Basic Information | |
---|---|
Family ID | F004318 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 443 |
Average Sequence Length | 46 residues |
Representative Sequence | VLSKLRLSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIVEY |
Number of Associated Samples | 50 |
Number of Associated Scaffolds | 438 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 29.64 % |
% of genes near scaffold ends (potentially truncated) | 18.28 % |
% of genes from short scaffolds (< 2000 bps) | 31.38 % |
Associated GOLD sequencing projects | 49 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (52.370 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (73.815 % of family members) |
Environment Ontology (ENVO) | Unclassified (76.298 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (51.467 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 438 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 2.05 |
PF12796 | Ank_2 | 0.68 |
PF13843 | DDE_Tnp_1_7 | 0.68 |
PF07727 | RVT_2 | 0.68 |
PF06985 | HET | 0.68 |
PF12776 | Myb_DNA-bind_3 | 0.46 |
PF13374 | TPR_10 | 0.46 |
PF00400 | WD40 | 0.46 |
PF00083 | Sugar_tr | 0.46 |
PF05699 | Dimer_Tnp_hAT | 0.46 |
PF07992 | Pyr_redox_2 | 0.46 |
PF11374 | DUF3176 | 0.46 |
PF13424 | TPR_12 | 0.46 |
PF00106 | adh_short | 0.46 |
PF00075 | RNase_H | 0.46 |
PF09334 | tRNA-synt_1g | 0.23 |
PF01384 | PHO4 | 0.23 |
PF01019 | G_glu_transpept | 0.23 |
PF08625 | Utp13 | 0.23 |
PF11991 | Trp_DMAT | 0.23 |
PF13603 | tRNA-synt_1_2 | 0.23 |
PF03184 | DDE_1 | 0.23 |
PF03404 | Mo-co_dimer | 0.23 |
PF01634 | HisG | 0.23 |
PF02668 | TauD | 0.23 |
PF01571 | GCV_T | 0.23 |
PF04616 | Glyco_hydro_43 | 0.23 |
PF04083 | Abhydro_lipase | 0.23 |
PF13673 | Acetyltransf_10 | 0.23 |
PF05057 | DUF676 | 0.23 |
PF06172 | Cupin_5 | 0.23 |
PF03663 | Glyco_hydro_76 | 0.23 |
PF00368 | HMG-CoA_red | 0.23 |
PF01266 | DAO | 0.23 |
PF16335 | DUF4965 | 0.23 |
PF10607 | CTLH | 0.23 |
PF08544 | GHMP_kinases_C | 0.23 |
PF11917 | DUF3435 | 0.23 |
PF00271 | Helicase_C | 0.23 |
PF02969 | TAF | 0.23 |
PF13384 | HTH_23 | 0.23 |
PF02796 | HTH_7 | 0.23 |
PF10551 | MULE | 0.23 |
PF05970 | PIF1 | 0.23 |
PF01846 | FF | 0.23 |
PF14214 | Helitron_like_N | 0.23 |
PF00230 | MIP | 0.23 |
PF02179 | BAG | 0.23 |
PF01565 | FAD_binding_4 | 0.23 |
PF01067 | Calpain_III | 0.23 |
PF01757 | Acyl_transf_3 | 0.23 |
PF00498 | FHA | 0.23 |
PF08240 | ADH_N | 0.23 |
PF07690 | MFS_1 | 0.23 |
PF01391 | Collagen | 0.23 |
PF04146 | YTH | 0.23 |
PF13537 | GATase_7 | 0.23 |
PF00026 | Asp | 0.23 |
PF03641 | Lysine_decarbox | 0.23 |
PF09820 | AAA-ATPase_like | 0.23 |
PF09368 | Sas10 | 0.23 |
PF14617 | CMS1 | 0.23 |
PF02752 | Arrestin_C | 0.23 |
PF11715 | Nup160 | 0.23 |
PF00732 | GMC_oxred_N | 0.23 |
PF06201 | PITH | 0.23 |
PF12243 | CTK3 | 0.23 |
PF05729 | NACHT | 0.23 |
PF12550 | GCR1_C | 0.23 |
PF10494 | Stk19 | 0.23 |
PF00248 | Aldo_ket_red | 0.23 |
PF13551 | HTH_29 | 0.23 |
PF17100 | NACHT_N | 0.23 |
PF08539 | HbrB | 0.23 |
PF01238 | PMI_typeI_C | 0.23 |
PF00069 | Pkinase | 0.23 |
PF08386 | Abhydrolase_4 | 0.23 |
PF14529 | Exo_endo_phos_2 | 0.23 |
PF00782 | DSPc | 0.23 |
PF07366 | SnoaL | 0.23 |
COG ID | Name | Functional Category | % Frequency in 438 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 0.91 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.23 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.23 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0507 | ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.23 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.23 |
COG1257 | Hydroxymethylglutaryl-CoA reductase | Lipid transport and metabolism [I] | 0.23 |
COG1482 | Mannose-6-phosphate isomerase, class I | Carbohydrate transport and metabolism [G] | 0.23 |
COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.23 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.23 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.23 |
COG3542 | Predicted sugar epimerase, cupin superfamily | General function prediction only [R] | 0.23 |
COG4833 | Predicted alpha-1,6-mannanase, GH76 family | Carbohydrate transport and metabolism [G] | 0.23 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 0.23 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.79 % |
Unclassified | root | N/A | 42.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001661|JGI12053J15887_10313125 | Not Available | 765 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100510147 | Not Available | 1080 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101384492 | Not Available | 596 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101514499 | Not Available | 566 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101615457 | Not Available | 546 | Open in IMG/M |
3300007788|Ga0099795_10209683 | Not Available | 825 | Open in IMG/M |
3300010159|Ga0099796_10359356 | Not Available | 630 | Open in IMG/M |
3300010880|Ga0126350_10738455 | Not Available | 549 | Open in IMG/M |
3300012199|Ga0137383_11117866 | Not Available | 570 | Open in IMG/M |
3300012200|Ga0137382_10815330 | Not Available | 672 | Open in IMG/M |
3300012200|Ga0137382_11184939 | Not Available | 543 | Open in IMG/M |
3300012202|Ga0137363_11485801 | Not Available | 568 | Open in IMG/M |
3300012203|Ga0137399_11110175 | Not Available | 666 | Open in IMG/M |
3300012206|Ga0137380_10823099 | Not Available | 801 | Open in IMG/M |
3300012206|Ga0137380_10910393 | Not Available | 755 | Open in IMG/M |
3300012206|Ga0137380_11400727 | Not Available | 584 | Open in IMG/M |
3300012207|Ga0137381_11382948 | Not Available | 596 | Open in IMG/M |
3300012208|Ga0137376_11723569 | Not Available | 517 | Open in IMG/M |
3300012211|Ga0137377_11329402 | Not Available | 649 | Open in IMG/M |
3300012211|Ga0137377_11474497 | Not Available | 607 | Open in IMG/M |
3300012349|Ga0137387_11250167 | Not Available | 522 | Open in IMG/M |
3300012351|Ga0137386_10823011 | Not Available | 667 | Open in IMG/M |
3300012357|Ga0137384_10821474 | Not Available | 751 | Open in IMG/M |
3300012359|Ga0137385_11423107 | Not Available | 557 | Open in IMG/M |
3300012361|Ga0137360_10896093 | Not Available | 764 | Open in IMG/M |
3300012361|Ga0137360_11098437 | Not Available | 687 | Open in IMG/M |
3300012362|Ga0137361_11922363 | Not Available | 508 | Open in IMG/M |
3300012683|Ga0137398_10869379 | Not Available | 629 | Open in IMG/M |
3300012685|Ga0137397_11091301 | Not Available | 582 | Open in IMG/M |
3300012922|Ga0137394_11335864 | Not Available | 579 | Open in IMG/M |
3300012924|Ga0137413_10739301 | Not Available | 750 | Open in IMG/M |
3300012924|Ga0137413_10925039 | Not Available | 679 | Open in IMG/M |
3300012929|Ga0137404_11529281 | Not Available | 618 | Open in IMG/M |
3300012929|Ga0137404_12028827 | Not Available | 537 | Open in IMG/M |
3300012944|Ga0137410_11295405 | Not Available | 630 | Open in IMG/M |
3300015054|Ga0137420_1321204 | All Organisms → Viruses → Predicted Viral | 2722 | Open in IMG/M |
3300015054|Ga0137420_1498537 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 6425 | Open in IMG/M |
3300015241|Ga0137418_10769496 | Not Available | 727 | Open in IMG/M |
3300019888|Ga0193751_1167805 | Not Available | 770 | Open in IMG/M |
3300019890|Ga0193728_1003215 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Lecanoromycetes → OSLEUM clade → Umbilicariomycetidae → Umbilicariales → Umbilicariaceae → Lasallia → Lasallia pustulata | 8329 | Open in IMG/M |
3300019890|Ga0193728_1005156 | Not Available | 6627 | Open in IMG/M |
3300019890|Ga0193728_1009066 | Not Available | 5034 | Open in IMG/M |
3300019890|Ga0193728_1011978 | Not Available | 4365 | Open in IMG/M |
3300019890|Ga0193728_1017344 | All Organisms → Viruses → Predicted Viral | 3613 | Open in IMG/M |
3300019890|Ga0193728_1018612 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3489 | Open in IMG/M |
3300019890|Ga0193728_1020448 | All Organisms → Viruses → Predicted Viral | 3321 | Open in IMG/M |
3300019890|Ga0193728_1030133 | Not Available | 2699 | Open in IMG/M |
3300019890|Ga0193728_1030342 | Not Available | 2689 | Open in IMG/M |
3300019890|Ga0193728_1034864 | All Organisms → Viruses → Predicted Viral | 2491 | Open in IMG/M |
3300019890|Ga0193728_1037775 | All Organisms → Viruses → Predicted Viral | 2383 | Open in IMG/M |
3300019890|Ga0193728_1040831 | All Organisms → Viruses → Predicted Viral | 2281 | Open in IMG/M |
3300019890|Ga0193728_1063261 | All Organisms → Viruses → Predicted Viral | 1773 | Open in IMG/M |
3300019890|Ga0193728_1064114 | All Organisms → Viruses → Predicted Viral | 1759 | Open in IMG/M |
3300019890|Ga0193728_1066684 | All Organisms → Viruses → Predicted Viral | 1719 | Open in IMG/M |
3300019890|Ga0193728_1068469 | All Organisms → Viruses → Predicted Viral | 1692 | Open in IMG/M |
3300019890|Ga0193728_1068646 | All Organisms → Viruses → Predicted Viral | 1689 | Open in IMG/M |
3300019890|Ga0193728_1075828 | Not Available | 1591 | Open in IMG/M |
3300019890|Ga0193728_1076388 | Not Available | 1584 | Open in IMG/M |
3300019890|Ga0193728_1077653 | Not Available | 1567 | Open in IMG/M |
3300019890|Ga0193728_1078011 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Sordariales → Sordariaceae → Neurospora → Neurospora tetrasperma | 1563 | Open in IMG/M |
3300019890|Ga0193728_1082711 | Not Available | 1509 | Open in IMG/M |
3300019890|Ga0193728_1083949 | All Organisms → Viruses → Predicted Viral | 1495 | Open in IMG/M |
3300019890|Ga0193728_1084602 | Not Available | 1488 | Open in IMG/M |
3300019890|Ga0193728_1090553 | Not Available | 1427 | Open in IMG/M |
3300019890|Ga0193728_1099180 | All Organisms → Viruses → Predicted Viral | 1348 | Open in IMG/M |
3300019890|Ga0193728_1104550 | Not Available | 1304 | Open in IMG/M |
3300019890|Ga0193728_1106068 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
3300019890|Ga0193728_1108171 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
3300019890|Ga0193728_1109129 | Not Available | 1269 | Open in IMG/M |
3300019890|Ga0193728_1117426 | Not Available | 1209 | Open in IMG/M |
3300019890|Ga0193728_1117436 | Not Available | 1209 | Open in IMG/M |
3300019890|Ga0193728_1121100 | Not Available | 1185 | Open in IMG/M |
3300019890|Ga0193728_1128684 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
3300019890|Ga0193728_1130184 | Not Available | 1129 | Open in IMG/M |
3300019890|Ga0193728_1138633 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300019890|Ga0193728_1139232 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
3300019890|Ga0193728_1144990 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
3300019890|Ga0193728_1201375 | Not Available | 835 | Open in IMG/M |
3300019890|Ga0193728_1203734 | Not Available | 828 | Open in IMG/M |
3300019890|Ga0193728_1214658 | Not Available | 798 | Open in IMG/M |
3300019890|Ga0193728_1226038 | Not Available | 768 | Open in IMG/M |
3300019890|Ga0193728_1229315 | Not Available | 759 | Open in IMG/M |
3300019890|Ga0193728_1237828 | Not Available | 738 | Open in IMG/M |
3300019890|Ga0193728_1263188 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae → Lepidopterella → Lepidopterella palustris → Lepidopterella palustris CBS 459.81 | 681 | Open in IMG/M |
3300019890|Ga0193728_1355828 | Not Available | 523 | Open in IMG/M |
3300020582|Ga0210395_10963612 | Not Available | 633 | Open in IMG/M |
3300021086|Ga0179596_10496584 | Not Available | 619 | Open in IMG/M |
3300024330|Ga0137417_1510901 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
3300024347|Ga0179591_1088758 | Not Available | 3028 | Open in IMG/M |
3300024347|Ga0179591_1106528 | All Organisms → Viruses → Predicted Viral | 1718 | Open in IMG/M |
3300027164|Ga0208994_1012430 | Not Available | 1141 | Open in IMG/M |
3300027528|Ga0208985_1065897 | Not Available | 700 | Open in IMG/M |
3300027545|Ga0209008_1128799 | Not Available | 560 | Open in IMG/M |
3300027575|Ga0209525_1054356 | Not Available | 973 | Open in IMG/M |
3300027767|Ga0209655_10302112 | Not Available | 516 | Open in IMG/M |
3300027895|Ga0209624_11041950 | Not Available | 529 | Open in IMG/M |
3300027908|Ga0209006_10443474 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 1088 | Open in IMG/M |
3300027908|Ga0209006_10495310 | Not Available | 1019 | Open in IMG/M |
3300027908|Ga0209006_10599564 | Not Available | 910 | Open in IMG/M |
3300027908|Ga0209006_10616095 | Not Available | 895 | Open in IMG/M |
3300027908|Ga0209006_10764248 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae → Lepidopterella → Lepidopterella palustris → Lepidopterella palustris CBS 459.81 | 786 | Open in IMG/M |
3300027908|Ga0209006_10848760 | Not Available | 737 | Open in IMG/M |
3300027908|Ga0209006_10934800 | Not Available | 694 | Open in IMG/M |
3300027908|Ga0209006_11289056 | Not Available | 565 | Open in IMG/M |
3300027908|Ga0209006_11439275 | Not Available | 525 | Open in IMG/M |
3300027908|Ga0209006_11509482 | Not Available | 508 | Open in IMG/M |
3300027908|Ga0209006_11521144 | Not Available | 506 | Open in IMG/M |
3300027908|Ga0209006_11522565 | Not Available | 505 | Open in IMG/M |
3300028011|Ga0265344_102765 | Not Available | 566 | Open in IMG/M |
3300028794|Ga0307515_10001039 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Sordariales → Chaetomiaceae → Chaetomium → Chaetomium globosum → Chaetomium globosum CBS 148.51 | 63467 | Open in IMG/M |
3300028794|Ga0307515_10001612 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales | 50289 | Open in IMG/M |
3300028794|Ga0307515_10001687 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 49260 | Open in IMG/M |
3300028794|Ga0307515_10001778 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Bionectriaceae → Clonostachys → Clonostachys rosea | 48009 | Open in IMG/M |
3300028794|Ga0307515_10001792 | Not Available | 47885 | Open in IMG/M |
3300028794|Ga0307515_10001821 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 47550 | Open in IMG/M |
3300028794|Ga0307515_10001856 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 47066 | Open in IMG/M |
3300028794|Ga0307515_10002217 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 42655 | Open in IMG/M |
3300028794|Ga0307515_10003043 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 35535 | Open in IMG/M |
3300028794|Ga0307515_10003371 | Not Available | 33703 | Open in IMG/M |
3300028794|Ga0307515_10003371 | Not Available | 33703 | Open in IMG/M |
3300028794|Ga0307515_10003858 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Pyrenophora | 31323 | Open in IMG/M |
3300028794|Ga0307515_10004000 | Not Available | 30768 | Open in IMG/M |
3300028794|Ga0307515_10004680 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 28073 | Open in IMG/M |
3300028794|Ga0307515_10005511 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 25622 | Open in IMG/M |
3300028794|Ga0307515_10005800 | Not Available | 24931 | Open in IMG/M |
3300028794|Ga0307515_10006123 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 24189 | Open in IMG/M |
3300028794|Ga0307515_10006140 | Not Available | 24152 | Open in IMG/M |
3300028794|Ga0307515_10006184 | Not Available | 24044 | Open in IMG/M |
3300028794|Ga0307515_10006359 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes | 23646 | Open in IMG/M |
3300028794|Ga0307515_10006715 | Not Available | 22910 | Open in IMG/M |
3300028794|Ga0307515_10006802 | Not Available | 22745 | Open in IMG/M |
3300028794|Ga0307515_10006991 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 22412 | Open in IMG/M |
3300028794|Ga0307515_10007376 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 21753 | Open in IMG/M |
3300028794|Ga0307515_10007815 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 21036 | Open in IMG/M |
3300028794|Ga0307515_10008282 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila → Zopfia rhizophila CBS 207.26 | 20293 | Open in IMG/M |
3300028794|Ga0307515_10008547 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 19935 | Open in IMG/M |
3300028794|Ga0307515_10008655 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Zopfiaceae → Zopfia → Zopfia rhizophila → Zopfia rhizophila CBS 207.26 | 19803 | Open in IMG/M |
3300028794|Ga0307515_10009593 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 18695 | Open in IMG/M |
3300028794|Ga0307515_10009665 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 18603 | Open in IMG/M |
3300028794|Ga0307515_10009939 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 18315 | Open in IMG/M |
3300028794|Ga0307515_10010078 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 18174 | Open in IMG/M |
3300028794|Ga0307515_10010279 | Not Available | 17970 | Open in IMG/M |
3300028794|Ga0307515_10010996 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 17248 | Open in IMG/M |
3300028794|Ga0307515_10011307 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 16946 | Open in IMG/M |
3300028794|Ga0307515_10011405 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomataceae → Laccaria → Laccaria amethystina → Laccaria amethystina LaAM-08-1 | 16866 | Open in IMG/M |
3300028794|Ga0307515_10012122 | Not Available | 16258 | Open in IMG/M |
3300028794|Ga0307515_10012402 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Trypetheliales → Trypetheliaceae → Viridothelium → Viridothelium virens | 16032 | Open in IMG/M |
3300028794|Ga0307515_10013410 | Not Available | 15325 | Open in IMG/M |
3300028794|Ga0307515_10013675 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Xylariomycetidae → Xylariales → Pseudomassariaceae → Pseudomassariella → Pseudomassariella vexata | 15125 | Open in IMG/M |
3300028794|Ga0307515_10014289 | Not Available | 14741 | Open in IMG/M |
3300028794|Ga0307515_10014345 | Not Available | 14705 | Open in IMG/M |
3300028794|Ga0307515_10014409 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 14660 | Open in IMG/M |
3300028794|Ga0307515_10014555 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 14565 | Open in IMG/M |
3300028794|Ga0307515_10014718 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 14475 | Open in IMG/M |
3300028794|Ga0307515_10014722 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Cryomyces → Cryomyces minteri | 14473 | Open in IMG/M |
3300028794|Ga0307515_10015255 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → Eurotiomycetes → Chaetothyriomycetidae → Chaetothyriales → Herpotrichiellaceae → Rhinocladiella → Rhinocladiella mackenziei → Rhinocladiella mackenziei CBS 650.93 | 14170 | Open in IMG/M |
3300028794|Ga0307515_10016080 | Not Available | 13728 | Open in IMG/M |
3300028794|Ga0307515_10017615 | Not Available | 12994 | Open in IMG/M |
3300028794|Ga0307515_10018768 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 12487 | Open in IMG/M |
3300028794|Ga0307515_10018802 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 12476 | Open in IMG/M |
3300028794|Ga0307515_10019064 | Not Available | 12376 | Open in IMG/M |
3300028794|Ga0307515_10019484 | Not Available | 12201 | Open in IMG/M |
3300028794|Ga0307515_10019549 | Not Available | 12178 | Open in IMG/M |
3300028794|Ga0307515_10020545 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 11771 | Open in IMG/M |
3300028794|Ga0307515_10021517 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 11429 | Open in IMG/M |
3300028794|Ga0307515_10021904 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 11301 | Open in IMG/M |
3300028794|Ga0307515_10022431 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae | 11125 | Open in IMG/M |
3300028794|Ga0307515_10022725 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 11038 | Open in IMG/M |
3300028794|Ga0307515_10022880 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 10992 | Open in IMG/M |
3300028794|Ga0307515_10022976 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 10965 | Open in IMG/M |
3300028794|Ga0307515_10023310 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Cryomyces → Cryomyces minteri | 10855 | Open in IMG/M |
3300028794|Ga0307515_10024147 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 10609 | Open in IMG/M |
3300028794|Ga0307515_10024714 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 10446 | Open in IMG/M |
3300028794|Ga0307515_10027037 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 9836 | Open in IMG/M |
3300028794|Ga0307515_10027815 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Sporormiaceae → Westerdykella → Westerdykella ornata | 9643 | Open in IMG/M |
3300028794|Ga0307515_10028966 | Not Available | 9383 | Open in IMG/M |
3300028794|Ga0307515_10029796 | Not Available | 9203 | Open in IMG/M |
3300028794|Ga0307515_10034032 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 8363 | Open in IMG/M |
3300028794|Ga0307515_10035571 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 8094 | Open in IMG/M |
3300028794|Ga0307515_10036361 | Not Available | 7968 | Open in IMG/M |
3300028794|Ga0307515_10038111 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetes incertae sedis → Botryosphaeriales → Botryosphaeriaceae → Botryosphaeria → Botryosphaeria dothidea | 7703 | Open in IMG/M |
3300028794|Ga0307515_10038685 | Not Available | 7619 | Open in IMG/M |
3300028794|Ga0307515_10041422 | Not Available | 7241 | Open in IMG/M |
3300028794|Ga0307515_10046194 | Not Available | 6664 | Open in IMG/M |
3300028794|Ga0307515_10047169 | Not Available | 6559 | Open in IMG/M |
3300028794|Ga0307515_10048013 | Not Available | 6468 | Open in IMG/M |
3300028794|Ga0307515_10048917 | Not Available | 6381 | Open in IMG/M |
3300028794|Ga0307515_10049552 | Not Available | 6314 | Open in IMG/M |
3300028794|Ga0307515_10050349 | Not Available | 6241 | Open in IMG/M |
3300028794|Ga0307515_10052797 | Not Available | 6016 | Open in IMG/M |
3300028794|Ga0307515_10055593 | Not Available | 5778 | Open in IMG/M |
3300028794|Ga0307515_10057545 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 5624 | Open in IMG/M |
3300028794|Ga0307515_10058000 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 5588 | Open in IMG/M |
3300028794|Ga0307515_10060036 | Not Available | 5436 | Open in IMG/M |
3300028794|Ga0307515_10081721 | All Organisms → Viruses → Predicted Viral | 4192 | Open in IMG/M |
3300028794|Ga0307515_10081911 | Not Available | 4183 | Open in IMG/M |
3300028794|Ga0307515_10084654 | Not Available | 4069 | Open in IMG/M |
3300028794|Ga0307515_10087214 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3965 | Open in IMG/M |
3300028794|Ga0307515_10099202 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3538 | Open in IMG/M |
3300028794|Ga0307515_10099742 | Not Available | 3523 | Open in IMG/M |
3300028794|Ga0307515_10105962 | Not Available | 3341 | Open in IMG/M |
3300028794|Ga0307515_10125725 | Not Available | 2866 | Open in IMG/M |
3300028794|Ga0307515_10171268 | Not Available | 2162 | Open in IMG/M |
3300028794|Ga0307515_10189462 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 1973 | Open in IMG/M |
3300028794|Ga0307515_10220340 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1717 | Open in IMG/M |
3300028794|Ga0307515_10277473 | Not Available | 1388 | Open in IMG/M |
3300028794|Ga0307515_10288765 | Not Available | 1338 | Open in IMG/M |
3300028794|Ga0307515_10481399 | Not Available | 853 | Open in IMG/M |
3300028794|Ga0307515_10627719 | Not Available | 686 | Open in IMG/M |
3300028794|Ga0307515_10783161 | Not Available | 575 | Open in IMG/M |
3300028794|Ga0307515_10783489 | Not Available | 575 | Open in IMG/M |
3300028802|Ga0307503_10769325 | Not Available | 547 | Open in IMG/M |
3300028802|Ga0307503_10796203 | Not Available | 539 | Open in IMG/M |
3300030522|Ga0307512_10253463 | Not Available | 874 | Open in IMG/M |
3300030522|Ga0307512_10276305 | Not Available | 808 | Open in IMG/M |
3300030522|Ga0307512_10421280 | Not Available | 551 | Open in IMG/M |
3300030522|Ga0307512_10433309 | Not Available | 538 | Open in IMG/M |
3300030522|Ga0307512_10467117 | Not Available | 504 | Open in IMG/M |
3300031057|Ga0170834_101265310 | Not Available | 527 | Open in IMG/M |
3300031708|Ga0310686_116976048 | Not Available | 762 | Open in IMG/M |
3300031838|Ga0307518_10033116 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 3749 | Open in IMG/M |
3300031838|Ga0307518_10033891 | Not Available | 3707 | Open in IMG/M |
3300031838|Ga0307518_10040769 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 3378 | Open in IMG/M |
3300031838|Ga0307518_10041363 | Not Available | 3355 | Open in IMG/M |
3300031838|Ga0307518_10066449 | Not Available | 2616 | Open in IMG/M |
3300031838|Ga0307518_10094623 | Not Available | 2146 | Open in IMG/M |
3300031838|Ga0307518_10099541 | Not Available | 2083 | Open in IMG/M |
3300031838|Ga0307518_10185974 | Not Available | 1398 | Open in IMG/M |
3300031838|Ga0307518_10194214 | Not Available | 1356 | Open in IMG/M |
3300031838|Ga0307518_10199599 | Not Available | 1330 | Open in IMG/M |
3300031838|Ga0307518_10227134 | Not Available | 1212 | Open in IMG/M |
3300031838|Ga0307518_10248998 | Not Available | 1131 | Open in IMG/M |
3300031838|Ga0307518_10281105 | All Organisms → Viruses → Predicted Viral | 1030 | Open in IMG/M |
3300031838|Ga0307518_10322451 | Not Available | 922 | Open in IMG/M |
3300031838|Ga0307518_10326956 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 911 | Open in IMG/M |
3300031838|Ga0307518_10335378 | Not Available | 892 | Open in IMG/M |
3300031838|Ga0307518_10339565 | Not Available | 883 | Open in IMG/M |
3300031838|Ga0307518_10362795 | Not Available | 835 | Open in IMG/M |
3300031838|Ga0307518_10401708 | Not Available | 764 | Open in IMG/M |
3300031838|Ga0307518_10425060 | Not Available | 726 | Open in IMG/M |
3300031838|Ga0307518_10449777 | Not Available | 690 | Open in IMG/M |
3300031838|Ga0307518_10510543 | Not Available | 614 | Open in IMG/M |
3300031838|Ga0307518_10510679 | Not Available | 614 | Open in IMG/M |
3300031838|Ga0307518_10561071 | Not Available | 562 | Open in IMG/M |
3300031838|Ga0307518_10602929 | Not Available | 524 | Open in IMG/M |
3300033179|Ga0307507_10000018 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 224203 | Open in IMG/M |
3300033179|Ga0307507_10000018 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 224203 | Open in IMG/M |
3300033179|Ga0307507_10000026 | All Organisms → cellular organisms → Eukaryota | 204681 | Open in IMG/M |
3300033179|Ga0307507_10000041 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 181562 | Open in IMG/M |
3300033179|Ga0307507_10000043 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 174786 | Open in IMG/M |
3300033179|Ga0307507_10000047 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 172297 | Open in IMG/M |
3300033179|Ga0307507_10000049 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 170691 | Open in IMG/M |
3300033179|Ga0307507_10000050 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 169847 | Open in IMG/M |
3300033179|Ga0307507_10000065 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 160945 | Open in IMG/M |
3300033179|Ga0307507_10000079 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 148885 | Open in IMG/M |
3300033179|Ga0307507_10000096 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 139868 | Open in IMG/M |
3300033179|Ga0307507_10000114 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 133267 | Open in IMG/M |
3300033179|Ga0307507_10000124 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 131248 | Open in IMG/M |
3300033179|Ga0307507_10000125 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 130869 | Open in IMG/M |
3300033179|Ga0307507_10000138 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 126114 | Open in IMG/M |
3300033179|Ga0307507_10000151 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 122213 | Open in IMG/M |
3300033179|Ga0307507_10000163 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 118765 | Open in IMG/M |
3300033179|Ga0307507_10000168 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 118439 | Open in IMG/M |
3300033179|Ga0307507_10000178 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 115210 | Open in IMG/M |
3300033179|Ga0307507_10000179 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 115115 | Open in IMG/M |
3300033179|Ga0307507_10000181 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 114856 | Open in IMG/M |
3300033179|Ga0307507_10000190 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 113237 | Open in IMG/M |
3300033179|Ga0307507_10000197 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 112577 | Open in IMG/M |
3300033179|Ga0307507_10000198 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 112539 | Open in IMG/M |
3300033179|Ga0307507_10000213 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 110384 | Open in IMG/M |
3300033179|Ga0307507_10000244 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 105821 | Open in IMG/M |
3300033179|Ga0307507_10000257 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 103557 | Open in IMG/M |
3300033179|Ga0307507_10000269 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 102223 | Open in IMG/M |
3300033179|Ga0307507_10000270 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae → Glonium → Glonium stellatum | 102139 | Open in IMG/M |
3300033179|Ga0307507_10000296 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 99589 | Open in IMG/M |
3300033179|Ga0307507_10000302 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 99207 | Open in IMG/M |
3300033179|Ga0307507_10000326 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 96483 | Open in IMG/M |
3300033179|Ga0307507_10000363 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 92784 | Open in IMG/M |
3300033179|Ga0307507_10000377 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 91634 | Open in IMG/M |
3300033179|Ga0307507_10000382 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 91437 | Open in IMG/M |
3300033179|Ga0307507_10000383 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 91417 | Open in IMG/M |
3300033179|Ga0307507_10000384 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 91368 | Open in IMG/M |
3300033179|Ga0307507_10000416 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 89015 | Open in IMG/M |
3300033179|Ga0307507_10000419 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 88748 | Open in IMG/M |
3300033179|Ga0307507_10000425 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 87729 | Open in IMG/M |
3300033179|Ga0307507_10000430 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 87577 | Open in IMG/M |
3300033179|Ga0307507_10000431 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 87555 | Open in IMG/M |
3300033179|Ga0307507_10000455 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 85561 | Open in IMG/M |
3300033179|Ga0307507_10000458 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 85312 | Open in IMG/M |
3300033179|Ga0307507_10000492 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 83409 | Open in IMG/M |
3300033179|Ga0307507_10000519 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 81475 | Open in IMG/M |
3300033179|Ga0307507_10000539 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 80623 | Open in IMG/M |
3300033179|Ga0307507_10000548 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 80328 | Open in IMG/M |
3300033179|Ga0307507_10000548 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 80328 | Open in IMG/M |
3300033179|Ga0307507_10000551 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 80221 | Open in IMG/M |
3300033179|Ga0307507_10000564 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 79476 | Open in IMG/M |
3300033179|Ga0307507_10000566 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 79383 | Open in IMG/M |
3300033179|Ga0307507_10000567 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 79316 | Open in IMG/M |
3300033179|Ga0307507_10000571 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 79107 | Open in IMG/M |
3300033179|Ga0307507_10000572 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 78959 | Open in IMG/M |
3300033179|Ga0307507_10000581 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 78539 | Open in IMG/M |
3300033179|Ga0307507_10000642 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 75621 | Open in IMG/M |
3300033179|Ga0307507_10000648 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 75289 | Open in IMG/M |
3300033179|Ga0307507_10000648 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 75289 | Open in IMG/M |
3300033179|Ga0307507_10000664 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 74668 | Open in IMG/M |
3300033179|Ga0307507_10000700 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 73516 | Open in IMG/M |
3300033179|Ga0307507_10000729 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 72293 | Open in IMG/M |
3300033179|Ga0307507_10000739 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 71946 | Open in IMG/M |
3300033179|Ga0307507_10000748 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 71714 | Open in IMG/M |
3300033179|Ga0307507_10000756 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 71443 | Open in IMG/M |
3300033179|Ga0307507_10000809 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 69217 | Open in IMG/M |
3300033179|Ga0307507_10000857 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 67560 | Open in IMG/M |
3300033179|Ga0307507_10000863 | All Organisms → cellular organisms → Eukaryota | 67309 | Open in IMG/M |
3300033179|Ga0307507_10000886 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 66511 | Open in IMG/M |
3300033179|Ga0307507_10000909 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 65863 | Open in IMG/M |
3300033179|Ga0307507_10000922 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes | 65464 | Open in IMG/M |
3300033179|Ga0307507_10000925 | Not Available | 65406 | Open in IMG/M |
3300033179|Ga0307507_10000929 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 65354 | Open in IMG/M |
3300033179|Ga0307507_10000945 | All Organisms → cellular organisms → Eukaryota | 64828 | Open in IMG/M |
3300033179|Ga0307507_10000971 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 63665 | Open in IMG/M |
3300033179|Ga0307507_10001035 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 61948 | Open in IMG/M |
3300033179|Ga0307507_10001044 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 61731 | Open in IMG/M |
3300033179|Ga0307507_10001127 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 59226 | Open in IMG/M |
3300033179|Ga0307507_10001136 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 59033 | Open in IMG/M |
3300033179|Ga0307507_10001139 | Not Available | 58930 | Open in IMG/M |
3300033179|Ga0307507_10001170 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 58243 | Open in IMG/M |
3300033179|Ga0307507_10001180 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 58153 | Open in IMG/M |
3300033179|Ga0307507_10001189 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 57948 | Open in IMG/M |
3300033179|Ga0307507_10001226 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 57229 | Open in IMG/M |
3300033179|Ga0307507_10001258 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 56741 | Open in IMG/M |
3300033179|Ga0307507_10001287 | All Organisms → cellular organisms → Eukaryota | 56268 | Open in IMG/M |
3300033179|Ga0307507_10001331 | Not Available | 55178 | Open in IMG/M |
3300033179|Ga0307507_10001391 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 54271 | Open in IMG/M |
3300033179|Ga0307507_10001395 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 54219 | Open in IMG/M |
3300033179|Ga0307507_10001425 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 53655 | Open in IMG/M |
3300033179|Ga0307507_10001467 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 52786 | Open in IMG/M |
3300033179|Ga0307507_10001502 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 52091 | Open in IMG/M |
3300033179|Ga0307507_10001514 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 51909 | Open in IMG/M |
3300033179|Ga0307507_10001544 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 51356 | Open in IMG/M |
3300033179|Ga0307507_10001548 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 51249 | Open in IMG/M |
3300033179|Ga0307507_10001591 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 50246 | Open in IMG/M |
3300033179|Ga0307507_10001644 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 49511 | Open in IMG/M |
3300033179|Ga0307507_10001658 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae → Glonium → Glonium stellatum | 49300 | Open in IMG/M |
3300033179|Ga0307507_10001675 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 48990 | Open in IMG/M |
3300033179|Ga0307507_10001713 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes | 48367 | Open in IMG/M |
3300033179|Ga0307507_10001780 | Not Available | 47360 | Open in IMG/M |
3300033179|Ga0307507_10001798 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 47035 | Open in IMG/M |
3300033179|Ga0307507_10001814 | Not Available | 46863 | Open in IMG/M |
3300033179|Ga0307507_10001836 | All Organisms → cellular organisms → Eukaryota | 46512 | Open in IMG/M |
3300033179|Ga0307507_10001844 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 46351 | Open in IMG/M |
3300033179|Ga0307507_10001906 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 45420 | Open in IMG/M |
3300033179|Ga0307507_10001938 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 44983 | Open in IMG/M |
3300033179|Ga0307507_10001945 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 44857 | Open in IMG/M |
3300033179|Ga0307507_10002003 | All Organisms → cellular organisms → Eukaryota | 44168 | Open in IMG/M |
3300033179|Ga0307507_10002006 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Mytilinidiales → Argynnaceae → Lepidopterella → Lepidopterella palustris → Lepidopterella palustris CBS 459.81 | 44154 | Open in IMG/M |
3300033179|Ga0307507_10002084 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 43237 | Open in IMG/M |
3300033179|Ga0307507_10002212 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 41580 | Open in IMG/M |
3300033179|Ga0307507_10002234 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 41350 | Open in IMG/M |
3300033179|Ga0307507_10002255 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 41101 | Open in IMG/M |
3300033179|Ga0307507_10002294 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 40747 | Open in IMG/M |
3300033179|Ga0307507_10002326 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 40361 | Open in IMG/M |
3300033179|Ga0307507_10002343 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 40192 | Open in IMG/M |
3300033179|Ga0307507_10002433 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 39060 | Open in IMG/M |
3300033179|Ga0307507_10002574 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 37578 | Open in IMG/M |
3300033179|Ga0307507_10002595 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 37332 | Open in IMG/M |
3300033179|Ga0307507_10002606 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 37222 | Open in IMG/M |
3300033179|Ga0307507_10002847 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 35041 | Open in IMG/M |
3300033179|Ga0307507_10002867 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 34851 | Open in IMG/M |
3300033179|Ga0307507_10002891 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 34626 | Open in IMG/M |
3300033179|Ga0307507_10002897 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Massarineae → Periconiaceae → Periconia → Periconia macrospinosa | 34589 | Open in IMG/M |
3300033179|Ga0307507_10002950 | All Organisms → cellular organisms → Eukaryota | 34163 | Open in IMG/M |
3300033179|Ga0307507_10002986 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 33902 | Open in IMG/M |
3300033179|Ga0307507_10003039 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 33560 | Open in IMG/M |
3300033179|Ga0307507_10003079 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 33284 | Open in IMG/M |
3300033179|Ga0307507_10003244 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 32053 | Open in IMG/M |
3300033179|Ga0307507_10003260 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 31917 | Open in IMG/M |
3300033179|Ga0307507_10003352 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 31359 | Open in IMG/M |
3300033179|Ga0307507_10003401 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporomycetidae incertae sedis → Gloniaceae → Glonium → Glonium stellatum | 31000 | Open in IMG/M |
3300033179|Ga0307507_10003419 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 30836 | Open in IMG/M |
3300033179|Ga0307507_10003530 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 30048 | Open in IMG/M |
3300033179|Ga0307507_10003576 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales | 29664 | Open in IMG/M |
3300033179|Ga0307507_10003637 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 29279 | Open in IMG/M |
3300033179|Ga0307507_10003732 | Not Available | 28685 | Open in IMG/M |
3300033179|Ga0307507_10003768 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 28466 | Open in IMG/M |
3300033179|Ga0307507_10003816 | Not Available | 28160 | Open in IMG/M |
3300033179|Ga0307507_10003865 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 27898 | Open in IMG/M |
3300033179|Ga0307507_10003904 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Mycosphaerellales | 27631 | Open in IMG/M |
3300033179|Ga0307507_10003949 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 27290 | Open in IMG/M |
3300033179|Ga0307507_10004004 | Not Available | 27049 | Open in IMG/M |
3300033179|Ga0307507_10004032 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 26929 | Open in IMG/M |
3300033179|Ga0307507_10004065 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 26756 | Open in IMG/M |
3300033179|Ga0307507_10004134 | Not Available | 26387 | Open in IMG/M |
3300033179|Ga0307507_10004153 | All Organisms → cellular organisms → Eukaryota | 26278 | Open in IMG/M |
3300033179|Ga0307507_10004301 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 25594 | Open in IMG/M |
3300033179|Ga0307507_10004412 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 25035 | Open in IMG/M |
3300033179|Ga0307507_10004427 | Not Available | 24969 | Open in IMG/M |
3300033179|Ga0307507_10004535 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 24405 | Open in IMG/M |
3300033179|Ga0307507_10004572 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 24262 | Open in IMG/M |
3300033179|Ga0307507_10004601 | Not Available | 24091 | Open in IMG/M |
3300033179|Ga0307507_10004683 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi | 23747 | Open in IMG/M |
3300033179|Ga0307507_10004792 | Not Available | 23345 | Open in IMG/M |
3300033179|Ga0307507_10005066 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 22205 | Open in IMG/M |
3300033179|Ga0307507_10005433 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 20945 | Open in IMG/M |
3300033179|Ga0307507_10005685 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 20213 | Open in IMG/M |
3300033179|Ga0307507_10005696 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 20159 | Open in IMG/M |
3300033179|Ga0307507_10005819 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 19759 | Open in IMG/M |
3300033179|Ga0307507_10005873 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 19561 | Open in IMG/M |
3300033179|Ga0307507_10006024 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 19104 | Open in IMG/M |
3300033179|Ga0307507_10006199 | All Organisms → cellular organisms → Bacteria | 18631 | Open in IMG/M |
3300033179|Ga0307507_10006401 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 18120 | Open in IMG/M |
3300033179|Ga0307507_10006443 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes | 18027 | Open in IMG/M |
3300033179|Ga0307507_10006459 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 18000 | Open in IMG/M |
3300033179|Ga0307507_10006475 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Sporormiaceae → Westerdykella → Westerdykella ornata | 17956 | Open in IMG/M |
3300033179|Ga0307507_10007296 | Not Available | 16182 | Open in IMG/M |
3300033179|Ga0307507_10007863 | All Organisms → cellular organisms → Eukaryota | 15124 | Open in IMG/M |
3300033179|Ga0307507_10008055 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae | 14835 | Open in IMG/M |
3300033179|Ga0307507_10008236 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 14564 | Open in IMG/M |
3300033179|Ga0307507_10008332 | Not Available | 14405 | Open in IMG/M |
3300033179|Ga0307507_10008494 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 14165 | Open in IMG/M |
3300033179|Ga0307507_10008494 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 14165 | Open in IMG/M |
3300033179|Ga0307507_10009442 | Not Available | 12987 | Open in IMG/M |
3300033179|Ga0307507_10009684 | Not Available | 12729 | Open in IMG/M |
3300033179|Ga0307507_10010331 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 12091 | Open in IMG/M |
3300033179|Ga0307507_10011217 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes | 11368 | Open in IMG/M |
3300033179|Ga0307507_10011581 | Not Available | 11090 | Open in IMG/M |
3300033179|Ga0307507_10012101 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Tricladiaceae → Cudoniella → Cudoniella acicularis | 10727 | Open in IMG/M |
3300033179|Ga0307507_10014166 | Not Available | 9545 | Open in IMG/M |
3300033179|Ga0307507_10015435 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 8985 | Open in IMG/M |
3300033179|Ga0307507_10015673 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 8888 | Open in IMG/M |
3300033179|Ga0307507_10019881 | Not Available | 7543 | Open in IMG/M |
3300033179|Ga0307507_10028938 | Not Available | 5888 | Open in IMG/M |
3300033179|Ga0307507_10041770 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina | 4582 | Open in IMG/M |
3300033179|Ga0307507_10388492 | Not Available | 800 | Open in IMG/M |
3300033179|Ga0307507_10507441 | Not Available | 648 | Open in IMG/M |
3300033179|Ga0307507_10509326 | Not Available | 646 | Open in IMG/M |
3300033179|Ga0307507_10526456 | Not Available | 630 | Open in IMG/M |
3300033179|Ga0307507_10565005 | Not Available | 596 | Open in IMG/M |
3300033179|Ga0307507_10646721 | Not Available | 537 | Open in IMG/M |
3300033179|Ga0307507_10659164 | Not Available | 530 | Open in IMG/M |
3300033179|Ga0307507_10684188 | Not Available | 515 | Open in IMG/M |
3300033545|Ga0316214_1023219 | Not Available | 872 | Open in IMG/M |
3300033547|Ga0316212_1067309 | Not Available | 520 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 73.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.29% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.13% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.19% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.45% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.23% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.23% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.23% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.23% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028011 | Plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE1 | Environmental | Open in IMG/M |
3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Host-Associated | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Host-Associated | Open in IMG/M |
3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J15887_103131251 | 3300001661 | Forest Soil | LFLVSYLALGLVLGIELVLDLGLGSLSILFIVEY* |
JGIcombinedJ26739_1005101471 | 3300002245 | Forest Soil | VLSLFRLSIVSYIVSYLVLGLVLDIKLVLDLGLGSLSILFIVGY* |
JGIcombinedJ26739_1013844921 | 3300002245 | Forest Soil | SIVSYLVSYLGLGLGLDKKLVLVLVLGSLSILYIVEYQFI* |
JGIcombinedJ26739_1015144991 | 3300002245 | Forest Soil | SVLSLFRLSIVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIVGY* |
JGIcombinedJ26739_1016154571 | 3300002245 | Forest Soil | VLSLFKSSIVFYIVSYLALGLVLDIELVLDLGLGSLSILFIVRYQSF* |
Ga0099795_102096831 | 3300007788 | Vadose Zone Soil | VSYIVSYLILDLVLDIDLVLVLSLCFFSIFFIVRY* |
Ga0099796_103593561 | 3300010159 | Vadose Zone Soil | RSLLVSYSALGLALGTELVLDLGSGSLSIFFIVVY* |
Ga0126350_107384551 | 3300010880 | Boreal Forest Soil | LFRSSIVFYIVSYLGLGLVLGTELVLDLGLGSLSILFIVRY* |
Ga0137383_111178661 | 3300012199 | Vadose Zone Soil | ASRVALIIWISRVSSSLRLSVVFYIVSYLVLGLVLGIELVLDSSLGSLSILFIIEY* |
Ga0137382_108153301 | 3300012200 | Vadose Zone Soil | VSYIVSYLTLGLVLGTELVLALDLGLGSLSILFIVEY |
Ga0137382_111849392 | 3300012200 | Vadose Zone Soil | VLSLLGLSMVSCVVSYLGLVLGTELVLDLGSGSLSILFMVEYQF |
Ga0137363_114858011 | 3300012202 | Vadose Zone Soil | LRLLLVSYSALGLVLGTELVLDLGSGSLSILFIVGYQFF* |
Ga0137399_111101751 | 3300012203 | Vadose Zone Soil | MSRVLSLLRLSIVSYLTLGLVLGIELVLDLGLGSLSILFIIGY* |
Ga0137380_108230991 | 3300012206 | Vadose Zone Soil | RSSLVPYIFSCLALGLVSGIKLVLDLGSGSSSILFIVKY* |
Ga0137380_109103931 | 3300012206 | Vadose Zone Soil | FRVLSLLRLSIVFYMVSYLGSVLGIELVLDLGLGSLSIFFMVKY* |
Ga0137380_114007271 | 3300012206 | Vadose Zone Soil | SKVLSKLRSSLVPYIVSYLASGSVSGIKSILDLDLGSLSILFMVEYQFF* |
Ga0137381_113829481 | 3300012207 | Vadose Zone Soil | NLFRFSIISYIVSYLGLVLGIELVSNLGSGSLNILFIVKYQFF* |
Ga0137376_117235691 | 3300012208 | Vadose Zone Soil | MSKVLSELRLSLVSYIVFYLALDLVLGIELVLDLGLGSLSILFIVEY* |
Ga0137377_113294021 | 3300012211 | Vadose Zone Soil | MWIFKALSELRLSMVSCVVSCSALSSVLGIESVLDLSLGSLSILFMVEY* |
Ga0137377_114744971 | 3300012211 | Vadose Zone Soil | IMWIFRVLSLFRLFMVFYIVSCLTLSLVLGIELVLDLGSGSSSILFIVEY* |
Ga0137387_112501671 | 3300012349 | Vadose Zone Soil | MWIFKVLSELRLSLVPYIVSYLALGLILDIESVLDLGLGSLSILFIIEY* |
Ga0137386_108230111 | 3300012351 | Vadose Zone Soil | VLSLLGLSIVSCIVFYLGSVLGTELVLDSSLGSLSILFMVEY* |
Ga0137384_108214741 | 3300012357 | Vadose Zone Soil | SFLVSCVVSCLALSLVLGIEFVLDLGLGSLSILFIV* |
Ga0137385_114231071 | 3300012359 | Vadose Zone Soil | SIVSYIVSYLALSLVLGIELVLDLGLGSLSILFIIEYQSF* |
Ga0137360_108960931 | 3300012361 | Vadose Zone Soil | MSRVLSLLRSSIVSYLTLGLVLGIESVLDLGLGSLSILFIIEY* |
Ga0137360_110984371 | 3300012361 | Vadose Zone Soil | MSKVLSELRSSLVSYIVSYSALGLVLGTELVLDLGSGSLRILFIVE* |
Ga0137361_119223631 | 3300012362 | Vadose Zone Soil | SGVTPIIWIFRVLSLLRLSTVFYIVSCSGLVLGIELVSDLSSGSLSILFIIEY* |
Ga0137398_108693791 | 3300012683 | Vadose Zone Soil | VSYILPYLILGLVLGTESVLDLGSGSLSILFIVEYQFF* |
Ga0137397_110913011 | 3300012685 | Vadose Zone Soil | MVFYIVFYIVLGLVLGIELVLDSGLGSLSILFIIEY* |
Ga0137394_113358641 | 3300012922 | Vadose Zone Soil | SRVLSELRLLLVSYLALGLVLGTELVLDLGSDSLSILFIVEY* |
Ga0137413_107393011 | 3300012924 | Vadose Zone Soil | SLVSYMVSYSALGLVLGIELVLDLGLGSLSILFIVEY* |
Ga0137413_109250391 | 3300012924 | Vadose Zone Soil | SFTVSYIALYLFSDLVLDIELVLDLGSGFLRILFIVKY* |
Ga0137404_115292811 | 3300012929 | Vadose Zone Soil | KILSLLRSSIVSYIVSYLILGSLLGIELVLDLGLGSLNILFIIGN* |
Ga0137404_120288271 | 3300012929 | Vadose Zone Soil | VLSKLRSLLVSYLALGLVLGIELVLDLGLGSLSILFIVEY* |
Ga0137410_112954051 | 3300012944 | Vadose Zone Soil | VAPIMRIFRVLSLLGLSIVSYLGLGLVLGTELVLNLDLGSLRILFIVEY* |
Ga0137420_13212041 | 3300015054 | Vadose Zone Soil | MSRVLSLLRLSIVSYLTLGLVLGIELVLDLGLGSLSILFIIGYQFF* |
Ga0137420_14985371 | 3300015054 | Vadose Zone Soil | MVSYIVSYLVLGLVLGIELVLDSSLGSLSILFIIEYQFF* |
Ga0137418_107694961 | 3300015241 | Vadose Zone Soil | MWISRVLSKLRSLLVSYSALGLVLDTELVLDLGLGSLSILFIVEYQFF* |
Ga0193751_11678051 | 3300019888 | Soil | MSKVLSKLKSSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0193728_10032151 | 3300019890 | Soil | MSKVLSELRLFLVSYIVSYLGLDSVLDIELVLDLGLDSLSIFFIVGY |
Ga0193728_10051561 | 3300019890 | Soil | MSRVLSSLKSSIVSYIVPYSILGLVLDIELVLDLGLSSLSILFIVRY |
Ga0193728_10090661 | 3300019890 | Soil | MSRVLSLLRLYIVSYIVPYLILGLLLDIELVLDLGLGSLSILFIVRY |
Ga0193728_10119781 | 3300019890 | Soil | MSKVLSELRLSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIEY |
Ga0193728_10173442 | 3300019890 | Soil | MSKVLSELRSSLVSYIVSYLGLGSVLGIELVLDLGSGSLSILFIIGYQFF |
Ga0193728_10186121 | 3300019890 | Soil | MSKILSKLRSSLVSYIVSYLGLDLVLDIKLVLDLGLGSLSIFFIVGY |
Ga0193728_10204481 | 3300019890 | Soil | MSKVLSGLKLSLVSYIVSYLGLDLVLDTELVLDLGLDSLSIFFIVGYQFF |
Ga0193728_10301331 | 3300019890 | Soil | MSRALSGLLLSLVSYLVLGLVLGMELVLDLGSGSLSIFFIVEYQFF |
Ga0193728_10303421 | 3300019890 | Soil | MSKVLSELRSSLVSYIVSYLGLSLVLGIELVLDLGLGSLSILFIIGY |
Ga0193728_10348641 | 3300019890 | Soil | MQISRVLSLFRLSIVSYIVSYLALGLVLGIELVLDLGLGSLSILFIIRY |
Ga0193728_10377752 | 3300019890 | Soil | MSKVLSKLRLSLVSYIVSYLGLGLGLVLGIELVLDLGSGSLSILFIIGY |
Ga0193728_10408311 | 3300019890 | Soil | MWISKVLSKLRLSLVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0193728_10632612 | 3300019890 | Soil | MSKVLSELRSSLVSYIGSYLGLGLVLGIELVLDLGLGSLSIFFIVEYQFS |
Ga0193728_10641141 | 3300019890 | Soil | VLSKLRSSLVSYIVSYLGLGLGLILGIELVLDLGLGFLSIFFIVEY |
Ga0193728_10666841 | 3300019890 | Soil | MSKVLSKLRLSLVSYIVSYLDLGLGLVLGTELVLDLGLGSLSILFIIGY |
Ga0193728_10684691 | 3300019890 | Soil | MSKVLSELRSSLVSYIVFYLGLGLGLVLGIELVLDLGLGFLSIFFIVEY |
Ga0193728_10686461 | 3300019890 | Soil | LSLVSYIVFYLGLGLGLVLGIELVLDLGLGSLSIFFIVEY |
Ga0193728_10758281 | 3300019890 | Soil | LVSYIVSYLGLGLGLVLGIELVLDLGLGSLSIFFIVEYQFS |
Ga0193728_10763881 | 3300019890 | Soil | MSKVLSELRLSLVSYIVSYLGLGLGLVLGTELVLDLGLGSLSILFIIGY |
Ga0193728_10776531 | 3300019890 | Soil | SYLGLGLGLVLGTELVLDLGSGSLSIFFIVEYQFS |
Ga0193728_10780111 | 3300019890 | Soil | VLSELRLSLVSYIVSYLALGLVLSIELVLDLGLGSLSIFFIVEY |
Ga0193728_10827111 | 3300019890 | Soil | MSKVLSKLRLSLVSYIVSYLALGLVLGIELVLDLGLGSLSIFFIVKYQFF |
Ga0193728_10839491 | 3300019890 | Soil | RSSLVSYIVSYLGLGLVLSIELVLDLGLGSLSILFIIGY |
Ga0193728_10846021 | 3300019890 | Soil | MSKVLSELRLSLVSYIVSYLGLGLGLGLVLGIELVLDLGLGSLSIFFIVEYWFS |
Ga0193728_10905531 | 3300019890 | Soil | MSKVLSKLRSSLVSYMVSYLGLGLGLVLGIELVLDLGLGSLSIFFIAEY |
Ga0193728_10991802 | 3300019890 | Soil | MSKVLSELRSSLVSYIVSYLGLGLGLGLGIELVLDLGLGSLSILFIIGYQFF |
Ga0193728_11045501 | 3300019890 | Soil | YIVSYLGLGLGLVLGIELVLDLGLGSLSIFFIVEY |
Ga0193728_11060682 | 3300019890 | Soil | MSKVLSKLRLSLVSYIVSYLGLGLVLGIELVLDLGSGSLSILFIIGYQFF |
Ga0193728_11081711 | 3300019890 | Soil | MSKVLSKLRSSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0193728_11091291 | 3300019890 | Soil | LSELRSSLVSYMVSYLDLGLVLGMELVLDLGLGSLSILFIIGYQFF |
Ga0193728_11174261 | 3300019890 | Soil | MSKVLSKLRLSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0193728_11174361 | 3300019890 | Soil | MSKVLSELRLSLVSYIVSYLGLGLVLGIELVLDLGSGSLSIFFIVKYQFS |
Ga0193728_11211001 | 3300019890 | Soil | LRSSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0193728_11286841 | 3300019890 | Soil | MSKVLSKLRLSLVSYIVSYLGLGLGLVLGIELVLDLGLGSLSIFFIVEY |
Ga0193728_11301841 | 3300019890 | Soil | MSKVLSELRSSLVSYIVSYSGLGLVLGIELVLDLGSGSLSILFIIGY |
Ga0193728_11386331 | 3300019890 | Soil | MSKVLSELRLSLVSYIVSYLGLGLVLGIELVLDLGLGSLNILFIIGY |
Ga0193728_11392321 | 3300019890 | Soil | MSKVLSELRSSLVSYIVSYLGLGLVLGIELVLDLGLGSLSI |
Ga0193728_11449901 | 3300019890 | Soil | MSKVLSELKSSLVSYIVSYLGLGLVLGIELVSDLGLGSLSILFIIGY |
Ga0193728_12013751 | 3300019890 | Soil | MSKVLSELRSSLVSYIVSYLGLGLGLGLVLGIELVLDLGLGSLSIFFIVEY |
Ga0193728_12037341 | 3300019890 | Soil | LSFYIVSYLGLDLVLDIELVLELGLGSLSIFFIVEYQFF |
Ga0193728_12146581 | 3300019890 | Soil | MSKVLSKLRSSLVSYIVSYLGLGSVLNIELVLDLGLGSLSILFIIGY |
Ga0193728_12260381 | 3300019890 | Soil | MSKVLSELRSSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0193728_12293151 | 3300019890 | Soil | MSKVLSKLRSSLVSYIVSYLGLGLVLGIELVLDSGSGSLSILFIIGYQFF |
Ga0193728_12378281 | 3300019890 | Soil | MSKVLSKLRSSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIG |
Ga0193728_12631881 | 3300019890 | Soil | MSKVLSELRSSLVSYIVSYLGLGLVLGIKLVLDSGLGSLSILFIIEY |
Ga0193728_13558281 | 3300019890 | Soil | LIMWMFKVLSELRLSLVSYIVSYLGLGLVLGIELILDLGLGSLSILFIIGY |
Ga0210395_109636121 | 3300020582 | Soil | LIIQTSKVLSSFRSSIVSYLGLGLILDIELVLDLGLGSLSILFIVGY |
Ga0179596_104965841 | 3300021086 | Vadose Zone Soil | VSYIVSYLTLGLVLGTELVLALDLGLGSLSILFIVE |
Ga0137417_15109011 | 3300024330 | Vadose Zone Soil | MSKVLSELRLSLVSYIVSYLALGLVLGIELVLDLGLGSLSILFIVEY |
Ga0179591_10887581 | 3300024347 | Vadose Zone Soil | MSKVLSELRSSLVSYIVFYLALGLVLSIELVLDLGLGSLSILFIVEYQFF |
Ga0179591_11065281 | 3300024347 | Vadose Zone Soil | MVSYLVLGLVLGMELVLDLGLGSLSILFIIGYQFF |
Ga0208994_10124302 | 3300027164 | Forest Soil | MRISRVLSSLRSSIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0208985_10658971 | 3300027528 | Forest Soil | MVSYIVSYLGLGLVLGIELVLDLALGSLSIFFIVEYQFF |
Ga0209008_11287991 | 3300027545 | Forest Soil | LSLFKLFIVSYIVSYLALGLILGIKLVLDLGLGSLSIFFIVGY |
Ga0209525_10543561 | 3300027575 | Forest Soil | MQISSILNLFRLSIVSYIVFYLGLGLVLGIELVLDLGSGSLSILFIVGY |
Ga0209655_103021121 | 3300027767 | Bog Forest Soil | MSRVLSLFRLSIVSYIVSYLGLGLVLGTELVLDLGLGSLSILFIVGY |
Ga0209624_110419501 | 3300027895 | Forest Soil | SILSLFRLSIVSYIVSYLGLGLILSIELVLDLGLGSLSILFIVGY |
Ga0209006_104434741 | 3300027908 | Forest Soil | MQIFSILSLFRLSIVSYIIFYLGLGLILGIKLVLDLGLGSLSIFL |
Ga0209006_104953101 | 3300027908 | Forest Soil | MQIFSILSLFGLSIVSYIVFYLGLGLVLDIKLVLNLGLGFLSILFIIGY |
Ga0209006_105995641 | 3300027908 | Forest Soil | MQIFRVLSLFKLSIVSYIFPYLALGLVLYIELVLDLGSGSLNILFIVRY |
Ga0209006_106160951 | 3300027908 | Forest Soil | LSIVSYIVSYLALGLVLNIELVLDLALGSLSILFIVRY |
Ga0209006_107642481 | 3300027908 | Forest Soil | MQTSSILSLFGLFIVSYIVSYLGLDLVLDKELVLDLGLGSLSIFFIVKY |
Ga0209006_108487601 | 3300027908 | Forest Soil | MQISRVLYLFKLSIVSYIGSYLALGSVLNIELVLDLGLGSLSILFIVEYQFI |
Ga0209006_109348001 | 3300027908 | Forest Soil | FIVSYIVSYLALGLVLGIKLVSDLGSGSLSILFIVGYQSF |
Ga0209006_112890561 | 3300027908 | Forest Soil | MQISSVLSLFRSSIVSYIVSYLGLGLVLSMELVLDLGLGSLSILFIVGY |
Ga0209006_114392751 | 3300027908 | Forest Soil | FRVLSLLRLSMVLYMVSYLGLGLVLGKKLVLDLVLGSLSILL |
Ga0209006_114688571 | 3300027908 | Forest Soil | MQIFSVLSLFRLSIVSYIVSYLGLSLVLGTELVLDLGSGS |
Ga0209006_115094821 | 3300027908 | Forest Soil | FKLSIVSYIVSYLALGLVLGIELVLDLGLGSLSILFIVGY |
Ga0209006_115211441 | 3300027908 | Forest Soil | SLFRLSIVSYVVSYLGLGLILGIGLVLNLGLGFLSILFIVGY |
Ga0209006_115225651 | 3300027908 | Forest Soil | SLFRSSIVFYIVFYLGLGLVLNIELVLNLGSGSLSILFIVGY |
Ga0265344_1027651 | 3300028011 | Plant Litter | MVSYVVSYLGLGLVLGTELVLDLGLGSLSILFIVGY |
Ga0307515_100010396 | 3300028794 | Ectomycorrhiza | MQIFRVLRLLRLSIVSYIASYLALGLVLGAELVLNLGLGSLRMLFRVEY |
Ga0307515_1000161224 | 3300028794 | Ectomycorrhiza | MRISRVLSSFGSSIVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0307515_100016876 | 3300028794 | Ectomycorrhiza | VLSLLRLFIVSYIVSYSTLGLVLGIDLVLDLGLGSLSILFIVEY |
Ga0307515_1000177816 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRSFIVSYIVSYLGLGLILGTELVLDLGSGSLSILFIIGYQFF |
Ga0307515_100017921 | 3300028794 | Ectomycorrhiza | MRISRVLSSLGSSIVSYIVSYLGLGLVLGIELVLNLGLGSLSILFIVGY |
Ga0307515_100018211 | 3300028794 | Ectomycorrhiza | MRISKALSLLGLSITSYIVSRLDLGLVLGIRLVLDLGLGSLSILFIVGY |
Ga0307515_100018567 | 3300028794 | Ectomycorrhiza | VLSLLRLFIVSYIDSYLSLGLVLDIELILDLGLGFLNIFFIIGY |
Ga0307515_1000221710 | 3300028794 | Ectomycorrhiza | VLSLFRLSIVSYIASYLALGLILGAELVLNLGLGSLKILFIVEYQSF |
Ga0307515_1000304326 | 3300028794 | Ectomycorrhiza | MFKVLNLLRLSVVSYIVFYLALGLVLGMELVLDLSLGSLSILFIIGY |
Ga0307515_100033713 | 3300028794 | Ectomycorrhiza | MRIFRVLSSLGSSIVSYIVSYLGLGLVLGIKSVLDLGLGSLSILFIIGYQFF |
Ga0307515_100033715 | 3300028794 | Ectomycorrhiza | MRIFRVPSSLRLSIVFYLSLGSVLGTELVLDLGLGSLRILFIVEY |
Ga0307515_100038581 | 3300028794 | Ectomycorrhiza | MRIFRVLSLFRLFLVSYIVFYLALGIVLDTELVLDLDSGSLSMLFIVEY |
Ga0307515_100040005 | 3300028794 | Ectomycorrhiza | MVFYIVSYLALGLVLGTELVLDLGLGSLNILFIVEY |
Ga0307515_1000468011 | 3300028794 | Ectomycorrhiza | MLSLLRLSIVSYIAFYLALGLVLDIKLVSNLGLGSLSILFIVKY |
Ga0307515_1000551120 | 3300028794 | Ectomycorrhiza | MRIFRVLSSLRSSIVSYIVSYLGSGLILGIELVLDLGSGSLSILFIIGY |
Ga0307515_100058004 | 3300028794 | Ectomycorrhiza | MRISRVLSLLKLSIISYLGLGSVLGTELVLDLGLGFLRILFIVKY |
Ga0307515_100061235 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRSSIVSYIVSYLGLGLVLGIELVLDLGLGSLNILFIIGY |
Ga0307515_100061403 | 3300028794 | Ectomycorrhiza | MRISRVSSSLKSSIVSYIVSYLGLGLVLGTKLVLDLGLGSLSILFI |
Ga0307515_100061844 | 3300028794 | Ectomycorrhiza | MRISRVSSSLGSSIVSYIVSCLGLDLVLGIESVLDLGLGSLSILFIIGY |
Ga0307515_100063591 | 3300028794 | Ectomycorrhiza | MRIFRVLSLLRLSIVSYLSLGLVLGIELVLDSGSGSLKIFFIVEYQSF |
Ga0307515_100067151 | 3300028794 | Ectomycorrhiza | MSRHCRVLSLLRLSIVSYLGLGLVLGTELVLDLGLGSLRILFIVEY |
Ga0307515_100068024 | 3300028794 | Ectomycorrhiza | VLSSLKSSIVSYIVSYLGLGLVLGIELVSDLSLGSLNILFIIGYQFF |
Ga0307515_100069915 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRSSIVSYIVSCLGLGLVLGIKLVLDLGSGSLSILFIIGY |
Ga0307515_100073766 | 3300028794 | Ectomycorrhiza | MRIFRVSSSLGSFIVSYIVSCLGLGLVLGIELVLNLGLGSLSILFIIGY |
Ga0307515_100078154 | 3300028794 | Ectomycorrhiza | MRIFRVSSSLGSSIVSYIVSCLGLGLVLGTELVLNLGSGSLSILFIIGY |
Ga0307515_100082822 | 3300028794 | Ectomycorrhiza | MRIFRVLSLLGLSIVSYLGLGLVLGIDLVLDLGLGSLRILFIVEY |
Ga0307515_100085472 | 3300028794 | Ectomycorrhiza | VPSLPRLSIVSYLGLGSVLGTELVLDLGLGSLRILFIVGY |
Ga0307515_100086554 | 3300028794 | Ectomycorrhiza | MRISRVLSSFGSSIVTYLGLGLVLGIELVLDLGLGSLNILFIIGY |
Ga0307515_1000959312 | 3300028794 | Ectomycorrhiza | VLSSLRSSIVSYIVSCLGLGLVLGIELVLDLGLGFLSILFIIGY |
Ga0307515_100096652 | 3300028794 | Ectomycorrhiza | VLSSLRLSIVFYLGLGLVLGIELVLDLGLGSLKILFILEY |
Ga0307515_100099393 | 3300028794 | Ectomycorrhiza | VLSSLGLSIVSYLGLGLVLGLVLGMEIVSDLGLGSLSILFIIKY |
Ga0307515_100100781 | 3300028794 | Ectomycorrhiza | MRISRVLSLLKLSIVSYLGLGLVLGIELVLNLGLGFLRILFIVEY |
Ga0307515_100102792 | 3300028794 | Ectomycorrhiza | MSRVLSLLGLSIVSYLGLGLVLGTELVLDLGLGFLRILFIVEY |
Ga0307515_100109961 | 3300028794 | Ectomycorrhiza | VSSSLRSSIVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0307515_100113074 | 3300028794 | Ectomycorrhiza | MRIFRVLSFLRSFIVSYIVSYLGLGLVLGIKSVLDLGSGSLSILFIIGY |
Ga0307515_100114051 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRLSIVFYIVSYLGLGLVLGTELVLDLGLGSLSILFIIGY |
Ga0307515_100121222 | 3300028794 | Ectomycorrhiza | MRISRVLSLLGLSIVSYLGLGSVLYIKLVLDLGLGSLRILFIVEY |
Ga0307515_100124023 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRLSIVSYIASYLVLGLVLGAELVLGLGSGSLNILFIVEY |
Ga0307515_100134101 | 3300028794 | Ectomycorrhiza | MRIFRVLSSFRSSIVSYIVSYLGLGLVLGIELVLDLGLGFLSILFIIGY |
Ga0307515_100136752 | 3300028794 | Ectomycorrhiza | VLSSLGLSIVSYLSLGLVLGTELVLNLGLGSLRILFIVEY |
Ga0307515_100142893 | 3300028794 | Ectomycorrhiza | MSRVLSLFGLSIDSYIVSYLALALVLNAKLVLDLGLNSLSIFFIVEC |
Ga0307515_100143455 | 3300028794 | Ectomycorrhiza | MVLSKLGLFIVSYIVSYLALSLVLNIKLVLDLGLGSLNIIFIVEY |
Ga0307515_100144092 | 3300028794 | Ectomycorrhiza | MRIFRVLSSLRSSIVSYIVSCLGLGLVLGLKLVLNLGLGSLSILFIIGY |
Ga0307515_100145551 | 3300028794 | Ectomycorrhiza | MRISKVPNSLRLSIVSYLGLGSVLGTELVLDLGLGSLRILFIVEY |
Ga0307515_100147182 | 3300028794 | Ectomycorrhiza | MRIFRVSSSLGLSIVSYIVSYLGLGLVLGIELVLDSGSGSLSIFFIIGY |
Ga0307515_100147225 | 3300028794 | Ectomycorrhiza | MRISRVLSSLGLLVVSYLGLGSILGIKLVLDLGSGSLRILFIVEYQSF |
Ga0307515_100152558 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRLSIVSYIVSYLGLGLVLSIELVLDLGLGSLSILFIIGY |
Ga0307515_100160801 | 3300028794 | Ectomycorrhiza | VLSLFGLSIVSYIAFYLALALVLGIELVLDLGLGSLKILFIVEHQSF |
Ga0307515_100176152 | 3300028794 | Ectomycorrhiza | MRIFRVLSLLGLSIVSYLGLGLVLNIKLVLDLGLGFLSIFIIIGY |
Ga0307515_100187684 | 3300028794 | Ectomycorrhiza | MRISRVLSLLGSSIVSYLGLGLGSSIELVLDLGSGSLSILFIIEY |
Ga0307515_100188021 | 3300028794 | Ectomycorrhiza | MRIFRVLSLLGLFIVSYLGLGLVLSIKLVLDLGSGSLKILFIIEY |
Ga0307515_100190641 | 3300028794 | Ectomycorrhiza | MRIFRVLSLLRSSIISYLGLGLVLGIELVLDLGLGSLSILFIIEY |
Ga0307515_100194841 | 3300028794 | Ectomycorrhiza | MRIFRVSSSLKLSIVSYIVSYLGLGLVLGIKSVLDLGLGSLSILFIIGY |
Ga0307515_100195493 | 3300028794 | Ectomycorrhiza | MQISRMPISLKLSIVSYSGLGLVLGTKLILDLGLSSLSIFFIVEY |
Ga0307515_100205452 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRSSIVSYIVSYLGLGLVLSTELVLDLGLGSLSILFIIGYQFF |
Ga0307515_100215171 | 3300028794 | Ectomycorrhiza | MRISRVLSSFGLSIVSYIVSYLGLGLILGTELVLDLGSGSLSILFIIGY |
Ga0307515_100219041 | 3300028794 | Ectomycorrhiza | MSRVLSSLRLSIVSYIVSYSALGSVLSIELVLDLGLGFLNILFIIEY |
Ga0307515_100224313 | 3300028794 | Ectomycorrhiza | MWISRVLSLLRLSLVSYIDSYSALSLVLDMESVLNLGLGSLSILFIIGY |
Ga0307515_100227251 | 3300028794 | Ectomycorrhiza | MRISRVPSLLRLSIVSYLGLGLVLGIKLVLDLGSGSLKILFIVEY |
Ga0307515_100228801 | 3300028794 | Ectomycorrhiza | MRIFRVLSSLGSSIVSYIVSYLGLSLVLGIKLVLDLGLGSLSILFIIGY |
Ga0307515_100229763 | 3300028794 | Ectomycorrhiza | MWISKVLSSLGSFIVSYIVSCLGLGLVLGIELVLDLGLGSLSIFIIIGY |
Ga0307515_100233103 | 3300028794 | Ectomycorrhiza | MRISRVLNSLRLSIVSYIVSYLGLGLVLGIELVLDLGLGFLSILFIIEY |
Ga0307515_100241472 | 3300028794 | Ectomycorrhiza | MRISRVLSSLGLSIVFYIVSYLGLGLVLGIELVLDLGSGSLSILFIVGY |
Ga0307515_100247143 | 3300028794 | Ectomycorrhiza | MRIFRVLSSLRLSIVSYIVSYLGLGLILGIELVLNLGLGFLSILFIIGY |
Ga0307515_100270371 | 3300028794 | Ectomycorrhiza | MRIFRVSSSLGSSIVSYIVSYLGLGLVLGIELVSDLGLGFLSILFIIGY |
Ga0307515_100278152 | 3300028794 | Ectomycorrhiza | MRVFRVLSLLGSSIVSYLGLGLVLGIELVLNLGLGSLSILFIITY |
Ga0307515_100289661 | 3300028794 | Ectomycorrhiza | VFRVLSLFRLSIVSYIASYLALDLVLSIELVLDLGLGSLRIFFIVEY |
Ga0307515_100297961 | 3300028794 | Ectomycorrhiza | MQISRVLSLFGSSVVFYLGLGLVLGTELVLDLGLGSLSILFIIGY |
Ga0307515_100340323 | 3300028794 | Ectomycorrhiza | MRISRVLSFLRLSIVSYLGLGLVLGIELVLDLGLGSLSILFIIGYQFF |
Ga0307515_100355712 | 3300028794 | Ectomycorrhiza | MRISRVPSLLKLSIVSYLGLGLVLGIKLVLDLGSGSLRILFIVEY |
Ga0307515_100363611 | 3300028794 | Ectomycorrhiza | MRISRVLSSLKSSIVSYIVSYLGLGLVLGIELVLDLGSGSLSILFIIGYQFF |
Ga0307515_100381111 | 3300028794 | Ectomycorrhiza | MPQPPLLTVSYIVSYLILGLVLGIELILDLGLGSLSIFIIIEY |
Ga0307515_100386851 | 3300028794 | Ectomycorrhiza | MSRVLSSFKSFIVSYVASYLALGLVLGAESVLDLCFGSLRILFMVEYQSF |
Ga0307515_100414221 | 3300028794 | Ectomycorrhiza | MRISRVPSSFGLSIVSYLGSGLVLGTELVLDSGLGSLSILFIIGYQSF |
Ga0307515_100461942 | 3300028794 | Ectomycorrhiza | SKVLSELRLSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIVGY |
Ga0307515_100471691 | 3300028794 | Ectomycorrhiza | VPSLLRLSIVSYLGLGLVSGIELVLDLGSGSLRILFIVKY |
Ga0307515_100480131 | 3300028794 | Ectomycorrhiza | RVALIMRISRVPSSLRLFIVSYLGLGSVLGIELILDLGSGSLRILFIVEY |
Ga0307515_100489171 | 3300028794 | Ectomycorrhiza | MQISRVLSSLRLSIVSYIAFYLALGLILGVELVLNLGLGSLSILFIVEY |
Ga0307515_100495521 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRLSIVSYIVSYLGLGLVLSIELVLDLGSGSLSILFIIGYQFF |
Ga0307515_100503493 | 3300028794 | Ectomycorrhiza | VLSSLRSSIVSYIVSYLGLGLVLSIELVLDLGSGSLSILFIIGY |
Ga0307515_100527972 | 3300028794 | Ectomycorrhiza | MFRFLASYANRVALIMRISRVPSSFGLSIVFYLGLGLVLGTELVLNLGSDSLSILFIIGY |
Ga0307515_100555931 | 3300028794 | Ectomycorrhiza | MRISRVLSSLGLSIVSYIVSYLGLGLVLGIELVLDLGSGSLSILFIIGY |
Ga0307515_100575453 | 3300028794 | Ectomycorrhiza | MRISRVSSSLKSSIVSYIVSCLGLGLVLGIELVLDLGSGSLSILFIIGY |
Ga0307515_100580003 | 3300028794 | Ectomycorrhiza | VSSSLRLSIVSYIISCLGLGLVLGIELVLNLGLGSLSILFIIGY |
Ga0307515_100600362 | 3300028794 | Ectomycorrhiza | VLSLFRSSIVSYLGLGLVLGIDLVLDLGLGSLSILFIIGY |
Ga0307515_100817211 | 3300028794 | Ectomycorrhiza | MRISRVLSSLRSSIVSYIVSYLGLSLVLGIELVLDLGSGSLSILFIIGY |
Ga0307515_100819111 | 3300028794 | Ectomycorrhiza | MRISRVLSLLKLLVVSCLGLGSVLGTELVLDLGSGFLRILFIVEY |
Ga0307515_100846541 | 3300028794 | Ectomycorrhiza | IVSYIVSYLGLGLVLGIELVLDLGSGSLSILFIIGY |
Ga0307515_100872141 | 3300028794 | Ectomycorrhiza | MWISRVLSSLRLSIVSYLGLGLVLGIKSALDLGLGSLKILFIVEYQSF |
Ga0307515_100992021 | 3300028794 | Ectomycorrhiza | VPSSLRSSIVSYIASYLALGLILGAELVLDLGLGSLSILFIVEY |
Ga0307515_100997421 | 3300028794 | Ectomycorrhiza | MRISRVLSSLGSSIVSYIVSCLGLGLVLGTESVLDLGSGSLSILFIIGY |
Ga0307515_101059622 | 3300028794 | Ectomycorrhiza | SSIVSYIVSYLGLGLVLGIELVLDLGSGSLSILFIIGYQFF |
Ga0307515_101257251 | 3300028794 | Ectomycorrhiza | MRISRVLSSFRSSIVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIEY |
Ga0307515_101712681 | 3300028794 | Ectomycorrhiza | MRIFRVLSSFGSFIVSYIVSYLGLGLVSNIESVLDLGLGSLSILFIIGY |
Ga0307515_101894621 | 3300028794 | Ectomycorrhiza | MRIFRVLSSLRLSIVSYIVSYLGLGLVLGIELVLDLGSGSL |
Ga0307515_102203402 | 3300028794 | Ectomycorrhiza | MRIPKVLSSLKSSIVSYIVSYLGLSLVLGIELVLDLGLGSLSILFIIGY |
Ga0307515_102774731 | 3300028794 | Ectomycorrhiza | MRISRVLSSFRLSIVSYIVSYLGLGLVLGIELVLDLGLGSLNILFIIGY |
Ga0307515_102887651 | 3300028794 | Ectomycorrhiza | MRIFRVSSSLGLSIVSYIVSYLGLGLVSGIELVLDLGLGFLSILFIIGY |
Ga0307515_104813991 | 3300028794 | Ectomycorrhiza | MRISRVLSSFGLSIVSYIISYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0307515_106277191 | 3300028794 | Ectomycorrhiza | LSIVSYIVSYLGLGLVLGIELVLDLGSGSLSILFIIGYQFF |
Ga0307515_107831611 | 3300028794 | Ectomycorrhiza | RVLSLLGLFIVSYIDSYLALGLVLGTELVLDLGLDSLSILFIIGY |
Ga0307515_107834891 | 3300028794 | Ectomycorrhiza | MSRVLSLFRLFIVSYVASCLVLGLVLGTELVLDLGLGSLKIFFIVEY |
Ga0307503_107693251 | 3300028802 | Soil | MRISRVLSSFGSSIVSYIVSYLGLGLVLGIELVLDLSLGSLSILFII |
Ga0307503_107962031 | 3300028802 | Soil | MRIFRVLSSLRLFIVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIIGY |
Ga0307512_102534631 | 3300030522 | Ectomycorrhiza | MSKVLSELRLSLVSYIVSYLGLGLVLGIELILDLGLGLVLNTELVLDLGLGSLSILFIVEYQFF |
Ga0307512_102763052 | 3300030522 | Ectomycorrhiza | VLSKLRLSLVSYIVSYLGLGLVLGIELVLDLGLGLVLGIKLVLDLSSGSLSIFFIVEYQF |
Ga0307512_104212801 | 3300030522 | Ectomycorrhiza | LKSSLVSYIVLGLVLGIELVLDLDSGSLSIFFIVEY |
Ga0307512_104333092 | 3300030522 | Ectomycorrhiza | VLSKLRLSLVSYIVSYLGLGLVLGTELVLDLGLGLVLGIKLVLDLGLGSLSILFIVEY |
Ga0307512_104671171 | 3300030522 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVSYLVLGSVLGIELILDLGLGSLSILFIVEYQ |
Ga0170834_1012653101 | 3300031057 | Forest Soil | FLVSYLTLGLGLVLGTELVLDLGLGSLSILFIVEYQFF |
Ga0310686_1169760481 | 3300031708 | Soil | STVSYVGSSSASGLVLGTELVLDSGSGSLSIFFIVGY |
Ga0307518_100331161 | 3300031838 | Ectomycorrhiza | MSKVLNELRSSLVSYIVFYLGLGLVLSIKLVLDLGLGSSSILFIVEYQFF |
Ga0307518_100338911 | 3300031838 | Ectomycorrhiza | MWISRVLSKLLSSAVSYIVFYLSLGLVLNIELVLMSDLGSGSLSIFFIVRY |
Ga0307518_100407691 | 3300031838 | Ectomycorrhiza | MFKVSSKLKSSLVSYIVSYSALGSMSSIKLVLDLGLGFLSIL |
Ga0307518_100413633 | 3300031838 | Ectomycorrhiza | MSRVLSKLWSSAVFYIISYLNLGLVLNIKLILMLDLGLNSLSIFFIVRY |
Ga0307518_100664491 | 3300031838 | Ectomycorrhiza | MSKVLSELKLSLVSYVVFYLGLGLILGIELVSDLGSGFLSILFIVEYQFF |
Ga0307518_100946232 | 3300031838 | Ectomycorrhiza | VLSEFKSSLISYVVSYLTLNLVLNIGLVLNLGLSSLSILFIVEY |
Ga0307518_100995411 | 3300031838 | Ectomycorrhiza | MSSEFKSSLVSYMVSYLTLDLILNIRLILSLGSGFLSIPFIVEYQFF |
Ga0307518_101859741 | 3300031838 | Ectomycorrhiza | MSKVLSELGLSSISYIISYLGLGLVLSIELILNSSLGFLSILFIIEY |
Ga0307518_101942141 | 3300031838 | Ectomycorrhiza | ISRVLSKPRLSSVSYADFYLSLGLVLILDLGLGSLSIFFIIEYQFF |
Ga0307518_101995991 | 3300031838 | Ectomycorrhiza | MFKVLSKLRSSLVSYIVSYLSLNLVLNTELILDLGLGLVLGIKLVSDLSLGSLSILFIIKYQFF |
Ga0307518_102271341 | 3300031838 | Ectomycorrhiza | MSKVLSELRSSLVSYIVSYLNLGLVLNIKLVLYLDLGFLSILFIVEY |
Ga0307518_102489981 | 3300031838 | Ectomycorrhiza | LVSYIVFYLGLNLILNTELVSDLGSGSLSILFIIKY |
Ga0307518_102811051 | 3300031838 | Ectomycorrhiza | VLSELRLSLVSYIVSYLALGLILGIELILDLGLGSLSILFIVEY |
Ga0307518_103224511 | 3300031838 | Ectomycorrhiza | MWMSRVLSKLWSSAVSYIVSYLSLGLALSIELVSISDLGLGSLSIFFIVGY |
Ga0307518_103269561 | 3300031838 | Ectomycorrhiza | MFKVLNKLGSSLVSYIVSYLGLSLILNIELISDLGSGSLSILFIVKY |
Ga0307518_103353781 | 3300031838 | Ectomycorrhiza | LFIVIYLFLGLVLNIELMLDSDLGFLSILFIVEYQFF |
Ga0307518_103395651 | 3300031838 | Ectomycorrhiza | LASHTSGITPIIWISKILNKLLSSVVFYIVSYSSLGSALNIELVLMLDLGLGSLSIFFIVGY |
Ga0307518_103627951 | 3300031838 | Ectomycorrhiza | VLNELWSSAVSNIVFYLSLGSVLNIKSVLMSDLGLGSLSIFFIVGYQSF |
Ga0307518_104017081 | 3300031838 | Ectomycorrhiza | MFKVLSELRSSLISYIVFYLNLGSVLGIELILNLGLGSLNIFFIVKY |
Ga0307518_104250601 | 3300031838 | Ectomycorrhiza | YLGELXLSTIFYIVLYSILGSVFNIELILNLGLGSLSIFFIVEY |
Ga0307518_104497771 | 3300031838 | Ectomycorrhiza | SYIVSYLNLGSALGIELVLMSDLGLGSLSIFFIVEYQSF |
Ga0307518_105105431 | 3300031838 | Ectomycorrhiza | LLSAVFYIISYSSLGLVLGIELVLILDLGLSSLSIFFIVGY |
Ga0307518_105106792 | 3300031838 | Ectomycorrhiza | SEFKSSLVSYIVFYLILDLIINIKLILDLGLGFLSILFIIKY |
Ga0307518_105610711 | 3300031838 | Ectomycorrhiza | MSRVLSKLLLSTVSYIVPYLILGLVLGIELVLNSGSGSLSIFFIVKYQSF |
Ga0307518_106029291 | 3300031838 | Ectomycorrhiza | MWIFKMLNELKSSLVSYIISYLILSLVLNIELVLNSGLSSLSIPFIIEY |
Ga0307507_10000018107 | 3300033179 | Ectomycorrhiza | VLSGLRLSLVSYIVLGLVLGLVLDIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000001857 | 3300033179 | Ectomycorrhiza | VLSKLKLSLVSYVVSYLGLGLVLSIELVLDLGSGSLSILFIIEY |
Ga0307507_1000002651 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYTVSYLGLGLVLSIELVLDLGLGSLSILFIVEY |
Ga0307507_1000004153 | 3300033179 | Ectomycorrhiza | MLRVLGKLLLSIVSYMVSYSILGLVLGIELVLGIELVLDLGLGSLSILFIV |
Ga0307507_1000004324 | 3300033179 | Ectomycorrhiza | MFKVLSKLRLSLVSYIVSYLGLGLVLVTELVLDLGLGSLSILFIVEY |
Ga0307507_1000004752 | 3300033179 | Ectomycorrhiza | MVSYLGLSLVLGIELVLDLGSGSLSILFIVEYQLF |
Ga0307507_100000499 | 3300033179 | Ectomycorrhiza | MSKVLSKLKSSLVSYIVSYSGSSSVLGTELVLDLGSGSLSILFIVEY |
Ga0307507_1000005049 | 3300033179 | Ectomycorrhiza | VLSEIKLFLVFYIVSYLGLGLVLGTELVLNLGLGSLSILFIVKY |
Ga0307507_100000654 | 3300033179 | Ectomycorrhiza | MSKVLSEFKLSLVSYIVSYIVLGSVLGIKLVLDLGLGSLSIFFIVEYQFF |
Ga0307507_1000007915 | 3300033179 | Ectomycorrhiza | VLSKLGLSLVSYIVSYLGSGLVLGIKLVLDLGSGSLSVLFIVEY |
Ga0307507_1000009616 | 3300033179 | Ectomycorrhiza | VLSELKSSLVSYIVSYLGLGLVLDIELVLDLGLGSLSILFIVEY |
Ga0307507_1000011440 | 3300033179 | Ectomycorrhiza | MLSKLKLSLVSYIVSYLALGLVLGIELILDLGLGSLSILFIVKY |
Ga0307507_1000012419 | 3300033179 | Ectomycorrhiza | VLSKLGLSLVSYIVLGLVLGTELVLDLGSGSLSILFIVEY |
Ga0307507_100001253 | 3300033179 | Ectomycorrhiza | MWISKALSGLRSSLVLYTVFYLVLGSVLDIELVLDLGLGSLSIFFIVKY |
Ga0307507_1000013812 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVSYSGLSLVLGIELVLDLDLGSLNILFIVEYQFF |
Ga0307507_1000015148 | 3300033179 | Ectomycorrhiza | MSRVLGKLLLSIVSYIVPYSILDLVLGIELVLGTESVLDSGLGSLSILFIVEYQFF |
Ga0307507_1000016313 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIVEY |
Ga0307507_1000016856 | 3300033179 | Ectomycorrhiza | VLSEFRLSLVSYIVSYSGLSLVLGIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000017810 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVFYLGLGLVLVTELVLDLGSGSLSILFIVEYQFF |
Ga0307507_100001797 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVFYLVLGLVLDIELILDLGLGSLSILFIVEY |
Ga0307507_1000018161 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVSYLGLGLVSSIELVLDLSLGSLSISFIVEYQFF |
Ga0307507_100001903 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVSYLGLGLVLGIELVLDLGLGFLSIPFIIEYQFF |
Ga0307507_1000019725 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVSFLGLGLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_100001987 | 3300033179 | Ectomycorrhiza | VLSGLGLSLVSYVVLGLVLGMELVLDLGLGSLNILFIVEYQFF |
Ga0307507_1000021319 | 3300033179 | Ectomycorrhiza | MSKVLSELRLFLVSYIVSCLGLGSVLVIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000024415 | 3300033179 | Ectomycorrhiza | VLSGLRSSLVSYVVLGLVLDLVLDTELVLDLVLGLVLGAELVLDLGLGSLSILFIVEYQF |
Ga0307507_1000025723 | 3300033179 | Ectomycorrhiza | VLGRLKLSLVSCVVLGLVLDLVLDVELVLNLVLGPVLGIELVLDLGLGSLSILFIVEY |
Ga0307507_1000026912 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVSYIVSYLGLGSVLGTESVLDLGLGSLSIFFMVEYQFF |
Ga0307507_1000027026 | 3300033179 | Ectomycorrhiza | VLGKLLLSIVSYIVPYLISGLVVGIELVLDTELVLDLGLGSLSILFIVEY |
Ga0307507_100002964 | 3300033179 | Ectomycorrhiza | VLSGLRLSLVSYIVLGSVLDTELVLNLGLGSLSILFIVEY |
Ga0307507_100003023 | 3300033179 | Ectomycorrhiza | VLSGLGLSLVSCVVLGLVLDLVLDTELVSDLGSGSLSILFMVEYQFF |
Ga0307507_1000032621 | 3300033179 | Ectomycorrhiza | MSKVSSKLRSSLVSYIVSYLGLGLISVIELVLDLGLGSLSILFIVEY |
Ga0307507_100003631 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVSCLGLGLVLGTELVLDLGLGSVLGTELVLDLGSGSLSILFIIEY |
Ga0307507_100003773 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVSYMVSYLGLGLVLVTELVLDLGLGSLSILFIVEY |
Ga0307507_100003823 | 3300033179 | Ectomycorrhiza | VLGKLRLSLVSYMVSCLDLDLILNIELVLNLGLGSLSILFMVEYQFF |
Ga0307507_1000038321 | 3300033179 | Ectomycorrhiza | MSKVLSKLKLSLVSYMVSYLVLSLVLNTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000038425 | 3300033179 | Ectomycorrhiza | VLSGLRLSLVSYTVSYLVLGLVLDIELVLNLGLVLDLGLGSLSIFFIVEY |
Ga0307507_1000041623 | 3300033179 | Ectomycorrhiza | VLSKLGLSLVSYMVSYLGLSLVLGIKSVLDLGLGSLSILFIIEY |
Ga0307507_1000041912 | 3300033179 | Ectomycorrhiza | MFRVLDKLLSSIVPCMVPYLILGLVLGMELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100004256 | 3300033179 | Ectomycorrhiza | VLSELGLSLVFYIVSYLGLSLVLGIELVLNLGLGSLSILFIVEYQFF |
Ga0307507_1000043011 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYTVSYLGLGLVLSIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000043117 | 3300033179 | Ectomycorrhiza | MSKVLSSLRLSLVSYIVSYLVLVLVLGIELVLDLGLGSLSILFIIEY |
Ga0307507_100004552 | 3300033179 | Ectomycorrhiza | MFKVLSELRLSLVSYIVSYLGLGLVLGTKLVLDLGLGSLSIFFMVEY |
Ga0307507_1000045833 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVSYIVSYSGLGSVLVMELVLDLGLGSLSILFIVEY |
Ga0307507_1000049237 | 3300033179 | Ectomycorrhiza | MSKVLSRFRSPLVSYIVSYLALGLVLGTELVLNLGLGSLSILFIVEYQFF |
Ga0307507_1000051912 | 3300033179 | Ectomycorrhiza | VLSEFRLFLVSYIVSYLGLSLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_1000053940 | 3300033179 | Ectomycorrhiza | MSKVLSEFRLFLVFYIVSYLGLGLVLVTELVLDLGLGSLSILFIVEY |
Ga0307507_100005481 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVSCLGLGLVLVIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000054824 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYMVSYLGSGLVLVTELVLDLGLGSLSILFIVEY |
Ga0307507_1000055112 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVSYLVLGLVLGIELILDLGLGFLSILFIVEY |
Ga0307507_100005643 | 3300033179 | Ectomycorrhiza | MSKVLNKLRLFLVFYMVSYLGLGLVLSIELVLNLGLGSLSILFIVEYQFF |
Ga0307507_1000056666 | 3300033179 | Ectomycorrhiza | VLGKLLLSIVSYIVPCLILGLVVDIELVLDTELVLNLGLGSLSILFIVEY |
Ga0307507_1000056752 | 3300033179 | Ectomycorrhiza | VLVPRLTKSLTSLVSYVVSYLGLGLVLGIELVLDLDSGLVLDTQLVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000057147 | 3300033179 | Ectomycorrhiza | MSKVLSKLGSSLVSYLGLGLVLGIKLVLDLGLGSLSILFIIEY |
Ga0307507_1000057231 | 3300033179 | Ectomycorrhiza | MVFYLGLGLVLGTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000058130 | 3300033179 | Ectomycorrhiza | MWIFKALSGLRLSLVSYTVSYSVLGSVLDTELVLDLGSGSLSIFFMVEY |
Ga0307507_1000064214 | 3300033179 | Ectomycorrhiza | VLSKLRLFLVSYMVSYLGLSLVLGIELVLDLGSGSLSILFMVEYQFF |
Ga0307507_1000064826 | 3300033179 | Ectomycorrhiza | VLSKLKLSLVSYVVSYLGLGSALGIELVLDLDLGSLSILFIVEY |
Ga0307507_1000064829 | 3300033179 | Ectomycorrhiza | VLSKLKLSLVSYIVSYLGLGLVLGIELVLDLGSGSLSILFIVKY |
Ga0307507_1000066411 | 3300033179 | Ectomycorrhiza | VLSEFRLSLVSYIVSYLGLGLVLGIEFILDLGLGSLIILFIVEY |
Ga0307507_1000070010 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIASYLGLGLVLGIELVLDLGLGSLSILFIIEY |
Ga0307507_1000072923 | 3300033179 | Ectomycorrhiza | VLSELRLFLVSYIVLGLVLGTELVLDLGLSPLSILFIVEY |
Ga0307507_1000073930 | 3300033179 | Ectomycorrhiza | VLSGVRSSLVSYAVSCLVLGLVLDIELVLDLESVLDLGLGSLSIFFMVEY |
Ga0307507_1000074815 | 3300033179 | Ectomycorrhiza | VLSKLKLFLVSYVVSCLGLGLVLGTKLVLDLGLGSLSVLFIVEY |
Ga0307507_1000075620 | 3300033179 | Ectomycorrhiza | MVSYLVLGLVLGMELVSGLGLGSLSILFIVEYQFF |
Ga0307507_100008094 | 3300033179 | Ectomycorrhiza | MYRVLGKLLLSMVSYMVSYLILDLVLGIKSVLGTELVLDLGSGSLSILFIVEYQFF |
Ga0307507_100008574 | 3300033179 | Ectomycorrhiza | VLSELGLSLVSYIVSYLGLSLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_1000086314 | 3300033179 | Ectomycorrhiza | MVSYLTLGLVLNTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100008861 | 3300033179 | Ectomycorrhiza | MVSYLGLGLVLDIKLVLNLGIGSLSVFFIVEYQFF |
Ga0307507_100009094 | 3300033179 | Ectomycorrhiza | VLSRLRLSLVSYIVSYLALGLVLGIELVLDLGLGSLSILFIIEY |
Ga0307507_1000092210 | 3300033179 | Ectomycorrhiza | VLSKLKLFLVSYIVSYLTLGLISGIELVLNLGAGSLSILFIVKY |
Ga0307507_1000092514 | 3300033179 | Ectomycorrhiza | VLSELKLSLVSYIVSYLSLGLGIELVLDLGLGSLSIFFIVEYQFF |
Ga0307507_100009292 | 3300033179 | Ectomycorrhiza | MFKVLSELKSSLVSYIVSYSGLGSVLVTELVLNLGSGSSSILFIVKYQFF |
Ga0307507_1000094525 | 3300033179 | Ectomycorrhiza | MSRVLSKLRLSLVSYIVSYLGLGLVLGTELVLDLGLGSLNVLFIVEY |
Ga0307507_100009719 | 3300033179 | Ectomycorrhiza | VLNKLRLFLVSYIVSYLALGLVLSTGLVLDLGAGSLSILFIIKYQFF |
Ga0307507_1000103518 | 3300033179 | Ectomycorrhiza | VLGKLLLSIVSYIVPYLILGLVLDIELVLGIESVLDLGLGSLNILFIVEYQFF |
Ga0307507_100010442 | 3300033179 | Ectomycorrhiza | MSKVLSELRLFLVSYMVSYLGLGLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_1000112719 | 3300033179 | Ectomycorrhiza | VLSELGLSLVSYMVSYLGLSLVLGMELVLDLGSGSLSILFIVEY |
Ga0307507_100011361 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLFLVSYIVSYLALGLVLSIELVLDLGLGSLSVFFIVKY |
Ga0307507_100011398 | 3300033179 | Ectomycorrhiza | MVSYLGLGLVLDTELILDLGSGSLSILFMVEYQFF |
Ga0307507_100011701 | 3300033179 | Ectomycorrhiza | MLSGFRLSLVSYIVLGLVLNPVLDAELVLDLVLGLVLGAKLVLGLGLGSLSILFIVEYQF |
Ga0307507_1000118014 | 3300033179 | Ectomycorrhiza | MLSELKSSLVSCVVSYLGLGLVLGTESVLNLGLGSLSILFIVKYQFF |
Ga0307507_1000118920 | 3300033179 | Ectomycorrhiza | MSKVLSEFKLSLVSYIIYYLVLGLVLGTELVLNLGLGSLSIHFIVEY |
Ga0307507_1000122616 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVFYLGLGLVSSTKLVLDLGSGSLSILFIVEYQFF |
Ga0307507_1000125810 | 3300033179 | Ectomycorrhiza | MFKVLSKLRLSLVSYLALGLVLGTESVLDLDLGSLSILFIVEY |
Ga0307507_100012871 | 3300033179 | Ectomycorrhiza | MSRVLGKLLLSIVSYIVSCLILGLVLGIELVLGTELVLDLSSGSLSILFIVEYQFF |
Ga0307507_1000133112 | 3300033179 | Ectomycorrhiza | VLSGLRLSLVSYIVLGLVLDLVLDAELVLDLVLGLVLGAELILDLDSGSLSILFIVKY |
Ga0307507_1000139122 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVFYMVSYLVLGLILGIELVSDLGLGSLSILFIVEYQFF |
Ga0307507_1000139519 | 3300033179 | Ectomycorrhiza | MLSGLRLSLVSYIVLGLVLGLVLDIKLVLDLGLGSLSILFIVEY |
Ga0307507_100014252 | 3300033179 | Ectomycorrhiza | VLSEFRLSLVSYIVSYSGLSLVLGTELVLDLGLGSLSIFFIVEY |
Ga0307507_100014671 | 3300033179 | Ectomycorrhiza | MVSYLGLGSVLGITLVLDLGSGSLSILFIVKYQFF |
Ga0307507_100015027 | 3300033179 | Ectomycorrhiza | MVLGLVLGLLLDTELVLGLGLGFLSTLFIVEYQFF |
Ga0307507_1000151413 | 3300033179 | Ectomycorrhiza | MSKVLSELKLFLVFYIVSYLVLGLVLGIELVLDLGLGSLSILLIVEYQFF |
Ga0307507_1000154419 | 3300033179 | Ectomycorrhiza | VLSELGLSLVSYIVSYSGLSLVLSIESVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000154811 | 3300033179 | Ectomycorrhiza | MSKVLSELRSSLVSYIVFYLGLGSVLVTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000159110 | 3300033179 | Ectomycorrhiza | MSRVLGKLLLSIVSYIVPCLILGLVLGMELVLDLGLGSLSILFIVEY |
Ga0307507_1000164422 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYTVSYLGLGSVLSIELVLDLGLDSLSILFIIEYQFF |
Ga0307507_100016583 | 3300033179 | Ectomycorrhiza | MSKVLSKFRLSLVSYIVSYLGLDLVLGIELVLNLGIGSLSILFIVEY |
Ga0307507_1000167518 | 3300033179 | Ectomycorrhiza | VLGKLLSSIVSYIVPYLILGLVVSIELVLDMELVSDLGLGSLGILFIVKY |
Ga0307507_100017132 | 3300033179 | Ectomycorrhiza | MVSYLGLGLVLSIELVLDLGSGSLSILFMVEYQFF |
Ga0307507_100017807 | 3300033179 | Ectomycorrhiza | MFRALGKLLSSIVSYIVPYLILGLVLNIELVLGTTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000179815 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVLGLVLGAELVLDLGPGSLSILFIIEY |
Ga0307507_100018146 | 3300033179 | Ectomycorrhiza | MSKVLSKFRSSLVSYIISYLYLGSVLGTELVLDLGLGFLSILFIVEYQFF |
Ga0307507_1000183616 | 3300033179 | Ectomycorrhiza | MWISKVLSGLRLSLVSYTVSYSVSGLVLDIELISDLGLGSLSIFFIIEYQFF |
Ga0307507_100018445 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVFYIVFYLGLGLVLGIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000190613 | 3300033179 | Ectomycorrhiza | MSKVLSKLKLSLVSCIVSCLGLGLVLVTELVLDLGSGSLSILFIVEY |
Ga0307507_100019382 | 3300033179 | Ectomycorrhiza | VLSKLRLFLVSYIVSYLDLDLVLSTELVLDLGSGSLSILFIVEY |
Ga0307507_1000194521 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVSYLGLSLVLGIELVLNLGLGSLSILFIVEY |
Ga0307507_1000200320 | 3300033179 | Ectomycorrhiza | MLRVLGKLLLSIISYIVPCLILGLVLGIELVLSTELVLDLGSGSLSILFIVEY |
Ga0307507_100020066 | 3300033179 | Ectomycorrhiza | MFKVLSKLRLSLVSYIVSYLGLGLVLGIELVLDLGLGFLSIFFIVEY |
Ga0307507_1000208436 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVSYLGLGLVLGIELVSDSGSGSLSIFFIVEY |
Ga0307507_100022121 | 3300033179 | Ectomycorrhiza | MSKVSSKLKLSLVSYIVSYSGLGLVLVTELVSDLGSGSLSILFIVEY |
Ga0307507_1000223413 | 3300033179 | Ectomycorrhiza | VLSEFRLSLVSYIVFYLGLGLVLGIELVLDLDLGSLSILFIVEYQFF |
Ga0307507_100022552 | 3300033179 | Ectomycorrhiza | VLSKFRLSLVSYLVLSLILGIELVLDLSLGSLNILFIVEY |
Ga0307507_100022947 | 3300033179 | Ectomycorrhiza | MVSYLGLSSVLGTELVLDLNSGSLSILFIVEYQFFWYFYMLS |
Ga0307507_1000232642 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIVE |
Ga0307507_100023432 | 3300033179 | Ectomycorrhiza | MFKVLSKLKLSLVSYVVSYLALALVLGIELILDLGLGSLNILFIVKY |
Ga0307507_100024331 | 3300033179 | Ectomycorrhiza | VLSELRLFLVSYIVSYLVSYSVLDLMLNIELVLNLGSGSLSIFFIVEY |
Ga0307507_100025743 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLFLVFYIVSYLGLGLVLGIELVLDLGLGSLSILFMVEYQFF |
Ga0307507_100025956 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVSYLGLSLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_100026062 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVLGLVLGTESVLDLGLGSLSILFIVEY |
Ga0307507_100028474 | 3300033179 | Ectomycorrhiza | VLSELRLFLVSYIVSYLGLSLVLGIELVLDLGLGSLSIFFIVEYQFF |
Ga0307507_100028676 | 3300033179 | Ectomycorrhiza | MVFYLDLGLVLSMELVLDLGLGSLSILFMVEYQFF |
Ga0307507_100028914 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVSYLGLGSVLVIELVLDLGLGSLSILFIVEY |
Ga0307507_100028979 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVSYIVSYLGLGLVLGIELVLNLGLGSLSILFIVEY |
Ga0307507_100029509 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVSYLGLGLILGIELVLDLGLGFLSILFIVEY |
Ga0307507_100029863 | 3300033179 | Ectomycorrhiza | MLSGLRLSLVSYTVSYLVLGLVLDIKLVLDLGLGSLSILFIVEYQFF |
Ga0307507_1000303926 | 3300033179 | Ectomycorrhiza | MWISKVLSGLRLSLVSYIVLGLVLGIELVLDLGLGSLSILFIVEY |
Ga0307507_100030795 | 3300033179 | Ectomycorrhiza | MWIFKVLSELRLFLVSYIVSYLGLSLVLGIELVLDLGLGSLSILFIVKY |
Ga0307507_1000324413 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVSYLGSSLVLGIELVLDLGLGSLSILFIVEY |
Ga0307507_100032601 | 3300033179 | Ectomycorrhiza | MFKVLSKLRLFLVSYIVSYLGLSLVLGIELVLDLGSGSLSILFIVEY |
Ga0307507_100033521 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLFLVFYIVSYLGLGLVLGIELVLDLDLGSLSILFIVKY |
Ga0307507_1000340120 | 3300033179 | Ectomycorrhiza | VLNELRLSLVSYIVSYLGLGLGTELVLNLGLGSLSIFFIVEY |
Ga0307507_100034192 | 3300033179 | Ectomycorrhiza | VSSKLKLSLVSYIVSYLGLGLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_100035303 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVLGLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_1000357610 | 3300033179 | Ectomycorrhiza | VLSKLRSSLVSYIVSYLGLGLDIELILDLDLGSLSILFIVEY |
Ga0307507_100036371 | 3300033179 | Ectomycorrhiza | VLSELKLSLVSYIVSYLGLGLVLGIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100037322 | 3300033179 | Ectomycorrhiza | VLSGLGLSLVSYIVLGLVLGIELVLDLGLGSLSIFFIVEY |
Ga0307507_100037684 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVLGLGLGLVLGIELVLDLGLGSLSILFIVEY |
Ga0307507_100038162 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVFYLGLGLGTELVLDLGLGSLSILFIVKY |
Ga0307507_100038652 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVSYIVSYLGLSLVLGTKSVLDLGSGSLSILFIVEY |
Ga0307507_100039048 | 3300033179 | Ectomycorrhiza | MSKVLNKLRSSLVSYIVFYLGIGLVLGTELVLDLDLGSLNILFIVEYQFF |
Ga0307507_100039495 | 3300033179 | Ectomycorrhiza | MVSYLGLGLVLGIELVLDLSLGSLSILFIVEYQFF |
Ga0307507_100040048 | 3300033179 | Ectomycorrhiza | MSRVLGKLLLSIVSYIVPYLILGLVVGIKLVLDMESVLDLGLGSLSILFIVEYQFF |
Ga0307507_100040322 | 3300033179 | Ectomycorrhiza | VLSKFRLSLVSYIVSYIVLGLVLYTELVLDLDLGSLSILIIVEY |
Ga0307507_100040655 | 3300033179 | Ectomycorrhiza | MSKVLSKLGLSLVSYIVSYLGSSLVLGIELVLDLDLGSLSILFIVKYQFF |
Ga0307507_100041349 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVSYIVFYLGLGLVLGIKLVLDLGLGSLSIFFIVKY |
Ga0307507_100041533 | 3300033179 | Ectomycorrhiza | VLSKLKLFLVSYIVSYLDLGLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_100043015 | 3300033179 | Ectomycorrhiza | VLSKLKSSLVSYIVSYLGLGLVLDTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100044122 | 3300033179 | Ectomycorrhiza | MCKVLSELRLFLAFYIVSYLGLGLVLNIELVLDLGLGSLSILFIVEY |
Ga0307507_100044272 | 3300033179 | Ectomycorrhiza | VLSKLGLSLVSYIVSYLGLSLVLGTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100045358 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIVSYLALGSVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_100045721 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVSYIVFYLGLGLGIELILDLDLGSLSILFIVEYQFF |
Ga0307507_100046011 | 3300033179 | Ectomycorrhiza | MVSYLGLGSVLVTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100046833 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVSYLGLGLVLDIELVLDLGLGSLSILFIIEY |
Ga0307507_100047925 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYIVSYLGLGLVLVTELVLDLGLGSLSILFIVEY |
Ga0307507_1000506610 | 3300033179 | Ectomycorrhiza | VLSKLKLFLVSYIVSYLRLGLVLGIKLVLDIGLGSLSILFIVEYQFF |
Ga0307507_100054335 | 3300033179 | Ectomycorrhiza | VLSKLGLFLVSYIVSYLGSSLVLGIESVLDLGLGSLSILFMVEYQFF |
Ga0307507_100056852 | 3300033179 | Ectomycorrhiza | MVSYLGLGLVLGIELVLNSGLGSLSILFIIEYQFF |
Ga0307507_100056964 | 3300033179 | Ectomycorrhiza | MSRVLNKFLPSIVSYIVPYLALGLVLGIKLVLNLGSGSLSILFIVEYK |
Ga0307507_100058192 | 3300033179 | Ectomycorrhiza | VLSELRLSLVSYIASYLSLGSVLGAELVLDLGLGLGLVLDLGLGSLSILFIVEYQFF |
Ga0307507_100058736 | 3300033179 | Ectomycorrhiza | VLSELKLSLVSYIVSYLGLGLVLGTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100060248 | 3300033179 | Ectomycorrhiza | MSKVLSELKLSLVSYIVSYLGLSLVLGIELVSNLGLGSLSILFIVEYQFF |
Ga0307507_100061995 | 3300033179 | Ectomycorrhiza | MLSKLKLSLVSYIVSSLVLGMVLSIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100064017 | 3300033179 | Ectomycorrhiza | VLGKLLLSIVSYIVLYLILGLVAGIELVLNTELVLDLGLGSLSILFIVEY |
Ga0307507_100064432 | 3300033179 | Ectomycorrhiza | VLSKLKSSLVSYIVSYLGLGLVLGAELVLDLGLGSLSILFIVEY |
Ga0307507_100064591 | 3300033179 | Ectomycorrhiza | MVSCLGLGLVLGTKLVLDLGLGSLSILFIVEYQFF |
Ga0307507_100064753 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYMVSYLGLGLVLGTELVLDLGLGSLNILFIVEYQFF |
Ga0307507_100072963 | 3300033179 | Ectomycorrhiza | VLSKLKLFLVSYIVSYIVLGLVLGIELILDLDLGFLSIFFIVEY |
Ga0307507_100078632 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYIVSCLGLGLVLGIELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100080556 | 3300033179 | Ectomycorrhiza | VLSGLRPSLVSYIVLGLVLNLVLDTELVLDLVLGLVLGIELVSNLGLGSLSILFIVEY |
Ga0307507_100082364 | 3300033179 | Ectomycorrhiza | MVSYLGLGLVLGTESVSDLGSGSLSIFFMVEYQFF |
Ga0307507_100083321 | 3300033179 | Ectomycorrhiza | MSKVLSELRLSLVSYMVSCLGLSLGLGSLSILFIVEY |
Ga0307507_100084941 | 3300033179 | Ectomycorrhiza | VLSELRLFLVSYIVSYLGLGLVLGIELVLNLGLGSLSIHFIVEYQFF |
Ga0307507_100084945 | 3300033179 | Ectomycorrhiza | VLSELGSSLVFYIVSYLGSSSVLGIESVLDLGLGSLSILFIVEY |
Ga0307507_100094422 | 3300033179 | Ectomycorrhiza | MSKVLSELKLSLVSYIVSYLALGLVLGIELVLDLVSGSLSILFIVEY |
Ga0307507_100096846 | 3300033179 | Ectomycorrhiza | VLSELKLSLVSYMVSYLGLSLVLGMELVLDLGLGSLSILFIVEY |
Ga0307507_100103312 | 3300033179 | Ectomycorrhiza | VLSKLRLSLVSYMVFYLGSSLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_100112172 | 3300033179 | Ectomycorrhiza | MVSYLGLSLVLGTELVLDLGSGSLSILFIVEYQFF |
Ga0307507_100115811 | 3300033179 | Ectomycorrhiza | VLSKLRLFLVSYIVSYLGLGLVLGTELVLDLGLGSLSILFMVEYQFF |
Ga0307507_100121013 | 3300033179 | Ectomycorrhiza | MVSYSALGLVLGTESVLDLGLGSLSILFIVKYYFF |
Ga0307507_100141664 | 3300033179 | Ectomycorrhiza | MVSYLGLGSVLSIELVLDLGLGSLSILFIVEYQFS |
Ga0307507_100154355 | 3300033179 | Ectomycorrhiza | MVSYLGLGLVLGTELVLDLGLGSLSILFIVEYQFFW |
Ga0307507_100156733 | 3300033179 | Ectomycorrhiza | MSRVLGKLLLSIVSYIVSYLILGLVLGIELVLSTESVLDLGLGSLSILFIVEY |
Ga0307507_100198811 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLSLVSYMVSYSGLSLVLSTELVLDLGLGSLSILFIVEYQFF |
Ga0307507_100289383 | 3300033179 | Ectomycorrhiza | MSKVLSKLRLFLVSYIVSYLGLSLVLGTELVLDLGLGSLSILFIVEY |
Ga0307507_100417701 | 3300033179 | Ectomycorrhiza | VLGKLLLSIVSYIVPYLILGLVLGIELVLGTESVLDLALGFLSIFFIVEYQFF |
Ga0307507_103884921 | 3300033179 | Ectomycorrhiza | MRISRVLSLLGLSIVSYLTLGSILGIELILGLGLGSLSILFIVKY |
Ga0307507_105074411 | 3300033179 | Ectomycorrhiza | PIIRIFRALGELRLSLVSYIVFFLYLNLGLGSLSIFFIVEYQFF |
Ga0307507_105093261 | 3300033179 | Ectomycorrhiza | GFLASYTSGIAPIMRISRVLSSLRLFMVFYLTLGSVLSTELVLNLGLGSLSIFFIVEYQF |
Ga0307507_105264561 | 3300033179 | Ectomycorrhiza | LSLVSYIVSYLTLGSILGTELVLDLGAGSLSILFIVK |
Ga0307507_105650051 | 3300033179 | Ectomycorrhiza | APIIRIFRVLSSLGLFIVSYLTLGSVLGTELVLDLGSGSLSIFFIVKYQFF |
Ga0307507_106467211 | 3300033179 | Ectomycorrhiza | SYIVSYLTLGSILGTESALDLGLGSLSIFFIVKYQFF |
Ga0307507_106591641 | 3300033179 | Ectomycorrhiza | RVLSKLRLSLVSYIVFYLTLGFILGTELVLNLGLGSLSILFIIEY |
Ga0307507_106841881 | 3300033179 | Ectomycorrhiza | SSLGPSIVSYLTLGSVLGIESVLDLGLGSLSILFIVEYQFFWYFRIRSLDLCLV |
Ga0316214_10232191 | 3300033545 | Roots | VAPIMQISRVSSLFGLSIVSYMVSFLGLGLVLGTELVLDLGSGSLSILFIVGYQSF |
Ga0316212_10673091 | 3300033547 | Roots | SIVSYIVFYLGLGLVLGIELVLDLGLGSLSILFIVGY |
⦗Top⦘ |