKIEKEIEDIQKACQHPTKSIKNVRERLDSTAIVTRYVCDECSLIIGIPNNNKLQNFLKQ
Ga0209337_123184633300025168MarineMGKPQKVAPLLEERQKIEKEIENLQKSCQHPTKSIKFTRESLDSTTMVIRYICDECCLIVGIPNNDKLQNFLKK
Ga0209194_106134233300025632Pelagic MarineMTLKKPFNKVEGLLSTRKEIEKEIEKIQKTCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNFLKQ
Ga0209532_109530653300025696Pelagic MarineKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSQTTVVRYVCDECSLIIGIPNNDELQNFLKQ
Ga0208545_105342443300025806AqueousMGKTQKVATLLGERQKIEKEIEEIQKSCQHPTKSIKNVRERLDSTSMVVRYVCDECSLIIGIPNNDELQNFLKQ
Ga0208545_108993543300025806AqueousKVATLLGERQKIEKEIEEIQKSCQHPIKSIKNVRERLDSTSMVVRWTCDTCFSIVGIPNNNELQNYLKQ
Ga0209757_1009618923300025873MarineMGKVPKVAALFEKRQKIEKEIEKLQGSCQHPTKSIKFARERLDSTTMVIRYVCDECLLIIGYPSKEETLNYLKQ
Ga0209631_1016016633300025890Pelagic MarineMGNTQKIAILLGERQKIEKEIEKLQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLSIGYPNIKEIEDFLKQ
Ga0209335_1025088943300025894Pelagic MarineTLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTSMVTRYVCDECSLIIGIPNNDELQNFLKQ
Ga0209425_1048558413300025897Pelagic MarineMGKSQKVATLLGERQKIEKEIEDIQKSCQHPTKSIKNVRERLDSTTMVVRWTCDTCSLIIGIPNNNELQNYLNQ
Ga0208941_105023713300027077MarineMGRPQKVATLLGERQKIEKEIEELQRSCQHPTKSIKNVRERLDSTSMVTRYMCDECFLIIGIPNNDELQNFLKQ
Ga0208170_102723613300027234EstuarineMGKPQKVAILLGEKQKIEKEIEKLQRSCQHSTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNIKEIEDFLKQ
Ga0209384_100295833300027522MarineMGETQKVATLLGEKQKIEKEIAKIQQLCDHTSNSVKSVRERLDSTSTVIRHVCDECSSIVGIPNNNDLQNFLKQ
Ga0209384_1003040113300027522MarineMGKTQKVATLLGERQKIEKEIEKIQNSCQHPTKSIKNVRERLDSTTMVIRYVCDECSLIIGIPNNNELQNFLKQ
Ga0209384_101611723300027522MarineMGTIQNITTLLKEKQKIEKEIEKLQNLCQHPTKSIKYVRERLDSTIMVIRYVCDGCSLIIGIPNNDNLQNFLKQ
Ga0209384_102364323300027522MarineMKKVAKLLEERQKINKEIEDIQKECPHFYASIKSVRERLDSTTNVIRYVCDSCSSIVGIPNNNDLQNFLKQ
Ga0209384_105754713300027522MarineMGNSQKVATLLGERQKIEREIAKIQQLCDHPSNSVKSVRERLDSTTTVIRHVCDECSSIVGIPNNNDLQIFLKQ
Ga0209384_112308613300027522MarineMGKPQKVATLLEERQKIEREIEKLQKSCQHSQKSIKSIRERLDSTTMVIRYTCDECSSIVGIPNTNDLENFLKQ
Ga0209554_123207323300027685MarineMGKAPKVVDLLEKRQKIEREIEKIQNSCEHPSKSIKSVRERLDSTTMVIRYVCNMCFLPIGYPNDKEQQDYLKQ
Ga0209830_1015676413300027791MarineVCVKASKLTYIFLFMGKTPKIATLLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ
Ga0256372_100249653300028123Sea-Ice BrineMSFKRSLNKVEGLFSARKKIEKEIEEIQKLCQHPTKSIKSIQERLDSTTMVIRYVCNECSSVIGIPNHDELQNYLKQ
Ga0302114_1022795613300031621MarineMGKSKKMAVLFSERQKIEKEIKELQGSCNHPTKSIKNVRERLDSTTTVIRHVCDVCSSVVGIPNNDELQNYLKQ
Ga0302126_1019911013300031622MarineMGKTPKIATLLMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ
Ga0302126_1028004423300031622MarineMEDSQKIATLLVERQNIEREIAKIQQLCHHSSTSLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK
Ga0302118_1027827423300031627MarineMEDSQKIATLLAERQNIEREIAKIQQLCHHPSTSIKFVRERLDSTMMVVRHTCDECSSIVGIPNTNDLENFLKK
Ga0302122_1006176923300031675MarineMEKQKIEKEIEELQGSCQHQTKSVKNVRERLDSTVMVVRYVCDACLLPIGYPNIDDLENFLKQ
Ga0302122_1021122423300031675MarineMGRIPKVATLLEERQKIEKEIEEIQKTCQHSTKSIKYVRERLDSTTMVVRYVCDECYLIVGIPNNDKLQNFLKQ
Ga0316202_1035663633300032277Microbial MatMGKTQKVATLLGERQKIEKEIEKLQRSCQHPTKSIKNVRERLDSTTMVIRYVCDTCLLPIGYPNAKEIENFLNQ
Ga0314858_122352_293_5173300033742Sea-Ice BrineMEDSQKIATLLAERQNIEREIAKIQQLCHHSSASLKFVRERLDSTIMVVRHTCDECSSIVGIPNTNDLENFLKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.