Basic Information | |
---|---|
Family ID | F004210 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 448 |
Average Sequence Length | 44 residues |
Representative Sequence | MKCDLCTEDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD |
Number of Associated Samples | 291 |
Number of Associated Scaffolds | 448 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 34.15 % |
% of genes near scaffold ends (potentially truncated) | 27.68 % |
% of genes from short scaffolds (< 2000 bps) | 84.38 % |
Associated GOLD sequencing projects | 269 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.527 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (10.268 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.759 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.196 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.72% β-sheet: 16.67% Coil/Unstructured: 73.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 448 Family Scaffolds |
---|---|---|
PF05995 | CDO_I | 20.31 |
PF02599 | CsrA | 19.42 |
PF00691 | OmpA | 19.42 |
PF13677 | MotB_plug | 4.02 |
PF00990 | GGDEF | 2.68 |
PF01618 | MotA_ExbB | 2.23 |
PF00196 | GerE | 1.79 |
PF12695 | Abhydrolase_5 | 1.34 |
PF03372 | Exo_endo_phos | 1.34 |
PF00072 | Response_reg | 1.12 |
PF03102 | NeuB | 1.12 |
PF04545 | Sigma70_r4 | 1.12 |
PF02623 | FliW | 0.89 |
PF02348 | CTP_transf_3 | 0.89 |
PF02655 | ATP-grasp_3 | 0.89 |
PF00856 | SET | 0.67 |
PF00248 | Aldo_ket_red | 0.67 |
PF09752 | ABHD18 | 0.67 |
PF13534 | Fer4_17 | 0.67 |
PF00106 | adh_short | 0.45 |
PF00795 | CN_hydrolase | 0.45 |
PF00596 | Aldolase_II | 0.45 |
PF13231 | PMT_2 | 0.45 |
PF13706 | Obsolete Pfam Family | 0.22 |
PF06224 | HTH_42 | 0.22 |
PF08666 | SAF | 0.22 |
PF01112 | Asparaginase_2 | 0.22 |
PF13183 | Fer4_8 | 0.22 |
PF03099 | BPL_LplA_LipB | 0.22 |
PF14066 | DUF4256 | 0.22 |
PF13803 | DUF4184 | 0.22 |
PF02754 | CCG | 0.22 |
PF01464 | SLT | 0.22 |
PF03572 | Peptidase_S41 | 0.22 |
PF00697 | PRAI | 0.22 |
PF00041 | fn3 | 0.22 |
PF13620 | CarboxypepD_reg | 0.22 |
PF00111 | Fer2 | 0.22 |
PF08668 | HDOD | 0.22 |
PF00005 | ABC_tran | 0.22 |
PF01895 | PhoU | 0.22 |
PF07995 | GSDH | 0.22 |
PF03796 | DnaB_C | 0.22 |
PF13692 | Glyco_trans_1_4 | 0.22 |
PF03079 | ARD | 0.22 |
PF02518 | HATPase_c | 0.22 |
PF03979 | Sigma70_r1_1 | 0.22 |
PF02687 | FtsX | 0.22 |
PF13442 | Cytochrome_CBB3 | 0.22 |
PF03807 | F420_oxidored | 0.22 |
PF00814 | TsaD | 0.22 |
PF07549 | Sec_GG | 0.22 |
COG ID | Name | Functional Category | % Frequency in 448 Family Scaffolds |
---|---|---|---|
COG5553 | Predicted metal-dependent enzyme of the double-stranded beta helix superfamily | General function prediction only [R] | 20.31 |
COG1551 | sRNA-binding carbon storage regulator CsrA | Signal transduction mechanisms [T] | 19.42 |
COG2089 | Sialic acid synthase SpsE, contains C-terminal SAF domain | Cell wall/membrane/envelope biogenesis [M] | 1.12 |
COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
COG1699 | Flagellar assembly factor FliW | Cell motility [N] | 0.89 |
COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.22 |
COG0135 | Phosphoribosylanthranilate isomerase | Amino acid transport and metabolism [E] | 0.22 |
COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.22 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.22 |
COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.22 |
COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.22 |
COG0341 | Preprotein translocase subunit SecF | Intracellular trafficking, secretion, and vesicular transport [U] | 0.22 |
COG0342 | Preprotein translocase subunit SecD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.22 |
COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.22 |
COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.22 |
COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.22 |
COG1791 | Acireductone dioxygenase (methionine salvage), cupin superfamily | Amino acid transport and metabolism [E] | 0.22 |
COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.22 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.22 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.22 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.53 % |
Unclassified | root | N/A | 6.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_149452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_14086016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101764119 | All Organisms → cellular organisms → Bacteria | 4210 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101765380 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101765425 | All Organisms → cellular organisms → Bacteria | 10411 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104221644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1057829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300000789|JGI1027J11758_12979015 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
3300000891|JGI10214J12806_12523635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300001431|F14TB_106647526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
3300002124|C687J26631_10042229 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
3300002558|JGI25385J37094_10019329 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
3300002560|JGI25383J37093_10044716 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300002908|JGI25382J43887_10216109 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300002911|JGI25390J43892_10124822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300003267|soilL1_10040123 | All Organisms → cellular organisms → Bacteria | 4092 | Open in IMG/M |
3300003324|soilH2_10003049 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300003324|soilH2_10150818 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
3300003324|soilH2_10277546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1152 | Open in IMG/M |
3300003324|soilH2_10341348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2963 | Open in IMG/M |
3300003465|P52013CM_1052052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300003702|PicMicro_10016940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7917 | Open in IMG/M |
3300004009|Ga0055437_10303599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300004047|Ga0055499_10033531 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300004114|Ga0062593_100868916 | Not Available | 907 | Open in IMG/M |
3300004114|Ga0062593_101526060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300004156|Ga0062589_100144312 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
3300004156|Ga0062589_100192455 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
3300004157|Ga0062590_102131047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300004157|Ga0062590_102137096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300004157|Ga0062590_102393459 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300004463|Ga0063356_100018785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6419 | Open in IMG/M |
3300004463|Ga0063356_100059848 | All Organisms → cellular organisms → Bacteria | 3895 | Open in IMG/M |
3300004463|Ga0063356_100061155 | All Organisms → cellular organisms → Bacteria | 3861 | Open in IMG/M |
3300004463|Ga0063356_100239623 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
3300004463|Ga0063356_100534570 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300004463|Ga0063356_100683506 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
3300004463|Ga0063356_101101796 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300004463|Ga0063356_101709355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 941 | Open in IMG/M |
3300004463|Ga0063356_103171844 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300004463|Ga0063356_106158877 | Not Available | 514 | Open in IMG/M |
3300004480|Ga0062592_100677892 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300004480|Ga0062592_102482056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300004633|Ga0066395_10103025 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300004633|Ga0066395_10727511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
3300004643|Ga0062591_101016753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
3300004798|Ga0058859_10003101 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300004800|Ga0058861_10010343 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300004801|Ga0058860_10050519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300005093|Ga0062594_102730327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300005166|Ga0066674_10065945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
3300005166|Ga0066674_10309628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300005172|Ga0066683_10359128 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300005172|Ga0066683_10631478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
3300005175|Ga0066673_10409617 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300005179|Ga0066684_10642294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300005180|Ga0066685_10224299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1293 | Open in IMG/M |
3300005180|Ga0066685_10650958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
3300005293|Ga0065715_10180871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1462 | Open in IMG/M |
3300005293|Ga0065715_10437148 | Not Available | 840 | Open in IMG/M |
3300005330|Ga0070690_101156133 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300005330|Ga0070690_101371683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300005331|Ga0070670_100016767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6287 | Open in IMG/M |
3300005331|Ga0070670_100977829 | Not Available | 769 | Open in IMG/M |
3300005331|Ga0070670_101124382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300005332|Ga0066388_100054779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4148 | Open in IMG/M |
3300005332|Ga0066388_100220244 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
3300005332|Ga0066388_100234237 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
3300005332|Ga0066388_100487824 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
3300005332|Ga0066388_100899182 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300005332|Ga0066388_102394123 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300005332|Ga0066388_102818793 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300005332|Ga0066388_104964833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300005332|Ga0066388_105178069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
3300005332|Ga0066388_105273578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300005332|Ga0066388_105955020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300005332|Ga0066388_106450499 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005332|Ga0066388_106738311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300005332|Ga0066388_106981112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300005332|Ga0066388_107055880 | Not Available | 565 | Open in IMG/M |
3300005338|Ga0068868_101655761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300005340|Ga0070689_100343842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
3300005355|Ga0070671_101330549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300005365|Ga0070688_100334766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
3300005365|Ga0070688_101434890 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300005446|Ga0066686_10421450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300005446|Ga0066686_10619243 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300005446|Ga0066686_10925437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300005447|Ga0066689_10119761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1535 | Open in IMG/M |
3300005450|Ga0066682_10128496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
3300005451|Ga0066681_10274288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
3300005454|Ga0066687_10804101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300005456|Ga0070678_100346936 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300005459|Ga0068867_101346802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300005466|Ga0070685_11272303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300005518|Ga0070699_101357997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300005529|Ga0070741_11161499 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300005530|Ga0070679_101579687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300005532|Ga0070739_10141652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
3300005540|Ga0066697_10298937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
3300005543|Ga0070672_101437579 | Not Available | 617 | Open in IMG/M |
3300005544|Ga0070686_100634299 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005544|Ga0070686_100970446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
3300005544|Ga0070686_101187487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300005552|Ga0066701_10297487 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300005552|Ga0066701_10705326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300005552|Ga0066701_10727542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300005553|Ga0066695_10064518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2203 | Open in IMG/M |
3300005555|Ga0066692_10701677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300005557|Ga0066704_10384039 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300005558|Ga0066698_10884486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300005560|Ga0066670_10201141 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300005576|Ga0066708_10857423 | Not Available | 568 | Open in IMG/M |
3300005598|Ga0066706_10637019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
3300005610|Ga0070763_10805634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300005617|Ga0068859_100876426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300005713|Ga0066905_101908342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300005764|Ga0066903_104399886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300005764|Ga0066903_105457074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300005764|Ga0066903_106103179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300005764|Ga0066903_106407716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Niveibacterium | 614 | Open in IMG/M |
3300005764|Ga0066903_106820607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300005829|Ga0074479_10851133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7133 | Open in IMG/M |
3300005836|Ga0074470_10033909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300005836|Ga0074470_10230531 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300005836|Ga0074470_10410676 | All Organisms → cellular organisms → Bacteria | 4185 | Open in IMG/M |
3300005836|Ga0074470_10482377 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300005836|Ga0074470_10581095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300005836|Ga0074470_11179137 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300005842|Ga0068858_100120258 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
3300005937|Ga0081455_11019057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300006034|Ga0066656_10412480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300006046|Ga0066652_101746949 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300006237|Ga0097621_100257242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1531 | Open in IMG/M |
3300006237|Ga0097621_102150360 | Not Available | 534 | Open in IMG/M |
3300006358|Ga0068871_101200396 | Not Available | 712 | Open in IMG/M |
3300006426|Ga0075037_1659499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300006791|Ga0066653_10775990 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300006794|Ga0066658_10201110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
3300006796|Ga0066665_10181720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1619 | Open in IMG/M |
3300006796|Ga0066665_11592167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300006797|Ga0066659_10072497 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300006797|Ga0066659_10309034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
3300006797|Ga0066659_10771452 | Not Available | 792 | Open in IMG/M |
3300006800|Ga0066660_11148882 | Not Available | 612 | Open in IMG/M |
3300006804|Ga0079221_10935027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300006844|Ga0075428_100219269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2054 | Open in IMG/M |
3300006844|Ga0075428_100336146 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
3300006844|Ga0075428_102003147 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300006845|Ga0075421_100108803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3484 | Open in IMG/M |
3300006845|Ga0075421_100186489 | All Organisms → cellular organisms → Bacteria | 2576 | Open in IMG/M |
3300006845|Ga0075421_101365118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300006845|Ga0075421_101702870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300006847|Ga0075431_101442233 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300006847|Ga0075431_102076393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300006852|Ga0075433_10060433 | All Organisms → cellular organisms → Bacteria | 3318 | Open in IMG/M |
3300006852|Ga0075433_10322176 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
3300006853|Ga0075420_100396314 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300006854|Ga0075425_101258234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300006854|Ga0075425_103032313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300006865|Ga0073934_10001475 | All Organisms → cellular organisms → Bacteria | 55916 | Open in IMG/M |
3300006865|Ga0073934_10386417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
3300006880|Ga0075429_100433802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
3300006881|Ga0068865_101846569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300006894|Ga0079215_10882447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300006914|Ga0075436_101308454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300007004|Ga0079218_10078200 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
3300007004|Ga0079218_11911910 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300007004|Ga0079218_14011003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300007076|Ga0075435_100807963 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300007255|Ga0099791_10419218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300007619|Ga0102947_1062926 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
3300009012|Ga0066710_100643621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1612 | Open in IMG/M |
3300009012|Ga0066710_100767373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1475 | Open in IMG/M |
3300009012|Ga0066710_100805221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
3300009012|Ga0066710_100902023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1360 | Open in IMG/M |
3300009012|Ga0066710_101361405 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300009012|Ga0066710_102883462 | Not Available | 675 | Open in IMG/M |
3300009089|Ga0099828_10279012 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300009090|Ga0099827_10592938 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300009094|Ga0111539_10001149 | All Organisms → cellular organisms → Bacteria | 34979 | Open in IMG/M |
3300009094|Ga0111539_10335024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1761 | Open in IMG/M |
3300009094|Ga0111539_11037487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
3300009094|Ga0111539_11419893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300009094|Ga0111539_12880300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300009095|Ga0079224_104295346 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300009102|Ga0114948_11650929 | Not Available | 511 | Open in IMG/M |
3300009137|Ga0066709_100714890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1442 | Open in IMG/M |
3300009143|Ga0099792_10001975 | All Organisms → cellular organisms → Bacteria | 7740 | Open in IMG/M |
3300009147|Ga0114129_10450004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1689 | Open in IMG/M |
3300009156|Ga0111538_10115187 | All Organisms → cellular organisms → Bacteria | 3415 | Open in IMG/M |
3300009157|Ga0105092_10839334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300009162|Ga0075423_10208479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2049 | Open in IMG/M |
3300009162|Ga0075423_10518547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
3300009162|Ga0075423_10844272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
3300009162|Ga0075423_11662076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300009173|Ga0114996_10315816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
3300009176|Ga0105242_10958299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
3300009176|Ga0105242_12193479 | Not Available | 597 | Open in IMG/M |
3300009235|Ga0103857_10052742 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300009444|Ga0114945_10094706 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300009444|Ga0114945_10267566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
3300009444|Ga0114945_10336401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300009444|Ga0114945_10661158 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300009609|Ga0105347_1065791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
3300009678|Ga0105252_10025815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2130 | Open in IMG/M |
3300009678|Ga0105252_10111979 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300009777|Ga0105164_10136467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
3300009792|Ga0126374_11817153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300010043|Ga0126380_10512775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
3300010043|Ga0126380_10700556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300010046|Ga0126384_11577449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300010047|Ga0126382_10014632 | All Organisms → cellular organisms → Bacteria | 3901 | Open in IMG/M |
3300010154|Ga0127503_10223426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
3300010304|Ga0134088_10456217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300010336|Ga0134071_10040985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2066 | Open in IMG/M |
3300010358|Ga0126370_11792399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300010358|Ga0126370_12022513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300010358|Ga0126370_12059351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300010359|Ga0126376_12299033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
3300010359|Ga0126376_12813375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300010361|Ga0126378_12605834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300010362|Ga0126377_10262984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1685 | Open in IMG/M |
3300010362|Ga0126377_11037870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300010366|Ga0126379_10143643 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
3300010366|Ga0126379_11239021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
3300010366|Ga0126379_13378866 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010373|Ga0134128_13029056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300010376|Ga0126381_102609648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300010376|Ga0126381_104450933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300010391|Ga0136847_12706739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300010397|Ga0134124_11787876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300010398|Ga0126383_11489274 | Not Available | 766 | Open in IMG/M |
3300010399|Ga0134127_11623349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300010399|Ga0134127_12060577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300010399|Ga0134127_13473121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300010400|Ga0134122_10000429 | All Organisms → cellular organisms → Bacteria | 28106 | Open in IMG/M |
3300010401|Ga0134121_10001097 | All Organisms → cellular organisms → Bacteria | 26414 | Open in IMG/M |
3300010401|Ga0134121_10293579 | Not Available | 1437 | Open in IMG/M |
3300010401|Ga0134121_12750991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
3300010401|Ga0134121_13088628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300010403|Ga0134123_12307535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300010403|Ga0134123_13186140 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300010883|Ga0133547_10015869 | All Organisms → cellular organisms → Bacteria | 19811 | Open in IMG/M |
3300011119|Ga0105246_10976143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
3300011119|Ga0105246_12209057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300011269|Ga0137392_10834150 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300011333|Ga0127502_11063960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300011438|Ga0137451_1226119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300012122|Ga0137332_1010964 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300012200|Ga0137382_10970093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300012201|Ga0137365_11033586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
3300012203|Ga0137399_10366657 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300012205|Ga0137362_10848923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300012207|Ga0137381_10078879 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
3300012207|Ga0137381_11424036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300012208|Ga0137376_11230645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300012211|Ga0137377_10276614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1611 | Open in IMG/M |
3300012212|Ga0150985_101720694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300012212|Ga0150985_105291740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
3300012212|Ga0150985_106796891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
3300012212|Ga0150985_114670120 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300012231|Ga0137465_1156428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300012356|Ga0137371_10239608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1417 | Open in IMG/M |
3300012356|Ga0137371_10876584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300012359|Ga0137385_10002804 | All Organisms → cellular organisms → Bacteria | 14994 | Open in IMG/M |
3300012373|Ga0134042_1160449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300012403|Ga0134049_1237472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300012406|Ga0134053_1342500 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
3300012469|Ga0150984_116173169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300012469|Ga0150984_117488895 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
3300012469|Ga0150984_122239057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300012469|Ga0150984_122789976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300012685|Ga0137397_10000007 | All Organisms → cellular organisms → Bacteria | 113039 | Open in IMG/M |
3300012906|Ga0157295_10410697 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300012908|Ga0157286_10165823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300012922|Ga0137394_10000497 | All Organisms → cellular organisms → Bacteria | 27517 | Open in IMG/M |
3300012922|Ga0137394_10721484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300012929|Ga0137404_10434389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1163 | Open in IMG/M |
3300012944|Ga0137410_10234596 | Not Available | 1432 | Open in IMG/M |
3300012948|Ga0126375_11406975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300012957|Ga0164303_11458781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
3300012971|Ga0126369_10039308 | All Organisms → cellular organisms → Bacteria | 3959 | Open in IMG/M |
3300012971|Ga0126369_10936180 | Not Available | 953 | Open in IMG/M |
3300012972|Ga0134077_10060018 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300012977|Ga0134087_10181554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300012985|Ga0164308_11936394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300013297|Ga0157378_11860145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300013306|Ga0163162_10333610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1649 | Open in IMG/M |
3300013308|Ga0157375_10573742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1289 | Open in IMG/M |
3300013308|Ga0157375_10787676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
3300013308|Ga0157375_11420244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300014154|Ga0134075_10023756 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
3300014262|Ga0075301_1164303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300014326|Ga0157380_12765469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300015371|Ga0132258_10006161 | All Organisms → cellular organisms → Bacteria | 23776 | Open in IMG/M |
3300015371|Ga0132258_10014357 | All Organisms → cellular organisms → Bacteria | 16841 | Open in IMG/M |
3300015371|Ga0132258_10021825 | All Organisms → cellular organisms → Bacteria | 13996 | Open in IMG/M |
3300015371|Ga0132258_10027385 | All Organisms → cellular organisms → Bacteria | 12638 | Open in IMG/M |
3300015371|Ga0132258_10412878 | All Organisms → cellular organisms → Bacteria | 3356 | Open in IMG/M |
3300015371|Ga0132258_12510862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
3300015371|Ga0132258_13265338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
3300015371|Ga0132258_13769248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
3300015372|Ga0132256_100557151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
3300015372|Ga0132256_101999220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300015372|Ga0132256_103537893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300015373|Ga0132257_102004059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300015374|Ga0132255_100568260 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300015374|Ga0132255_101193815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1146 | Open in IMG/M |
3300015374|Ga0132255_105153727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300015374|Ga0132255_106350239 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300016270|Ga0182036_10458815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
3300016294|Ga0182041_10850314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300016294|Ga0182041_11429943 | Not Available | 635 | Open in IMG/M |
3300016319|Ga0182033_10997232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300016445|Ga0182038_10186863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1618 | Open in IMG/M |
3300017656|Ga0134112_10016230 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
3300017792|Ga0163161_11968819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300018031|Ga0184634_10272180 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300018064|Ga0187773_10819564 | Not Available | 593 | Open in IMG/M |
3300018071|Ga0184618_10042804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1614 | Open in IMG/M |
3300018082|Ga0184639_10517495 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300018083|Ga0184628_10006892 | All Organisms → cellular organisms → Bacteria | 5443 | Open in IMG/M |
3300018083|Ga0184628_10074819 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
3300018422|Ga0190265_13547632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300018431|Ga0066655_10239485 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300018431|Ga0066655_10593913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300018433|Ga0066667_10007602 | All Organisms → cellular organisms → Bacteria | 4962 | Open in IMG/M |
3300018433|Ga0066667_10302179 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300018469|Ga0190270_10137266 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
3300018476|Ga0190274_10001836 | All Organisms → cellular organisms → Bacteria | 12452 | Open in IMG/M |
3300018481|Ga0190271_12643305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300018482|Ga0066669_10500737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
3300018482|Ga0066669_10762182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300018482|Ga0066669_12091152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
3300019257|Ga0180115_1322210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1138 | Open in IMG/M |
3300019356|Ga0173481_10057393 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300019360|Ga0187894_10095183 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
3300019360|Ga0187894_10224600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
3300019362|Ga0173479_10119361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1008 | Open in IMG/M |
3300019487|Ga0187893_10940399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300019880|Ga0193712_1005605 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
3300020579|Ga0210407_10873087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300021080|Ga0210382_10358468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300021168|Ga0210406_10062212 | All Organisms → cellular organisms → Bacteria | 3234 | Open in IMG/M |
3300021168|Ga0210406_11327504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300021403|Ga0210397_10538566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
3300021444|Ga0213878_10198379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300021560|Ga0126371_10180624 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
3300022227|Ga0187827_10515857 | Not Available | 714 | Open in IMG/M |
3300022563|Ga0212128_10040738 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
3300022563|Ga0212128_10954667 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300022726|Ga0242654_10200239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Photobacterium → Photobacterium lipolyticum | 694 | Open in IMG/M |
3300024254|Ga0247661_1039292 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300025310|Ga0209172_10003921 | All Organisms → cellular organisms → Bacteria | 21380 | Open in IMG/M |
3300025315|Ga0207697_10246148 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300025325|Ga0209341_10665361 | Not Available | 807 | Open in IMG/M |
3300025903|Ga0207680_10006995 | All Organisms → cellular organisms → Bacteria | 5475 | Open in IMG/M |
3300025903|Ga0207680_10265744 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300025907|Ga0207645_10681954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
3300025908|Ga0207643_10493651 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300025912|Ga0207707_10487165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
3300025918|Ga0207662_10033746 | All Organisms → cellular organisms → Bacteria | 2985 | Open in IMG/M |
3300025921|Ga0207652_11372326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300025922|Ga0207646_11935370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300025925|Ga0207650_10208456 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
3300025926|Ga0207659_10732116 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300025927|Ga0207687_10751421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
3300025930|Ga0207701_11176857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300025931|Ga0207644_10768759 | Not Available | 805 | Open in IMG/M |
3300025931|Ga0207644_11522445 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300025934|Ga0207686_11555803 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300025936|Ga0207670_11405055 | Not Available | 593 | Open in IMG/M |
3300025941|Ga0207711_11147780 | Not Available | 718 | Open in IMG/M |
3300025941|Ga0207711_11452696 | Not Available | 629 | Open in IMG/M |
3300025951|Ga0210066_1026654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
3300025961|Ga0207712_11297891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300025972|Ga0207668_11416801 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300025986|Ga0207658_12099307 | Not Available | 514 | Open in IMG/M |
3300026035|Ga0207703_10021410 | All Organisms → cellular organisms → Bacteria | 5062 | Open in IMG/M |
3300026035|Ga0207703_10104103 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
3300026296|Ga0209235_1039151 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
3300026297|Ga0209237_1062534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1795 | Open in IMG/M |
3300026313|Ga0209761_1291057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300026325|Ga0209152_10234985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300026327|Ga0209266_1196309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
3300026536|Ga0209058_1145430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1126 | Open in IMG/M |
3300026550|Ga0209474_10116672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1776 | Open in IMG/M |
3300027513|Ga0208685_1018681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1583 | Open in IMG/M |
3300027773|Ga0209810_1140740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
3300027815|Ga0209726_10182128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
(restricted) 3300027837|Ga0255041_10292451 | Not Available | 588 | Open in IMG/M |
3300027873|Ga0209814_10074260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
3300027874|Ga0209465_10215073 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300027876|Ga0209974_10210173 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300027880|Ga0209481_10461303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300027882|Ga0209590_10374158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
3300027907|Ga0207428_10162108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1697 | Open in IMG/M |
3300027907|Ga0207428_10212345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1454 | Open in IMG/M |
3300027909|Ga0209382_10035876 | All Organisms → cellular organisms → Bacteria | 5961 | Open in IMG/M |
3300027909|Ga0209382_10201933 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
3300027909|Ga0209382_10219473 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
3300027909|Ga0209382_11521337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300027965|Ga0209062_1076591 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300028146|Ga0247682_1064671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300028381|Ga0268264_10173578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1952 | Open in IMG/M |
3300030606|Ga0299906_10054698 | All Organisms → cellular organisms → Bacteria | 3184 | Open in IMG/M |
3300031057|Ga0170834_110497285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
3300031231|Ga0170824_106533714 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300031538|Ga0310888_10030899 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
3300031562|Ga0310886_10967209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300031573|Ga0310915_10993141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300031646|Ga0302133_10463139 | Not Available | 564 | Open in IMG/M |
3300031716|Ga0310813_10764179 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300031716|Ga0310813_10888042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300031716|Ga0310813_11059037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300031716|Ga0310813_11140965 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300031719|Ga0306917_10845061 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300031802|Ga0310123_10354797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 953 | Open in IMG/M |
3300031803|Ga0310120_10318218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
3300031847|Ga0310907_10320505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300031908|Ga0310900_10866582 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300031908|Ga0310900_11118521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300031908|Ga0310900_11196832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
3300031910|Ga0306923_11225748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
3300031944|Ga0310884_10869700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300031947|Ga0310909_11685889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300031954|Ga0306926_12817611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300031965|Ga0326597_10045954 | All Organisms → cellular organisms → Bacteria | 5487 | Open in IMG/M |
3300031965|Ga0326597_11184618 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300031965|Ga0326597_11670741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300032000|Ga0310903_10292843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300032001|Ga0306922_11255002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300032122|Ga0310895_10378264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
3300032144|Ga0315910_10878428 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300032144|Ga0315910_11471414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300032157|Ga0315912_10064067 | All Organisms → cellular organisms → Bacteria | 2894 | Open in IMG/M |
3300032157|Ga0315912_10124015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2024 | Open in IMG/M |
3300032261|Ga0306920_101186765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
3300032261|Ga0306920_102280238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300032261|Ga0306920_102300650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300032278|Ga0310345_10780065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
3300032820|Ga0310342_100889791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
3300032892|Ga0335081_11244298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
3300033433|Ga0326726_10714727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
3300034671|Ga0314796_099687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300034673|Ga0314798_154058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300034819|Ga0373958_0073833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.04% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.13% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.90% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.46% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.46% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.46% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.01% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.56% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.56% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.34% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.12% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.12% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.12% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.89% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.89% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.67% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.67% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.67% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.67% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.67% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.67% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.45% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.45% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.22% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.22% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.22% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.22% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.22% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.22% |
Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 0.22% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.22% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.22% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.22% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.22% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.22% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.22% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.22% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.22% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.22% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.22% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.22% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.22% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.22% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.22% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007619 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009102 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300012122 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT200_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025951 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031646 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_02452570 | 2199352025 | Soil | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSDD |
ICChiseqgaiiFebDRAFT_140860162 | 3300000363 | Soil | MKCDICTDDNGLGIHYHAFIEGKHHWVCEICKKKLKIEAEHMDD* |
INPhiseqgaiiFebDRAFT_1017641195 | 3300000364 | Soil | MKCDLCTEDDGNGIHYHAFIDGKHHWVCESCKKKLKIETEHVDD* |
INPhiseqgaiiFebDRAFT_1017653802 | 3300000364 | Soil | MKCDLCPEDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD* |
INPhiseqgaiiFebDRAFT_1017654259 | 3300000364 | Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCESCKKKLKIETEHIDD* |
INPhiseqgaiiFebDRAFT_1042216442 | 3300000364 | Soil | MKCEVCTDDNGLGIHYHAFIEGKHHWVCEACKKKLKIETEHVDD* |
AF_2010_repII_A01DRAFT_10578293 | 3300000580 | Forest Soil | MKCDLCTEDDGNGIHYHAFIEGKHHWVCELCKKKLKIETEH |
JGI1027J11758_129790154 | 3300000789 | Soil | MKCDLCTEDDGQGIHYHTFIDGKHHWVCESCKKKLKIETEHIDD* |
JGI10214J12806_125236352 | 3300000891 | Soil | GTAAMKCDICATDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE* |
F14TB_1066475263 | 3300001431 | Soil | MKCEICTTDDGDGIHYHAFIDGKHHWVCEACKAKLKVEAEHTDE* |
C687J26631_100422292 | 3300002124 | Soil | MKCDVCTTDTGDGIHYHAFIDGKHHWVCEACKKKLKADSEHMDD* |
JGI25385J37094_100193292 | 3300002558 | Grasslands Soil | MKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
JGI25383J37093_100447161 | 3300002560 | Grasslands Soil | MKCDLCPDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD* |
JGI25382J43887_102161092 | 3300002908 | Grasslands Soil | MQCDLCTEDDGAGIHYHAFIEGKHHWVCETCKKKLKIDAEHVDE* |
JGI25390J43892_101248222 | 3300002911 | Grasslands Soil | MKCDLCTEDDGDGIHYHAFIEGKHHWVCESCKKKLKIEAEHVDE* |
soilL1_100401235 | 3300003267 | Sugarcane Root And Bulk Soil | MKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD* |
soilH2_100030493 | 3300003324 | Sugarcane Root And Bulk Soil | MKCDLCPEDDGQGIHYHAFIEGKHHWVCEACKKKLRIEAEHIDD* |
soilH2_101508182 | 3300003324 | Sugarcane Root And Bulk Soil | MKCDICTTDNGEGIHYHAFIEGKHHWVCEACKMKLRVETDHTDE* |
soilH2_102775462 | 3300003324 | Sugarcane Root And Bulk Soil | MKCDLCTEDDGKGIHYHAFIDGKHHWVCEVCKKKLKVETEHVDD* |
soilH2_103413485 | 3300003324 | Sugarcane Root And Bulk Soil | MKCDLCTDDDGKGIHFHAFLDGKHLWVCEACKKKLKIEAEHVDD* |
P52013CM_10520523 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | MKCDTCTTDDGEGIHYHAFIEGKHHWVCEACKMKFKVEAEHTDD* |
PicMicro_100169403 | 3300003702 | Marine, Hydrothermal Vent Plume | MVGMQCDLCTEDDGKGIHYHAFIDGKHYWVCASCKKKHKVESEHTDE* |
Ga0055437_103035992 | 3300004009 | Natural And Restored Wetlands | MKCDLCTTDDGKGIHYHAFIDGKHHWVCESCKKKLKIESEHHDE* |
Ga0055499_100335312 | 3300004047 | Natural And Restored Wetlands | MTAMKCDLCTEDDGNGIHYHAFIEGKHRWVCESCKKKLKVETEHTDE* |
Ga0062593_1008689162 | 3300004114 | Soil | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHSDE* |
Ga0062593_1015260601 | 3300004114 | Soil | MKCDICTDDDGLGIHYHAFIEGKHHWVCEACKKKLKIEAEHMDD* |
Ga0062589_1001443121 | 3300004156 | Soil | MKCDICANDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE* |
Ga0062589_1001924553 | 3300004156 | Soil | MKCDICTTDDGEGIHYHAFIEGKHHWVCENCKAKLKVEAEHTDE* |
Ga0062590_1021310472 | 3300004157 | Soil | MKCDLCPDDDGKGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0062590_1021370962 | 3300004157 | Soil | MKCDICTEDDGKGIHYHAFIDGKHHWVCEACKKKLKVETEHVDD* |
Ga0062590_1023934592 | 3300004157 | Soil | MKCDICVTDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE* |
Ga0063356_1000187856 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDICTTDNGEGIHYHAFIEGKHHWVCETCKMKLRVETEHTDE* |
Ga0063356_1000598485 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDLCTDDDGKGIHYHAFIEGKHHWVCESCKKKLKIEAEHTDE* |
Ga0063356_1000611552 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDICTTDNGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDE* |
Ga0063356_1002396233 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDLCTTDNGEGIHYHAFIDGKHHWVCDSCKTKLKVETEHTDE* |
Ga0063356_1005345703 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDLCPDDDGRGIHYHAFIDGKHHWVCESCKKKMKIEAEHMDD* |
Ga0063356_1006835062 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDICTTDDGEGIHFHAFIEGKHHWVCESCKMKLKVEAEHTDE* |
Ga0063356_1011017963 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDLCTTDDGEGIHYHAFIEGKHHWVCQACKTKLKIETEHTDE* |
Ga0063356_1017093551 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDLCTEDDGRGIHYHAFIEGKHHWVCESCKKKLKIEADHTDE* |
Ga0063356_1031718442 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDVCTTDTGEGIHYHAFIEGKHRWVCESCKAKLRVEAEHTDE* |
Ga0063356_1061588771 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCDLCTTDDGKGIHYHAFIEGKHHWVCESCKKKLKIEAEHTDE* |
Ga0062592_1006778922 | 3300004480 | Soil | MKCDICATDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE* |
Ga0062592_1024820562 | 3300004480 | Soil | RNSNHKYGNIACVMKCDLCPDDDGKGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0066395_101030253 | 3300004633 | Tropical Forest Soil | MKCDLCTEDDGNGIHYHAFIEGKHHWVCELCKKKLKIETEHVDD* |
Ga0066395_107275112 | 3300004633 | Tropical Forest Soil | MKCDLCPDDDGKGIHYHAFIEGKHHWVCDSCKKKLKIETEHSDD* |
Ga0062591_1010167532 | 3300004643 | Soil | GRMKCDICVTDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE* |
Ga0058859_100031012 | 3300004798 | Host-Associated | MKCEICTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDD* |
Ga0058861_100103432 | 3300004800 | Host-Associated | MKCDLCPEDDGHGIHYHAFIEGKHHWVCEACKKKLRIEAEHIDD* |
Ga0058860_100505191 | 3300004801 | Host-Associated | MKCEICTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDE* |
Ga0062594_1027303272 | 3300005093 | Soil | MKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLKIEAEHVDD* |
Ga0066674_100659452 | 3300005166 | Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCETCKKKLKVETEHTDE* |
Ga0066674_103096282 | 3300005166 | Soil | MTCDLCTEDDGKGIHYHAFIDGKHHWVCEPCKKKLKVETEHVDD* |
Ga0066683_103591282 | 3300005172 | Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCETCKKKLKIETEHTDE* |
Ga0066683_106314782 | 3300005172 | Soil | MTCDLCTQDDGQGIHYHAFIDGKHRWVCESCKKKLKIESEHTDE* |
Ga0066673_104096172 | 3300005175 | Soil | MKCDLCTDDDGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHIDD* |
Ga0066684_106422941 | 3300005179 | Soil | QVKCDLCTEDNGLGIHYHAFIDGKHHWVCESCKKKLKIETEHTDD* |
Ga0066685_102242993 | 3300005180 | Soil | MTCDLCTQDDGQGIHYHAFIDGKHRWVCESCKKKLKIETEHTDE* |
Ga0066685_106509581 | 3300005180 | Soil | MKCDLCTEDDGAGIHYHAFIEGKHHWVCESCKKKLKIEAEHVDE* |
Ga0065715_101808713 | 3300005293 | Miscanthus Rhizosphere | MKCDICTDDDGLGIHYHAFIEGKHHWVCEACKKKLKIEAE |
Ga0065715_104371481 | 3300005293 | Miscanthus Rhizosphere | MKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSDD* |
Ga0070690_1011561332 | 3300005330 | Switchgrass Rhizosphere | MMKCDLCTSDDGKGIHYHAFIEGKHHWVCETCKKNLRIEAEHSDD* |
Ga0070690_1013716832 | 3300005330 | Switchgrass Rhizosphere | MKCDLCADDDGKGIHYHAFIEGKHHWVCEACKKKLKDEAEHTDD* |
Ga0070670_1000167679 | 3300005331 | Switchgrass Rhizosphere | MKCEMCTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDE* |
Ga0070670_1009778292 | 3300005331 | Switchgrass Rhizosphere | MKCDVCPDDDGKGIHYHAFIDGKHHWVCESCKQKLKVESEHSDE* |
Ga0070670_1011243822 | 3300005331 | Switchgrass Rhizosphere | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSDD* |
Ga0066388_1000547792 | 3300005332 | Tropical Forest Soil | MKCDLCTEDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD* |
Ga0066388_1002202445 | 3300005332 | Tropical Forest Soil | MKCDLCTTDNGEGIHYHAFIEGKHHWVCETCKTKLKVETEHTDE* |
Ga0066388_1002342374 | 3300005332 | Tropical Forest Soil | MKCDLCTEDDGNGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0066388_1004878244 | 3300005332 | Tropical Forest Soil | MKCDLCTEDDGQGIHYHAFIEGKHHWVCESCKKKLKVETEHTDE* |
Ga0066388_1008991822 | 3300005332 | Tropical Forest Soil | MKCDLCTDDDGRGIHYHAFIEGKHHWVCEACKKKLKVEAEHTDE* |
Ga0066388_1023941232 | 3300005332 | Tropical Forest Soil | MKCDICPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD* |
Ga0066388_1028187932 | 3300005332 | Tropical Forest Soil | MKCDICTTDNGEGIHYHAFIDGKHHWVCEGCKMKLKVEAEHTDE* |
Ga0066388_1049648332 | 3300005332 | Tropical Forest Soil | MKCDLCTEDDGHGIHYHAFIDGKHHWVCEACKGKLKIETEHMDD* |
Ga0066388_1051780692 | 3300005332 | Tropical Forest Soil | MTCDLCTDDKGNGIHYHAFIDGKHHWVCESCKKKLKIETEHVDD* |
Ga0066388_1052735783 | 3300005332 | Tropical Forest Soil | MKCDLCPDDDGSGIHYHAFIDGKHHWVCESCKKKLRIETEHTDD* |
Ga0066388_1059550203 | 3300005332 | Tropical Forest Soil | MKCDLCTEDDGKGIHYHAFIDGKHHWVCEPCKKKLKIEAEHTDE* |
Ga0066388_1064504992 | 3300005332 | Tropical Forest Soil | MKCDICTTDNGEGIHYHAFIEGKHHWVCEGCKTKLKIEAEHTDE* |
Ga0066388_1067383112 | 3300005332 | Tropical Forest Soil | MTCDLCTEDDGKGIHYHAFINGKHHWVCESCKKKLKIEAEHVDD* |
Ga0066388_1069811121 | 3300005332 | Tropical Forest Soil | MKCDLCKDDDGKGIHYHAFIEGKHHWVCEVCKKKLKIEAEHMDD* |
Ga0066388_1070558801 | 3300005332 | Tropical Forest Soil | MTCDLCSDDDGKGIHYHAFIEGKHHWVCETCKKKLKIEAEHTDD* |
Ga0068868_1016557611 | 3300005338 | Miscanthus Rhizosphere | MKCDICTTDDGEGIHYHAFIEGEHHWVCENCKAKLKVEAEHTDE* |
Ga0070689_1003438422 | 3300005340 | Switchgrass Rhizosphere | MMKCDLCTSDDGKGIHYHAFIEGKHHWVCESCKKNLRIEAEHSDD* |
Ga0070671_1013305492 | 3300005355 | Switchgrass Rhizosphere | MMKCDLCTGDDGNGIHYHAFIEGKHHWVCEACKKNLRIEAEHSDD* |
Ga0070688_1003347661 | 3300005365 | Switchgrass Rhizosphere | MKCEICTTDDGEGIHYHAFIEGKHHWVCEACKTKLKVEAEHTDE* |
Ga0070688_1014348901 | 3300005365 | Switchgrass Rhizosphere | MMKCDLCTSDDGKGIHYHAFIEGKHHWVCEACKKNLRIEAEHSDD* |
Ga0066686_104214502 | 3300005446 | Soil | MKCDLCPDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD* |
Ga0066686_106192432 | 3300005446 | Soil | MKCDLCTEDDGCGIHYHAFIDGKHHWVCEPCKKKLKVQAEHTDER* |
Ga0066686_109254371 | 3300005446 | Soil | MKCDLCTEDNGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD* |
Ga0066689_101197611 | 3300005447 | Soil | CPDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD* |
Ga0066682_101284962 | 3300005450 | Soil | LGSMKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
Ga0066681_102742882 | 3300005451 | Soil | MKCDLCTEDDGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHIDD* |
Ga0066687_108041012 | 3300005454 | Soil | MKCDVCTTDDGEGIHYHAFIEGKHRWVCEPCKKKLKVETEHTDD* |
Ga0070678_1003469363 | 3300005456 | Miscanthus Rhizosphere | MKCDLCTDDDGTGIHYHAFIDGKHHWVCETCKKKLKIEAEHSDD* |
Ga0068867_1013468021 | 3300005459 | Miscanthus Rhizosphere | MKCDLCTEDDAKGIHYHAFIDGKHRWVCESCKKKLRVETEHNDD* |
Ga0070685_112723032 | 3300005466 | Switchgrass Rhizosphere | MKCDICTTDNGEGIHYHAFIEGKHHWVCETCKMKLRVETEHTDD* |
Ga0070699_1013579972 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCDLCTEDNGEGIHYHAFIDGKHHWVCESCKKKLKIETEHVDD* |
Ga0070741_111614992 | 3300005529 | Surface Soil | MKCDLCPDDDGKGIHYHAFVDGKHHWVCESCKKKLKVETEHMDD* |
Ga0070679_1015796872 | 3300005530 | Corn Rhizosphere | MKCDLCTEDDGQGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD* |
Ga0070739_101416523 | 3300005532 | Surface Soil | MKCDLCTNDNGQGIHYHAFIEGKHHWVCEECKKTLKVESEHMDD* |
Ga0066697_102989372 | 3300005540 | Soil | VGPTLIIMKCDLCTEDNGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD* |
Ga0070672_1014375791 | 3300005543 | Miscanthus Rhizosphere | MMKCDLCTSDDGKGIHYHAFIEGKHHWVCEACKKNLRIEAEHSD |
Ga0070686_1006342992 | 3300005544 | Switchgrass Rhizosphere | MTCDLCTEDDGQGIHYHAFIDGKHHWVCEPCKKKLKIESEHMDD* |
Ga0070686_1009704462 | 3300005544 | Switchgrass Rhizosphere | MKCDLCADDDGKGIHYHAFIEGKHHWVCEACKKKLKVEAEHTDD* |
Ga0070686_1011874872 | 3300005544 | Switchgrass Rhizosphere | MKCDLCPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD* |
Ga0066701_102974871 | 3300005552 | Soil | DDGEGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
Ga0066701_107053262 | 3300005552 | Soil | MKCDLCTEDNGEGIHYHAFIEGKHHWVCESCKKKLKIEAEHVDE* |
Ga0066701_107275421 | 3300005552 | Soil | LCPEDNGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHIDD* |
Ga0066695_100645182 | 3300005553 | Soil | MKCDLCPEDDGRGIHYHAFIDGKHNWVCESCKKKLKVEAEHSDD* |
Ga0066692_107016771 | 3300005555 | Soil | MKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLKVE |
Ga0066704_103840391 | 3300005557 | Soil | ETGTGITINLGSMKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
Ga0066698_108844861 | 3300005558 | Soil | IAVKCGSMKCDLCTEDDGAGIHYHAFIEGKHYWVCESCKKKLKIEAEHVDE* |
Ga0066670_102011413 | 3300005560 | Soil | MKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLKVEAEHV |
Ga0066708_108574231 | 3300005576 | Soil | TVGRPVGPTLIIMKCDLCTEDNGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD* |
Ga0066706_106370192 | 3300005598 | Soil | MKCDLCTDDDGKGIHYHAFIEGKHHWVCEPCKKKLKIEAEHTDE* |
Ga0070763_108056341 | 3300005610 | Soil | MKCDLCTTDDGQGIHYHAFIEGKHHWVCEPCKKKLKVETEHTDD* |
Ga0068859_1008764261 | 3300005617 | Switchgrass Rhizosphere | RIVTKARAEVKPVRIHVMMKCDLCTSDDGKGIHYHAFIEGKHHWVCEACKKNLRIEAEHSDD* |
Ga0066905_1019083422 | 3300005713 | Tropical Forest Soil | MSEVKSFDMKCDLCSDDDGKGIHYHAFIEGKHHWVCETCKKKLKIEAEHTDD* |
Ga0066903_1043998862 | 3300005764 | Tropical Forest Soil | MKCDICPDDDGKGIHYHAFIDGKHNWVCESCKKKLKIEAEHMDD* |
Ga0066903_1054570742 | 3300005764 | Tropical Forest Soil | MKCDLCPDDDGKGIHYHAFIDGKHHWVCESCKKKLRIEAEHMDD* |
Ga0066903_1061031791 | 3300005764 | Tropical Forest Soil | MKCDLCAEDDGQGIHYHAFVDGKHHWVCEKCKGKLKIEAEHMDD* |
Ga0066903_1064077162 | 3300005764 | Tropical Forest Soil | MVYSNMKCDVCTNDDGQGIHYHAFIDGKHHWVCEECKKKLKIEAEHMDD* |
Ga0066903_1068206072 | 3300005764 | Tropical Forest Soil | MKCDVCTEDDGQGIHYHAFIDGKHRWVCEACKKKLKIEAEHMD |
Ga0074479_108511333 | 3300005829 | Sediment (Intertidal) | MPSMKCEVCTTDDGKGIHYHAFIDGKHHWVCEACKKKLKIESEHMDD* |
Ga0074470_100339092 | 3300005836 | Sediment (Intertidal) | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHSDD* |
Ga0074470_102305312 | 3300005836 | Sediment (Intertidal) | MKCDVCTTDDGNGIHYHAFIDGKHHWVCEACKKKMKIEAEHMDD* |
Ga0074470_104106762 | 3300005836 | Sediment (Intertidal) | MKCDVCPDDDGKGIHYHAFIEGKHHWVCEACKKKLKVESEHSDD* |
Ga0074470_104823771 | 3300005836 | Sediment (Intertidal) | ARIRCMMKCDLCTADDGTGIHYHAFIEGKHHWICEACKKTLKIDSEHSDD* |
Ga0074470_105810951 | 3300005836 | Sediment (Intertidal) | NGDGIHYHAFIDGKHRWVCEACKKKLKLEAEHMDD* |
Ga0074470_111791371 | 3300005836 | Sediment (Intertidal) | ECSSMKCDLCTTDDGKGIHYHAFIDGKHHWVCESCKKKLKIESEHHDE* |
Ga0068858_1001202585 | 3300005842 | Switchgrass Rhizosphere | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKK |
Ga0081455_110190571 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKCDLCTEDDGKGIHYHAFIDGKHHWVCESCKKKLKIETEHIDD* |
Ga0066656_104124802 | 3300006034 | Soil | MKCDLCTEDDGCGIHYHAFIDGKHHWVCEPCKKKLKVEAEHTDE* |
Ga0066652_1017469492 | 3300006046 | Soil | MKCDLCADDDGKGIHYHAFIEGKHHWVCETCKKKLKIEAEHTDE* |
Ga0097621_1002572421 | 3300006237 | Miscanthus Rhizosphere | MKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEH |
Ga0097621_1021503601 | 3300006237 | Miscanthus Rhizosphere | MKCDLCTDDDGTGIHYHAFIEGKHHWVCESCKKKLKIETEHSDD* |
Ga0068871_1012003962 | 3300006358 | Miscanthus Rhizosphere | MKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSD |
Ga0075037_16594992 | 3300006426 | Permafrost Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCEPCKKKLKVETEHTDD* |
Ga0066653_107759901 | 3300006791 | Soil | MKCDLCTEDDGDGIHYHAFIEGKNHWVCESCKKKLKIEAEHVDE |
Ga0066658_102011102 | 3300006794 | Soil | MKCDLCTEDNGEGIHYHAFIDGKHHWVCEPCKKKLKIETEHVDD* |
Ga0066665_101817203 | 3300006796 | Soil | CDLCPDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD* |
Ga0066665_115921672 | 3300006796 | Soil | DLCPDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD* |
Ga0066659_100724973 | 3300006797 | Soil | MKGDVCTEDAGEGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
Ga0066659_103090343 | 3300006797 | Soil | MWGAGGPDINNMKCDLCTEDNGEGIHYHAFIDGKHHWVCEPCKKKLKIETEHVDD* |
Ga0066659_107714521 | 3300006797 | Soil | DLCPDDDAQGIHYHAFIDGKHYWVCETCKKKLKIESEHMDD* |
Ga0066660_111488821 | 3300006800 | Soil | MKCDLCTDDDGQGIHYHAFIDGKHRWVCEPCKKKLKVETEHVDD* |
Ga0079221_109350271 | 3300006804 | Agricultural Soil | DAHQRESTNSRPAGGPDVNNMKCDLCTEDDGQGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD* |
Ga0075428_1002192691 | 3300006844 | Populus Rhizosphere | EDDGNGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0075428_1003361463 | 3300006844 | Populus Rhizosphere | MKCDLCTDDDGKGIHYHAFIDGKHHWVCESCKKKLRVETEHVDD* |
Ga0075428_1020031472 | 3300006844 | Populus Rhizosphere | MKCDICANDNGEGIHYHAFIEGKHHWVCEGCKTKLKVEAEHTDE* |
Ga0075421_1001088033 | 3300006845 | Populus Rhizosphere | MKCDLCTDDNGKGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0075421_1001864893 | 3300006845 | Populus Rhizosphere | MKCDICTDDDGLGIHYHAFIEGKHHWVCEPCKKKLKIEAEHMDD* |
Ga0075421_1013651181 | 3300006845 | Populus Rhizosphere | EDDGNGIHYHAFIDGKHHWVCESCKKKLKIETEHVDD* |
Ga0075421_1017028701 | 3300006845 | Populus Rhizosphere | MKCDICTDDDGLGIHYHAFIEGKHHWVCETCKKKLKIEAEHMDD* |
Ga0075431_1014422332 | 3300006847 | Populus Rhizosphere | MKCDICTDDDGLGIHYHAFIEGKHHWVCETCKKRLKIEAEHMDD* |
Ga0075431_1020763932 | 3300006847 | Populus Rhizosphere | DDGKGIHYHAFIDGKHHWVCESCKKKLRVETEHVDD* |
Ga0075433_100604335 | 3300006852 | Populus Rhizosphere | MKCDLCTDDDGKGIHYHAFIEGKHRWVCESCKKKLKIEAEHTDE* |
Ga0075433_103221763 | 3300006852 | Populus Rhizosphere | MKCDLCTDDDGKGIHYHAFIEGKHHWVCETCKKKLKIETEHIDD* |
Ga0075420_1003963142 | 3300006853 | Populus Rhizosphere | MKCDLCKEDDGNGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0075425_1012582343 | 3300006854 | Populus Rhizosphere | GKGIHYHAFIDGKHHWVCEPCKKKLKVESEHMDD* |
Ga0075425_1030323131 | 3300006854 | Populus Rhizosphere | GKGIHYHAFIDGKHHWVCETCKKKLKIEAEHVDD* |
Ga0073934_1000147516 | 3300006865 | Hot Spring Sediment | MKCDLCVEDDGQGIHYHAFIDGKHHWVCESCKKKLKVEAEHTDE* |
Ga0073934_103864172 | 3300006865 | Hot Spring Sediment | MKCDLCAEDDGQGIHYHAFIEGKHHWVCETCKKKLKVEAEHMDD* |
Ga0075429_1004338021 | 3300006880 | Populus Rhizosphere | LQSIESRPMKCDICTTDDGEGIHYHAFIEGKHHWVCENCKAKLKVEAEHTDE* |
Ga0068865_1018465691 | 3300006881 | Miscanthus Rhizosphere | MKCDICTTDDGEGIHYHAFIEGKHHWVCENCKAKLKVEA |
Ga0079215_108824472 | 3300006894 | Agricultural Soil | MKCDICTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDE* |
Ga0075436_1013084541 | 3300006914 | Populus Rhizosphere | TQVMKCDLCPEDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD* |
Ga0079218_100782005 | 3300007004 | Agricultural Soil | MKCEICTTDDGEGIHYHAFIDGKHHWVCEACKAKLKVEAEHTDE* |
Ga0079218_119119101 | 3300007004 | Agricultural Soil | MKCDVCTTDDGKGIHYHAFIEGKHHWVCEPCKKKLKIEA |
Ga0079218_140110032 | 3300007004 | Agricultural Soil | MKCDLCTDDNGQGIHYHAFIDGKHHWVCEPCKKKLKIETEHTDD* |
Ga0075435_1008079632 | 3300007076 | Populus Rhizosphere | MKCDLCTDDDGKGIHYHAFIEGRHHWVCETCKKKLKIEAEHTDD* |
Ga0099791_104192182 | 3300007255 | Vadose Zone Soil | MKCDLCTEDNGEGIHYHAFLDGKHHWVCESCKKKLKIETEHVDD* |
Ga0102947_10629262 | 3300007619 | Soil | MKCDLCTDDDGKGIHYHAFIDGKHYWVCEKCKRERNLDSEHTDE* |
Ga0066710_1006436212 | 3300009012 | Grasslands Soil | MTCDLCTQDDGQGIHYHAFIDGKHRWVCESCKKKLKIETEHTDE |
Ga0066710_1007673731 | 3300009012 | Grasslands Soil | MKCDLCTEDNGEGMHYQAFIDGKHHWVCESCKKKLKIETEHVDDSRGLN |
Ga0066710_1008052212 | 3300009012 | Grasslands Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCEACKKKLKVETEHTDE |
Ga0066710_1009020233 | 3300009012 | Grasslands Soil | MKCDLCTEDDGTGIHYHAFVDGKHHWVCENCKKRLKIETEHVD |
Ga0066710_1013614052 | 3300009012 | Grasslands Soil | MKCDLCTEDDGCGIHYHAFIDGKHHWVCEPCKKKLKVEAEHTDE |
Ga0066710_1028834622 | 3300009012 | Grasslands Soil | MKCDLCTDDHGKGIHYHAFIEGKHHWVCESCKKKLKIEAEHTDE |
Ga0099828_102790122 | 3300009089 | Vadose Zone Soil | MKCDLCTEDNGEGIHYHAFIDGKHHWVCEACKKKLKIETEHVDD* |
Ga0099827_105929382 | 3300009090 | Vadose Zone Soil | MKCDLCTEDNGEGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD* |
Ga0111539_1000114916 | 3300009094 | Populus Rhizosphere | MKCDICTTDDGEGIHFHAFIEGKHHWVCESCKKKLKVEAEHTDE* |
Ga0111539_103350243 | 3300009094 | Populus Rhizosphere | MKCDLCTSDDGVGIHYHAFIDGKHHWVCETCKTKLKVEAEHTDE* |
Ga0111539_110374872 | 3300009094 | Populus Rhizosphere | MKCDVCTDDNGAGIHYHAFIEGKHHWVCESCKKKLKIEAEHMDD* |
Ga0111539_114198933 | 3300009094 | Populus Rhizosphere | MKCDLCTEDDGNGIHYHAFIDGKHHWVCESCKKKLKVETE |
Ga0111539_128803001 | 3300009094 | Populus Rhizosphere | MKCDLCTTDDGEGIHYHAFIDGKHHWICETCKTKLKVEAEHTDE* |
Ga0079224_1042953462 | 3300009095 | Agricultural Soil | MRCDLCTDDNGQGIHYHAFIDGKHYWVCEACKKRLKVESEHIDE* |
Ga0114948_116509292 | 3300009102 | Deep Subsurface | MAGMKCDLCTDDDGKGIHYHAFIDGKHYWVCASCKKKHKIESEHSDE* |
Ga0066709_1007148902 | 3300009137 | Grasslands Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCEACKKKLKVETEHTDE* |
Ga0099792_100019754 | 3300009143 | Vadose Zone Soil | MKCDLCTTDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSDD* |
Ga0114129_104500042 | 3300009147 | Populus Rhizosphere | MKCDLCTEDDGKGIHYHAFIDGKHHWVCEPCKKKLKIETEHIDD* |
Ga0111538_101151871 | 3300009156 | Populus Rhizosphere | MKCDICTEDDGKGIHYHAFIDGKHHWVCEACKKKLKVET |
Ga0105092_108393342 | 3300009157 | Freshwater Sediment | DICTTDDGEGIHFHAFIEGKHHWVCESCKKKLKVEAEHTDE* |
Ga0075423_102084791 | 3300009162 | Populus Rhizosphere | DLCTEDDGKGIHYHAFIDGKHHWVCETCKKKLKIEAEHVDD* |
Ga0075423_105185471 | 3300009162 | Populus Rhizosphere | MKCEICRTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDD* |
Ga0075423_108442722 | 3300009162 | Populus Rhizosphere | MKCDLCTEDNGEGIHYHAFIDGKHHWVCESCKKKLKIE |
Ga0075423_116620762 | 3300009162 | Populus Rhizosphere | MRCDLCTEDDGLGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD* |
Ga0114996_103158162 | 3300009173 | Marine | MKCDLCKDDDGKGAHYHAFIEGKHYWICGPCKERLKIESEHTDE* |
Ga0105242_109582992 | 3300009176 | Miscanthus Rhizosphere | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCESCKKKLKIETEHSDD* |
Ga0105242_121934791 | 3300009176 | Miscanthus Rhizosphere | MKCDVCTTDTGDGIHFHAFIEGKHHWVCEACKKKLKIETEHMDD* |
Ga0103857_100527422 | 3300009235 | River Water | MKCDLCTTDDGKGMHYHAFIDGKHHWVCESCKKNLKVEAEHTDE* |
Ga0114945_100947061 | 3300009444 | Thermal Springs | CVEDDGQGIHYHAFIDGKHHWVCEACKKKLKVEAEHTDE* |
Ga0114945_102675663 | 3300009444 | Thermal Springs | MKCDLCVEDDGQGIHYHAFIDGKHHWVCEACKKKLKV |
Ga0114945_103364012 | 3300009444 | Thermal Springs | MKCDLCTEDDGKGIHYHAFIDGKHRWVCESCKKKLKIEAEHTDE* |
Ga0114945_106611581 | 3300009444 | Thermal Springs | MMKCDLCTEDDGESIHYHAFIEGKHYWVCENCKKKLKVDAEHVDE* |
Ga0105347_10657912 | 3300009609 | Soil | MKCDLCTEDDGKGIHYHAFIDGKHHWVCEPCKKKLRIEAEHMDD* |
Ga0105252_100258153 | 3300009678 | Soil | MKCDLCTDDNGQGIHYHAFIEGKHHWVCESCKKKLKIESEHMDD* |
Ga0105252_101119792 | 3300009678 | Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCEPCKKKLRIEAEHMDD* |
Ga0105164_101364672 | 3300009777 | Wastewater | MKCDLCTEDDGKGIHYHAFIEGKHHWVCEPCKKKLKIDAEHTDE* |
Ga0126374_118171532 | 3300009792 | Tropical Forest Soil | MKCDLCADDDGKGIHYHAFIESKHHWVCEACKKKLKVEAEHTDE* |
Ga0126380_105127752 | 3300010043 | Tropical Forest Soil | MKCDVCTEDDGKGIHYHAFIDGKHRWVCESCKKKLKVETEHVDD* |
Ga0126380_107005562 | 3300010043 | Tropical Forest Soil | MKCDLCVEDDGQGIHYHAFVDGKHHWVCEKCKGKLKIEAEHMDD* |
Ga0126384_115774491 | 3300010046 | Tropical Forest Soil | MKCDVCTEDDGKGIHYHAFIEGKHCWVCESCKKNLKVEAEHVDD |
Ga0126382_100146326 | 3300010047 | Tropical Forest Soil | MKCDVCTEDDGKGIHYHAFIEGKHCWVCESCKKNLKVEAEHVDD* |
Ga0127503_102234261 | 3300010154 | Soil | VRSLPARLHARLYARRRNLEIDMKCDICTDDDGLGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD* |
Ga0134088_104562172 | 3300010304 | Grasslands Soil | MKCDLCTEDDGCGIHYHAFIDGKHHWVCETCKKKLKVEAEHTDE* |
Ga0134071_100409853 | 3300010336 | Grasslands Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCETCKKKLKVEAEHTDE* |
Ga0126370_117923991 | 3300010358 | Tropical Forest Soil | MKCDLCTEDDGRGIHYHAFIEGKHHWVCEACKKKLKIETEHTDD* |
Ga0126370_120225132 | 3300010358 | Tropical Forest Soil | MKCDLCTEDNGQGIHYHAFIEGKHHWVCEACKKKLKIETEHIDD* |
Ga0126370_120593511 | 3300010358 | Tropical Forest Soil | MHVKIASMKCDLCTEDDGQGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD* |
Ga0126376_122990332 | 3300010359 | Tropical Forest Soil | MKCDLCTDDDGLGIHYHAFIEGKHHWVCETCKKKLKIEAEHMDD* |
Ga0126376_128133751 | 3300010359 | Tropical Forest Soil | MKCDLCSDDDGKGIHYHAFIEGKHHWVCEACKKKLKIEAEHTDE* |
Ga0126378_126058341 | 3300010361 | Tropical Forest Soil | CPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD* |
Ga0126377_102629844 | 3300010362 | Tropical Forest Soil | MKCDICPDDDGKGIHYHAFIDGKHNWVCESCKKKL |
Ga0126377_110378703 | 3300010362 | Tropical Forest Soil | DGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD* |
Ga0126379_101436433 | 3300010366 | Tropical Forest Soil | MKCDLCTEDDGQGIHYHAFIEGKHHWVCESCKKKLKIETEHIDD* |
Ga0126379_112390213 | 3300010366 | Tropical Forest Soil | MKCDLCADDNGQEIHYHAFIEGKHHWVCEACKKKLKIETEHIDD* |
Ga0126379_133788661 | 3300010366 | Tropical Forest Soil | CDLCADDNGQGIHYHAFIEGKHHWVCEACKKKLKIEAEHIDD* |
Ga0134128_130290562 | 3300010373 | Terrestrial Soil | MKCDLCTEDNGEGIHYHAFIDGKHHWVCEPCKKKLK |
Ga0126381_1026096483 | 3300010376 | Tropical Forest Soil | MKCDLCTEDDGNGIHYHAFIEGKHHWVCELCKKKLKIETE |
Ga0126381_1044509331 | 3300010376 | Tropical Forest Soil | MKCDLCTQDDGQGIHYHAFVDGKHHWVCEECKKKLKIESEHMDD* |
Ga0136847_127067392 | 3300010391 | Freshwater Sediment | MKCDLCTEDDGKGIHYHAFIEGKHRWVCEPCKKKLKIEAEHTDE* |
Ga0134124_117878762 | 3300010397 | Terrestrial Soil | MKRDLCPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD* |
Ga0126383_114892742 | 3300010398 | Tropical Forest Soil | MKCDICIEDDGQGIHYHAFVDGKHHWVCEECKKKLKIEAEHMDD* |
Ga0134127_116233492 | 3300010399 | Terrestrial Soil | MKCDVCTTDDGEGIHFHAFIDGKHHWVCEACKKKLKIEAEHMDD* |
Ga0134127_120605771 | 3300010399 | Terrestrial Soil | MKCDICPDDDGLGIHYHAFIDGKHHWVCETCKKKLKVETEHIDD* |
Ga0134127_134731212 | 3300010399 | Terrestrial Soil | MKCDLCTEDDGKGIHYHAFIDGKHHWVCETCKKKLKIEAEHVDD* |
Ga0134122_1000042911 | 3300010400 | Terrestrial Soil | MMKCDLCTDDDGKGIHYHAFIDGKHQWVCEACKKKLKIDSEHSDD* |
Ga0134121_100010973 | 3300010401 | Terrestrial Soil | MKCDVCTTDTGDGIHYHAFIEGKHHWVCEACKKKLKIETEHMDD* |
Ga0134121_102935794 | 3300010401 | Terrestrial Soil | VKCDLCPEDDGQGIHYYAFIEGKHHWVCETCKKKLKIETEHNDD* |
Ga0134121_127509912 | 3300010401 | Terrestrial Soil | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCDSCKKKLKIEAEHV |
Ga0134121_130886282 | 3300010401 | Terrestrial Soil | MKCDVCTTDTGDGIHFHAFIEGKHHWVCEACKKKLKLEAEHMDD* |
Ga0134123_123075352 | 3300010403 | Terrestrial Soil | MKCDICTDDDGKGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0134123_131861401 | 3300010403 | Terrestrial Soil | MMKCDLCTSDDGKGIHYHAFIEGKHHWVCESCKKNL |
Ga0133547_100158698 | 3300010883 | Marine | MVRMKCDLCTQDDGRGTHYHAFIDGKHYWVCEACKKKHKVESEHTDE* |
Ga0105246_109761432 | 3300011119 | Miscanthus Rhizosphere | MKCDLCTEDDGKGIHYHAFIDGKHRWVCETCKRKLGVETEHNDD* |
Ga0105246_122090572 | 3300011119 | Miscanthus Rhizosphere | MKCDICTTDKGEGIHYHAFIEGKHHWVCETCKMKLRVETEH |
Ga0137392_108341502 | 3300011269 | Vadose Zone Soil | MKCDICTEDDGEGIHYHAFIDGKHHWVCESCKKKLKIETEHVDD* |
Ga0127502_110639602 | 3300011333 | Soil | MKCDVCTTDDGEGIHYHAFIDGKHHWVCEACKKKLKVEAEHTD |
Ga0137451_12261191 | 3300011438 | Soil | MMKCDLCTDDDGKGIHFHAFIDGKHHWVCEACKKKLKIEAEHSDD* |
Ga0137332_10109642 | 3300012122 | Soil | MKCDLCTDDNGQGIHYHALIEGKHHWVCESCKKKLKIESEHMDD* |
Ga0137382_109700932 | 3300012200 | Vadose Zone Soil | MKCDLCPDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHSDE* |
Ga0137365_110335861 | 3300012201 | Vadose Zone Soil | MKCDLCTQDDGQGIHYHAFIDGKHHWVCETSKKKLKVETEHTDER |
Ga0137399_103666572 | 3300012203 | Vadose Zone Soil | MKCDLCTEDNGEGIHYHAFIDGKHRWVCESCKKKLKIETEHVDE* |
Ga0137362_108489232 | 3300012205 | Vadose Zone Soil | MKCDLCTEDNGEGIHYHAFLDGKHHWVCESCKKRLKIETEHVDD* |
Ga0137381_100788793 | 3300012207 | Vadose Zone Soil | MTCDLCTEDDGQGIHYHAFIDGKHRWVCESCKKKLKIETEHTDE* |
Ga0137381_114240362 | 3300012207 | Vadose Zone Soil | MKCDLCIDDDGKGIHYHAFIDGKHRWVCEPCKKKLKIETEHTDD* |
Ga0137376_112306451 | 3300012208 | Vadose Zone Soil | MKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLKV |
Ga0137377_102766142 | 3300012211 | Vadose Zone Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWICETCKKKLKVETEHTDE* |
Ga0150985_1017206942 | 3300012212 | Avena Fatua Rhizosphere | MKCDICPDDDGQGIHYHAFIEGKHHWVCEPCKKKLKVETEHIDD* |
Ga0150985_1052917402 | 3300012212 | Avena Fatua Rhizosphere | MMKCDLCTDDNGKGIHYHAFIDGKHHWVCESCKKKLKIETEHSDE* |
Ga0150985_1067968912 | 3300012212 | Avena Fatua Rhizosphere | MKCDVCTDDDGNGIHYHAFIDGKHHWVCESCKKKLKIDAEHVDD* |
Ga0150985_1146701202 | 3300012212 | Avena Fatua Rhizosphere | MKCDLCPDDDGNGIHYHAFIDGKHHWVCEVCKKKLKVETEHTDE* |
Ga0137465_11564283 | 3300012231 | Soil | DDGQGIHYHAFIDGKHHWVCETCKKKLKIESEHMDD* |
Ga0137371_102396082 | 3300012356 | Vadose Zone Soil | MKCDLCTQDDGQGIHYHAFIDGKHHWVCETCKKKLKIETEHTDE* |
Ga0137371_108765842 | 3300012356 | Vadose Zone Soil | MTCDLCTQDDGQGIHYHAFIDGKHRWVCESCKKKLKIETE |
Ga0137385_100028048 | 3300012359 | Vadose Zone Soil | MKCDVCTEDDGEGIHYHAFIEGKHYWVCETCKKNLKVEAEHVDD* |
Ga0134042_11604492 | 3300012373 | Grasslands Soil | GEGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
Ga0134049_12374722 | 3300012403 | Grasslands Soil | MKCDVCSEDDGEGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
Ga0134053_13425002 | 3300012406 | Grasslands Soil | MKCDLCPDDDGKGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
Ga0150984_1161731691 | 3300012469 | Avena Fatua Rhizosphere | DDGKGIHYHAFIDGKHHWVCESCKKKLKIETEHSDE* |
Ga0150984_1174888953 | 3300012469 | Avena Fatua Rhizosphere | MKCDLCPDDDGKGIHYHAFLEGKHHWVCESCKKKLKIEAEHTDE* |
Ga0150984_1222390572 | 3300012469 | Avena Fatua Rhizosphere | ARRRDLRTIHMKCDVCADDNGQGIHYHAFIDGKHRWVCESCKKKLKIETEHIDD* |
Ga0150984_1227899762 | 3300012469 | Avena Fatua Rhizosphere | MKCDLCTEDDGEGIHYHAFIEGKHHWVCEPCKKKLKIETEHTDD* |
Ga0137397_100000075 | 3300012685 | Vadose Zone Soil | MKCDLCPEDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD* |
Ga0157295_104106971 | 3300012906 | Soil | IKPARIPCMMKCDVCTDDDGKGIHYHAFIEGKHHWVCEACKKKLKIETEHSDD* |
Ga0157286_101658232 | 3300012908 | Soil | ICATDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE* |
Ga0137394_100004973 | 3300012922 | Vadose Zone Soil | VKCDLCTEDNGEGIHYHAFIDGKHHWVCESCKKKLKIETEHVDE* |
Ga0137394_107214842 | 3300012922 | Vadose Zone Soil | MKCDLCPDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHTDD* |
Ga0137404_104343892 | 3300012929 | Vadose Zone Soil | MKCDLCPDDNGKGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD* |
Ga0137410_102345962 | 3300012944 | Vadose Zone Soil | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSDE* |
Ga0126375_114069752 | 3300012948 | Tropical Forest Soil | MRCDLCTEDDGLGIHYHAFIDGKHHWVCESCKKKLKIETEHIDD* |
Ga0164303_114587812 | 3300012957 | Soil | MKCDICTDDNGQGIHYHAFIEGKHHWVCETCKKKLKVETEHIDD* |
Ga0126369_100393083 | 3300012971 | Tropical Forest Soil | MRCDICTTDNGEGIHYHAFIEGRHHWVCESCKMKLKVETEHTDE* |
Ga0126369_109361802 | 3300012971 | Tropical Forest Soil | MKCDLCTEDNGQGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD* |
Ga0134077_100600183 | 3300012972 | Grasslands Soil | MKCDLCTEDDGAGIHYHAFIEGKHHWVCESCKKKLKIEAEHV |
Ga0134087_101815541 | 3300012977 | Grasslands Soil | MKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLKVEAEH |
Ga0164308_119363942 | 3300012985 | Soil | MKCDLCTEDNGQGIHYHAFIDGKHHWVCEACKKKLKIETEHIDA* |
Ga0157378_118601452 | 3300013297 | Miscanthus Rhizosphere | MKCDLCTEDDGKGIHYHAFIDGKHRWVCEPCKKKLKVETEHVDD* |
Ga0163162_103336102 | 3300013306 | Switchgrass Rhizosphere | MMKCDLCTSDDGKGIHYHAFIEGKHHWVCEACKKSLRIEAEHSDD* |
Ga0157375_105737423 | 3300013308 | Miscanthus Rhizosphere | MPSMMKCDLCTSDDGKGIHYHAFIEGKHHWVCEACKKNLRIEAEHSDD* |
Ga0157375_107876763 | 3300013308 | Miscanthus Rhizosphere | NPFMMKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHSDE* |
Ga0157375_114202442 | 3300013308 | Miscanthus Rhizosphere | DNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE* |
Ga0134075_100237562 | 3300014154 | Grasslands Soil | MKCDVCTEDDGKGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD* |
Ga0075301_11643032 | 3300014262 | Natural And Restored Wetlands | MKCDLCTEDDGNGIHYHAFIEGKHRWVCETCKKKLKVETEHTDE* |
Ga0157380_127654692 | 3300014326 | Switchgrass Rhizosphere | MKCEICTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEH |
Ga0132258_100061613 | 3300015371 | Arabidopsis Rhizosphere | MKCDLCTDDDGKGIHYHAFVEGKHHWVCESCKKKLKIEAEHIDD* |
Ga0132258_100143578 | 3300015371 | Arabidopsis Rhizosphere | MKCDICTEDDGKGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0132258_1002182511 | 3300015371 | Arabidopsis Rhizosphere | MKCDLCPDDDGKGIHYHAFIDGKHHWVCESCKKKLRIEAEHVDD* |
Ga0132258_1002738513 | 3300015371 | Arabidopsis Rhizosphere | MKCDLCADDDGKGIHYHAFIEGKHHWVCEACKKKLKIEAEHTDE* |
Ga0132258_104128781 | 3300015371 | Arabidopsis Rhizosphere | STAIRSLSMKCDLCTEDNGEGIHYHAFIEGKHHWVCEFCKKKLKIETEHVDD* |
Ga0132258_125108623 | 3300015371 | Arabidopsis Rhizosphere | MTCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLKIEAEHVDD* |
Ga0132258_132653382 | 3300015371 | Arabidopsis Rhizosphere | MKCDLCTEDNGQGIHYHAFIEGKHHWVCEAYKKKLKIEAEHMDD* |
Ga0132258_137692481 | 3300015371 | Arabidopsis Rhizosphere | LIFVSEVKSFIMKCDLCSDDDGKGIHYHAFIEGKHHWVCETCKKKLRIEAEHTDD* |
Ga0132256_1005571512 | 3300015372 | Arabidopsis Rhizosphere | MKCDLCPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD* |
Ga0132256_1019992201 | 3300015372 | Arabidopsis Rhizosphere | DDDGKGIHYHAFIDGKHHWVCEACKKKLKIEAEHTDE* |
Ga0132256_1035378932 | 3300015372 | Arabidopsis Rhizosphere | RIAFVMKCDLCTEDDGKGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD* |
Ga0132257_1020040592 | 3300015373 | Arabidopsis Rhizosphere | MKCDLCTEDNGQGIHYHAFIEGKHHWVCEACKKKLKIEAEHMDD* |
Ga0132255_1005682602 | 3300015374 | Arabidopsis Rhizosphere | MKCDICTTDNGEGIHYHAFIDGKHHWVCEGCKTKLKVEAEHTDE* |
Ga0132255_1011938151 | 3300015374 | Arabidopsis Rhizosphere | TDDDGKGIHYHAFIDGKHHWVCETCKKKLKIEAEHVDD* |
Ga0132255_1051537272 | 3300015374 | Arabidopsis Rhizosphere | MKCDLCTEDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHTDE* |
Ga0132255_1063502392 | 3300015374 | Arabidopsis Rhizosphere | DGEGIHYHAFIEGKHHWVCEACKMKFKVEAEHTDD* |
Ga0182036_104588153 | 3300016270 | Soil | MQARQGEASNNMKCDLCTEDDGKGIHYHAFIEGKHHWVCESCKKKLKIETEHIDD |
Ga0182041_108503142 | 3300016294 | Soil | MQARQGEASNNMKCDLCTEDDGKGIHYHAFIDGKHHWVCESCKKKLKIETEHIDD |
Ga0182041_114299432 | 3300016294 | Soil | MKCDLCPDDDGKGIHYHAFIEGKHHWVCDSCKKKLKIETEHSDD |
Ga0182033_109972321 | 3300016319 | Soil | MKCDLCTEDNGEGVHYHAFIDGKHHWVCEACKKKLK |
Ga0182038_101868633 | 3300016445 | Soil | MKCDLCTEDKGEGIHYHAFIDGKHHWVCEACKKKLKIETEHVDD |
Ga0134112_100162304 | 3300017656 | Grasslands Soil | MKRDLCTEDDGAGIHYHAFIEGKHHWVCESCKKKLKIEAEHVDE |
Ga0163161_119688192 | 3300017792 | Switchgrass Rhizosphere | MKCEICTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDE |
Ga0184634_102721802 | 3300018031 | Groundwater Sediment | MKCDLCTEDDGKGIHYHAFIEGKHHWVCEPCKKKLKIEAEHTDE |
Ga0187773_108195642 | 3300018064 | Tropical Peatland | HRQSKLEFLSMKCDLCTDDDGAGIHYHAFIEGKHRWVCETCKKKLKVEAEHTDE |
Ga0184618_100428043 | 3300018071 | Groundwater Sediment | MKCDLCIDDDGKGIHYHAFIDGKHRWVCEPCKKKLKIETEHTDD |
Ga0184639_105174952 | 3300018082 | Groundwater Sediment | SSVGYGEGGKIGFMKCDLCTEDDGKGIHYHAFIEGKHHWVCEPCKKKLKIEAEHTDE |
Ga0184628_100068922 | 3300018083 | Groundwater Sediment | MMKCDVCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSDD |
Ga0184628_100748191 | 3300018083 | Groundwater Sediment | LMSEVKSFIMKCDLCTDDDGKGIHYHAFIEGKHHWVCESCKKKLKIDAEHTDD |
Ga0190265_135476322 | 3300018422 | Soil | MKCDLCVEDDGKGIHYHAFIEGKHHWVCEPCKKKLRVETEHTDE |
Ga0066655_102394852 | 3300018431 | Grasslands Soil | MKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLKVEAEHVDD |
Ga0066655_105939131 | 3300018431 | Grasslands Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCETCKKKLKVETEHTDE |
Ga0066667_100076022 | 3300018433 | Grasslands Soil | MKCDLCTEDDGDGIHYHAFIEGKHHWVCESCKKKLKIEAEHVDE |
Ga0066667_103021792 | 3300018433 | Grasslands Soil | MKCDLCPDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD |
Ga0190270_101372664 | 3300018469 | Soil | MKCEICTTDDGEGIHYHAFIDGKHHWVCEACKAKLKVEAEHTDE |
Ga0190274_100018363 | 3300018476 | Soil | MKCDVCTTDTGDGIHFHAFIDGKHHWVCEACKKSLKIEAEHMDD |
Ga0190271_126433051 | 3300018481 | Soil | MKCDICTTDNGEGIHYHAFIEGKHHWVCEACKAKLKVEAEH |
Ga0066669_105007372 | 3300018482 | Grasslands Soil | MKCDLCTDDDGKGIHYHAFIEGKHHWVCEPCKKKLKIEAEHTDE |
Ga0066669_107621822 | 3300018482 | Grasslands Soil | MKCDLCTEDDGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHIDD |
Ga0066669_120911521 | 3300018482 | Grasslands Soil | MKCDLCIEDNGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDE |
Ga0180115_13222102 | 3300019257 | Groundwater Sediment | CTDDDGKGIHYHAFIEGKHRWVCESCKKKLKIEAEHTDD |
Ga0173481_100573932 | 3300019356 | Soil | MKCDICATDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE |
Ga0187894_100951832 | 3300019360 | Microbial Mat On Rocks | MKCDLCTDDDGLGIHYHAFIEGKHHWVCESCKKKLKIESEHMDD |
Ga0187894_102246002 | 3300019360 | Microbial Mat On Rocks | MKCDLCTEDTGSGIHYHAFVDGKHYWVCENCKKRLKIEIDHTDE |
Ga0173479_101193612 | 3300019362 | Soil | MMKCDVCTDDDGKGIHYHAFIEGKHHWVCEACKKKLKIETEHSDD |
Ga0187893_109403992 | 3300019487 | Microbial Mat On Rocks | MKCDICPDDDGQGIHYHAFIEGKHHWVCENCKKKLKIESEHLDD |
Ga0193712_10056052 | 3300019880 | Soil | MKCDLCTTDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSDD |
Ga0210407_108730872 | 3300020579 | Soil | PEDDGKGIHYHAFIDGKHHRVCELCKKKLKIESEHNDE |
Ga0210382_103584682 | 3300021080 | Groundwater Sediment | MKCDLCIDDDGKGIHYHAFIDGKHRWVCEPCKKKLKIETEHTDE |
Ga0210406_100622122 | 3300021168 | Soil | MKCDLCTEDNGQGIHYHAFIDGKHHWICEACKKKLKIETEHIDD |
Ga0210406_113275042 | 3300021168 | Soil | MKCDICPDDDGKGIHYHAFIDGKHHWVCEPCKKKLKIEAEHMDD |
Ga0210397_105385662 | 3300021403 | Soil | MKCDICPDDDGKGIHYHAFIEGKHHWVCEPCKKKLKIEAEHMDD |
Ga0213878_101983791 | 3300021444 | Bulk Soil | MKCDLCTEDDGKGIHYHAFIEGKHHWVCESCKKKLKIETEHIDD |
Ga0126371_101806245 | 3300021560 | Tropical Forest Soil | MKCDICPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD |
Ga0187827_105158571 | 3300022227 | Seawater | SIIAAAMNCDYCSDDDGKGAHFHAFIEGKHYWVCASCKAKLKVDSEHNDE |
Ga0212128_100407383 | 3300022563 | Thermal Springs | MKCDLCVEDDGQGIHYHAFIDGKHHWVCEACKKKLKVEAEHTDE |
Ga0212128_109546672 | 3300022563 | Thermal Springs | MMKCDLCTEDDGESIHYHAFIEGKHHWVCEDCKKKLKVEAEHTDE |
Ga0242654_102002392 | 3300022726 | Soil | MKCDLCIEDDGQGIHYHAFVDGKHHWVCEECKKKLKIEAEHMDD |
Ga0247661_10392922 | 3300024254 | Soil | MKCDLCPEDDGKGIHYHAFIDGKHHWVCEPCKKKLKIEAEHMDD |
Ga0209172_100039215 | 3300025310 | Hot Spring Sediment | MKCDLCVEDDGQGIHYHAFIDGKHHWVCESCKKKLKVEAEHTDE |
Ga0207697_102461482 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCEICTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDD |
Ga0209341_106653611 | 3300025325 | Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCESCKKKLKIETEHTDE |
Ga0207680_100069955 | 3300025903 | Switchgrass Rhizosphere | MKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSDD |
Ga0207680_102657442 | 3300025903 | Switchgrass Rhizosphere | MKCDICTTDDGEGIHYHAFIEGKHHWVCENCKAKLKVEAEHTDE |
Ga0207645_106819541 | 3300025907 | Miscanthus Rhizosphere | MKCDICVTDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE |
Ga0207643_104936512 | 3300025908 | Miscanthus Rhizosphere | MKCDVCPDDDGKGIHYHAFIDGKHHWVCESCKQKLKVESEHSDE |
Ga0207707_104871653 | 3300025912 | Corn Rhizosphere | MKCDLCPEDDGQGIHYHAFIEGKHHWVCEACKKKLRIEAEHIDD |
Ga0207662_100337463 | 3300025918 | Switchgrass Rhizosphere | MKCDICTTDDGEGIHYHAFIEGKHHWVCENCKAKLKVEAEHTDD |
Ga0207652_113723261 | 3300025921 | Corn Rhizosphere | MKCDLCTEDDGQGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD |
Ga0207646_119353701 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VKCDLCPEDDGQGIHYHAFIDGKHHWVCEPCKKRLKIETEHNDD |
Ga0207650_102084562 | 3300025925 | Switchgrass Rhizosphere | MKCEMCTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDE |
Ga0207659_107321162 | 3300025926 | Miscanthus Rhizosphere | MKCDICTTDDGEGIHFHAFIEGKHHWVCESCKKKLKVEAEHTDE |
Ga0207687_107514212 | 3300025927 | Miscanthus Rhizosphere | MMKCDLCTDDDGKGIHYHAFIDGKHRWVCESCKRKLGVETEHNDD |
Ga0207701_111768571 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PVRIHVMMKCDLCTSDDGKGIHYHAFIEGKHHWVCETCKMKLRVETEHTDD |
Ga0207644_107687591 | 3300025931 | Switchgrass Rhizosphere | AKLSGMKCDLCTEDDGTGIHYHAFIDGKHHWVCETCKQKLKIEAEHSDD |
Ga0207644_115224452 | 3300025931 | Switchgrass Rhizosphere | MMKCDLCTGDDGNGIHYHAFIEGKHHWVCEACKKNLRIEAEHSDD |
Ga0207686_115558031 | 3300025934 | Miscanthus Rhizosphere | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCESCKKKLKIETEHSDD |
Ga0207670_114050552 | 3300025936 | Switchgrass Rhizosphere | MKCDTCTTDDGEGIHYHAFIEGKHHWVCEACKMKFKVEAEHTDD |
Ga0207711_111477802 | 3300025941 | Switchgrass Rhizosphere | IPSMMKCDLCTGDDGNGIHYHAFIEGKHHWVCEACKKNLRIEAEHSDD |
Ga0207711_114526961 | 3300025941 | Switchgrass Rhizosphere | MKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHS |
Ga0210066_10266541 | 3300025951 | Natural And Restored Wetlands | MKCDLCTEDDGKGAHYHAFIDGRHYWVCEACKKKHRIESEHTDE |
Ga0207712_112978912 | 3300025961 | Switchgrass Rhizosphere | MKCDLCTDDDGKGIHYHAFIEGKHHWVCESCKKKLKIEAEHTDE |
Ga0207668_114168012 | 3300025972 | Switchgrass Rhizosphere | MKCDICTTDDGEGIHYHAFIEGKHHWVCEACKAKLKVEAEHTDE |
Ga0207658_120993071 | 3300025986 | Switchgrass Rhizosphere | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHSDE |
Ga0207703_100214105 | 3300026035 | Switchgrass Rhizosphere | MKCEICTTDDGEGIHYHAFIEGKHRWVCEACKAKLKVEAEHTDD |
Ga0207703_101041031 | 3300026035 | Switchgrass Rhizosphere | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLK |
Ga0209235_10391512 | 3300026296 | Grasslands Soil | MKCDLCPDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD |
Ga0209237_10625344 | 3300026297 | Grasslands Soil | LGSMKCDVCTEDDGEGIHYHAFIEGKHYWVCESCKKNLQ |
Ga0209761_12910572 | 3300026313 | Grasslands Soil | SRRRTKSKLESRSMKCDLCPDDDGKGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD |
Ga0209152_102349852 | 3300026325 | Soil | MKCDLCTEDDGAGIHYHAFIEGKHHWVCESCKKKLKI |
Ga0209266_11963091 | 3300026327 | Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCETCKKKLKVETEH |
Ga0209058_11454303 | 3300026536 | Soil | MKCDLCTEDDGQGIHYHAFIDGKHHWVCETCKKKLKIETEHTDE |
Ga0209474_101166722 | 3300026550 | Soil | MKCDLCTEDNGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD |
Ga0208685_10186813 | 3300027513 | Soil | MKCDLCTEDDGKGIHYHAFIDGKHHWVCEPCKKKLRIEAEHMDD |
Ga0209810_11407402 | 3300027773 | Surface Soil | MKCDLCTNDNGQGIHYHAFIEGKHHWVCEECKKTLKVESEHMDD |
Ga0209726_101821282 | 3300027815 | Groundwater | MKCDVCIEDDGKGIHYHAFIDGKHRWVCEPCKKKLKVETEHTDE |
(restricted) Ga0255041_102924511 | 3300027837 | Seawater | MTCDLCSDDDGKGIHYHAFIEGKHYWVCAGCKARLKVESE |
Ga0209814_100742602 | 3300027873 | Populus Rhizosphere | MKCDLCTEDDGQGIHYHAFIDGKHHWVCESCKKKLKIETEHIDD |
Ga0209465_102150732 | 3300027874 | Tropical Forest Soil | MKCDLCPEDDGKGIHYHAFIDGKHHWVCESCKKKLKIETEHIDD |
Ga0209974_102101732 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MKCDICANDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE |
Ga0209481_104613032 | 3300027880 | Populus Rhizosphere | MKCDLCTEDDGQGIHYHAFIDGKHHWVCESCKKKLK |
Ga0209590_103741581 | 3300027882 | Vadose Zone Soil | MKCDLCTEDNGEGIHYHAFIDGKHHWVCETCKKKLKIETEHIDD |
Ga0207428_101621084 | 3300027907 | Populus Rhizosphere | MKCDICTTDDGEGIHYHAFIEGKHHWVCENCKAKLKVEAE |
Ga0207428_102123452 | 3300027907 | Populus Rhizosphere | MKCDICANDNGEGIHYHAFIEGKHHWVCEGCKTKLKVEAEHTDE |
Ga0209382_100358762 | 3300027909 | Populus Rhizosphere | MKCDLCTDDNGKGIHYHAFIDGKHHWVCESCKKKLKVETEHVDD |
Ga0209382_102019334 | 3300027909 | Populus Rhizosphere | TDDDGLGIHYHAFIEGKHHWVCEPCKKKLKIEAEHMDD |
Ga0209382_102194732 | 3300027909 | Populus Rhizosphere | MKCDLCTDDDGKGIHYHAFIDGKHHWVCESCKKKLRVETEHVDD |
Ga0209382_115213371 | 3300027909 | Populus Rhizosphere | MKCDICTDDDGLGIHYHAFIEGKHHWVCETCKKKLKIE |
Ga0209062_10765912 | 3300027965 | Surface Soil | MKCDLCPDDDGKGIHYHAFVDGKHHWVCESCKKKLKVETEHMDD |
Ga0247682_10646711 | 3300028146 | Soil | MKCDLCTEDDGQGIHYHAFIEGKHHWVCETCKKKLKIETEHIDD |
Ga0268264_101735782 | 3300028381 | Switchgrass Rhizosphere | MMKCDLCTSDDGKGIHYHAFIEGKHHWVCESCKKNLRIEAEHSDD |
Ga0299906_100546983 | 3300030606 | Soil | MRAMTCDLCADDDGKGIHYHAFIEGKHYWVCARCKARLRVETDHTDE |
Ga0170834_1104972852 | 3300031057 | Forest Soil | MKCDICPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIDAEHMDD |
Ga0170824_1065337142 | 3300031231 | Forest Soil | MKCDLCIEDNGKGIHYHAFIDGKHHWVCEVCKKKLSIDSEHMDD |
Ga0310888_100308995 | 3300031538 | Soil | MKCDTCVTDNGEGTHYHAFIEGKHHWVCEGCKTKLKVETEHTDE |
Ga0310886_109672091 | 3300031562 | Soil | CTEDDGQGIHYHAFIDGKHHWVCETCKKKLKIESEHMDD |
Ga0310915_109931411 | 3300031573 | Soil | DDGKGIHYHAFIEGKHHWVCESCKKKLKIETEHIDD |
Ga0302133_104631391 | 3300031646 | Marine | CDYCSDDDGKGAHYHAFIEGKHYWVCASCKAKLKVDSEHNDE |
Ga0310813_107641792 | 3300031716 | Soil | MKCDLCTDDDGKGIHYHAFIDGKHHWVCETCKKKLKIEAEHVDD |
Ga0310813_108880423 | 3300031716 | Soil | MKCDLCADDDGKGIHYHAFIDGKHHWVCEACKKKLKVETEHVDD |
Ga0310813_110590372 | 3300031716 | Soil | MKCDLCPDDDGKGIHYHAFIDGKHLWVCETCKKKLKVETEHVDD |
Ga0310813_111409652 | 3300031716 | Soil | MKCDICTDDNGLGIHYHAFIEGKHHWVCEICKKKLKIEAEHMDD |
Ga0306917_108450612 | 3300031719 | Soil | MKCDLCPEDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD |
Ga0310123_103547972 | 3300031802 | Marine | MTCDLCKDDDGKGAHYHAFIDGKHYWICGPCKERLNIESEHTDE |
Ga0310120_103182181 | 3300031803 | Marine | VIIAGIMRCDYCTDDDGKGAHYHAFIEGKHYWVCASCKAKLKVDSEHNDE |
Ga0310907_103205051 | 3300031847 | Soil | DQGRMKCDICVTDNGEGIHYHAFIEGKHRWVCEGCKTKLKVETEHTDE |
Ga0310900_108665822 | 3300031908 | Soil | MKCDICTEDDGKGIHYHAFIDGKHHWVCEACKKKLKVETEHVDD |
Ga0310900_111185212 | 3300031908 | Soil | DICATDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE |
Ga0310900_111968321 | 3300031908 | Soil | MKCDTCTTDDGEGIHYHAFIEGKHHWVCEACKMKFKADAEHTDD |
Ga0306923_112257481 | 3300031910 | Soil | MQARQGEASNNMKCDLCTEDDGKGIHYHAFIEGKHHWVCESCKK |
Ga0310884_108697002 | 3300031944 | Soil | QAMKCDICTTDDGEGIHYHAFIEGKHHWVCENCKAKLKVEAEHTDE |
Ga0310909_116858891 | 3300031947 | Soil | SAMKCDLCAEDNGQGIHYHAFIDGKHHWVCEACKKKLKIETEHIDD |
Ga0306926_128176112 | 3300031954 | Soil | MKCDICPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHTDD |
Ga0326597_100459543 | 3300031965 | Soil | MKCDLCTEDDGKGLHYHAFIDGRHYWVCESCKKKHKVESEHTDE |
Ga0326597_111846182 | 3300031965 | Soil | LGNRALMKCDLCTEDDGKGIHYHAFIDGKHHWVCDKCKKKLKVESEHMDD |
Ga0326597_116707412 | 3300031965 | Soil | MKCDLCTDDDGNGIHYHAFIDGKHHWVCEHCKKRLKVEAEHSDE |
Ga0310903_102928431 | 3300032000 | Soil | MCVTDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTDE |
Ga0306922_112550021 | 3300032001 | Soil | MKCDLCTEDDGKGIHYHAFIEGKHHWVCESCKKKLKIETEH |
Ga0310895_103782641 | 3300032122 | Soil | CTTDDGEGIHYHAFIEGKHHWVCENCKAKLKVEAEHTDE |
Ga0315910_108784282 | 3300032144 | Soil | MKCDVCTTDDGEGIHFHAFIDGKHHWVCEACKKRLKIEAEHMDD |
Ga0315910_114714141 | 3300032144 | Soil | PKATMKCDLCPDDTGDGIHYHAFIDGKHHWVCEACKKKLKIDAEHSDD |
Ga0315912_100640673 | 3300032157 | Soil | MMKCDVCTEDDGKGIHYHAFIEGKHHWVCETCKKKLKIETEHSDD |
Ga0315912_101240152 | 3300032157 | Soil | MMKCDVCTDDDGKGIHYHAFIDGKHHWVCESCKKKLKIETEHSDD |
Ga0306920_1011867653 | 3300032261 | Soil | MKCDLCTEDNGEGIHYHAFIDGKHHWVCEACKKKLKIETEHVDD |
Ga0306920_1022802382 | 3300032261 | Soil | MKCDLCTEDDGKGIHYHAFIDGKHHWVCESCKKKLKIETEHIDD |
Ga0306920_1023006502 | 3300032261 | Soil | MKCDLCTEDEGEGIHYHAFIDGKHHWVCESCKKKLKIEAEHVDD |
Ga0310345_107800651 | 3300032278 | Seawater | MTCDLCKDDDGKGTHYHAFIDGKHYWICAACKVRLKVESEHTDE |
Ga0310342_1008897911 | 3300032820 | Seawater | MTCDLCSNDDGKGAHYHAFIDGQHYWVCANCKSRLKIESEH |
Ga0335081_112442982 | 3300032892 | Soil | MKCDLCPDDDGRGIHYHAFIENKHHWVCESCKAKLKVEAEHSDD |
Ga0326726_107147272 | 3300033433 | Peat Soil | MMKCDLCTDDDGKGIHYHAFIDGKHHWVCEACKKKLKIETEHSD |
Ga0314796_099687_507_626 | 3300034671 | Soil | MKCDICATDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETE |
Ga0314798_154058_2_130 | 3300034673 | Soil | MKCDICVTDNGEGIHYHAFIEGKHHWVCEGCKTKLKVETEHTD |
Ga0373958_0073833_1_120 | 3300034819 | Rhizosphere Soil | CPDDDGKGIHYHAFIDGKHHWVCESCKKKLKIEAEHMDD |
⦗Top⦘ |