NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F004742

Metagenome / Metatranscriptome Family F004742

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F004742
Family Type Metagenome / Metatranscriptome
Number of Sequences 425
Average Sequence Length 43 residues
Representative Sequence MLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Number of Associated Samples 195
Number of Associated Scaffolds 425

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.48 %
% of genes near scaffold ends (potentially truncated) 50.59 %
% of genes from short scaffolds (< 2000 bps) 89.41 %
Associated GOLD sequencing projects 170
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (64.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.471 % of family members)
Environment Ontology (ENVO) Unclassified
(45.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.118 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.71%    β-sheet: 0.00%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 425 Family Scaffolds
PF04392ABC_sub_bind 24.47
PF00239Resolvase 3.29
PF03401TctC 2.59
PF00589Phage_integrase 2.35
PF01436NHL 1.41
PF08281Sigma70_r4_2 0.94
PF10908DUF2778 0.71
PF13185GAF_2 0.71
PF13435Cytochrome_C554 0.47
PF01593Amino_oxidase 0.47
PF16868NMT1_3 0.47
PF07007LprI 0.47
PF00654Voltage_CLC 0.47
PF01068DNA_ligase_A_M 0.47
PF00536SAM_1 0.47
PF13356Arm-DNA-bind_3 0.24
PF00072Response_reg 0.24
PF08238Sel1 0.24
PF01925TauE 0.24
PF13458Peripla_BP_6 0.24
PF00149Metallophos 0.24
PF07369DUF1488 0.24
PF13489Methyltransf_23 0.24
PF09834DUF2061 0.24
PF00107ADH_zinc_N 0.24
PF13545HTH_Crp_2 0.24
PF01402RHH_1 0.24
PF11175DUF2961 0.24
PF08327AHSA1 0.24
PF00211Guanylate_cyc 0.24
PF00872Transposase_mut 0.24
PF00378ECH_1 0.24
PF00248Aldo_ket_red 0.24
PF13467RHH_4 0.24
PF01381HTH_3 0.24
PF02796HTH_7 0.24
PF02690Na_Pi_cotrans 0.24
PF02357NusG 0.24
PF00753Lactamase_B 0.24
PF13374TPR_10 0.24
PF01548DEDD_Tnp_IS110 0.24
PF13442Cytochrome_CBB3 0.24
PF00884Sulfatase 0.24
PF04545Sigma70_r4 0.24
PF03466LysR_substrate 0.24
PF02515CoA_transf_3 0.24

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 425 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 24.47
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 3.29
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 3.29
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.59
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 0.47
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.47
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.47
COG3755Uncharacterized conserved protein YecT, DUF1311 familyFunction unknown [S] 0.47
COG0250Transcription termination/antitermination protein NusGTranscription [K] 0.24
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.24
COG1283Na+/phosphate symporterInorganic ion transport and metabolism [P] 0.24
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.24
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.24
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.24
COG3547TransposaseMobilome: prophages, transposons [X] 0.24


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.00 %
UnclassifiedrootN/A36.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17392207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2774Open in IMG/M
2170459002|F0B48LX02H0QOPNot Available515Open in IMG/M
2170459003|FZ032L002I5GK8Not Available550Open in IMG/M
2170459010|GIO7OMY01BUM35All Organisms → cellular organisms → Bacteria527Open in IMG/M
2189573001|GZR05M101AX28GNot Available513Open in IMG/M
2209111022|2221189187Not Available515Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10012213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2369Open in IMG/M
3300000955|JGI1027J12803_102508074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium741Open in IMG/M
3300002914|JGI25617J43924_10188138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300003911|JGI25405J52794_10071982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria755Open in IMG/M
3300004479|Ga0062595_102016668Not Available558Open in IMG/M
3300004629|Ga0008092_11345518All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300004633|Ga0066395_10689049Not Available606Open in IMG/M
3300005332|Ga0066388_100133662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3031Open in IMG/M
3300005332|Ga0066388_100153379All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium2885Open in IMG/M
3300005332|Ga0066388_100331309All Organisms → cellular organisms → Bacteria → Proteobacteria2168Open in IMG/M
3300005332|Ga0066388_100564777Not Available1765Open in IMG/M
3300005332|Ga0066388_100571461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1757Open in IMG/M
3300005332|Ga0066388_100953774All Organisms → cellular organisms → Bacteria → Proteobacteria1428Open in IMG/M
3300005332|Ga0066388_101067805All Organisms → cellular organisms → Bacteria1362Open in IMG/M
3300005332|Ga0066388_102671928All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300005332|Ga0066388_104059857Not Available746Open in IMG/M
3300005332|Ga0066388_104160852Not Available738Open in IMG/M
3300005332|Ga0066388_104269196All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300005332|Ga0066388_104677269Not Available696Open in IMG/M
3300005332|Ga0066388_105309508Not Available653Open in IMG/M
3300005332|Ga0066388_106345637Not Available596Open in IMG/M
3300005332|Ga0066388_106540243Not Available587Open in IMG/M
3300005332|Ga0066388_106560891All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005332|Ga0066388_107217958Not Available558Open in IMG/M
3300005332|Ga0066388_107472784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300005332|Ga0066388_108611219Not Available507Open in IMG/M
3300005332|Ga0066388_108723525Not Available504Open in IMG/M
3300005340|Ga0070689_102117690Not Available515Open in IMG/M
3300005347|Ga0070668_100855218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria811Open in IMG/M
3300005363|Ga0008090_10155450Not Available543Open in IMG/M
3300005363|Ga0008090_10232799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71126Open in IMG/M
3300005406|Ga0070703_10087566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → Defluviicoccus vanus1074Open in IMG/M
3300005434|Ga0070709_10502933All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300005434|Ga0070709_11294680All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005435|Ga0070714_100461539All Organisms → cellular organisms → Bacteria → Proteobacteria1207Open in IMG/M
3300005435|Ga0070714_101067708Not Available787Open in IMG/M
3300005435|Ga0070714_101427026Not Available676Open in IMG/M
3300005436|Ga0070713_100149413All Organisms → cellular organisms → Bacteria2077Open in IMG/M
3300005436|Ga0070713_102065579All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005437|Ga0070710_10144280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS0021463Open in IMG/M
3300005447|Ga0066689_10627042Not Available677Open in IMG/M
3300005454|Ga0066687_10895353Not Available529Open in IMG/M
3300005456|Ga0070678_100882004Not Available817Open in IMG/M
3300005467|Ga0070706_100032831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC372A004788Open in IMG/M
3300005713|Ga0066905_100135075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1749Open in IMG/M
3300005713|Ga0066905_100402865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1110Open in IMG/M
3300005713|Ga0066905_100405300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1107Open in IMG/M
3300005713|Ga0066905_100492217All Organisms → cellular organisms → Bacteria → Proteobacteria1017Open in IMG/M
3300005713|Ga0066905_100498893All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300005713|Ga0066905_100736379All Organisms → cellular organisms → Bacteria → Proteobacteria849Open in IMG/M
3300005713|Ga0066905_100853969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium793Open in IMG/M
3300005713|Ga0066905_101057861Not Available718Open in IMG/M
3300005713|Ga0066905_101155690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum690Open in IMG/M
3300005713|Ga0066905_101363877Not Available640Open in IMG/M
3300005713|Ga0066905_101609831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria594Open in IMG/M
3300005764|Ga0066903_100116883All Organisms → cellular organisms → Bacteria3687Open in IMG/M
3300005764|Ga0066903_100137939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3457Open in IMG/M
3300005764|Ga0066903_100258537All Organisms → cellular organisms → Bacteria → Proteobacteria2698Open in IMG/M
3300005764|Ga0066903_100274888All Organisms → cellular organisms → Bacteria → Proteobacteria2633Open in IMG/M
3300005764|Ga0066903_100327344Not Available2453Open in IMG/M
3300005764|Ga0066903_100889918Not Available1609Open in IMG/M
3300005764|Ga0066903_100968582Not Available1550Open in IMG/M
3300005764|Ga0066903_101060198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1489Open in IMG/M
3300005764|Ga0066903_101328527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1345Open in IMG/M
3300005764|Ga0066903_101506095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1270Open in IMG/M
3300005764|Ga0066903_101540085All Organisms → cellular organisms → Bacteria1257Open in IMG/M
3300005764|Ga0066903_101652212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1217Open in IMG/M
3300005764|Ga0066903_101728171Not Available1192Open in IMG/M
3300005764|Ga0066903_101769132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1179Open in IMG/M
3300005764|Ga0066903_101928293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1132Open in IMG/M
3300005764|Ga0066903_102698508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria963Open in IMG/M
3300005764|Ga0066903_102915675Not Available927Open in IMG/M
3300005764|Ga0066903_103130260Not Available895Open in IMG/M
3300005764|Ga0066903_104069323All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300005764|Ga0066903_104090141Not Available781Open in IMG/M
3300005764|Ga0066903_104333417All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005764|Ga0066903_104893716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria711Open in IMG/M
3300005764|Ga0066903_105216412Not Available687Open in IMG/M
3300005764|Ga0066903_105288849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria682Open in IMG/M
3300005764|Ga0066903_105316735All Organisms → cellular organisms → Bacteria → Proteobacteria680Open in IMG/M
3300005764|Ga0066903_105343893Not Available678Open in IMG/M
3300005764|Ga0066903_105360825Not Available677Open in IMG/M
3300005764|Ga0066903_106193485Not Available625Open in IMG/M
3300005764|Ga0066903_106210318All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005764|Ga0066903_106416862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium613Open in IMG/M
3300005764|Ga0066903_106511539Not Available608Open in IMG/M
3300005764|Ga0066903_106966851All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005764|Ga0066903_107033498Not Available583Open in IMG/M
3300005764|Ga0066903_107298542Not Available571Open in IMG/M
3300005764|Ga0066903_107509235Not Available562Open in IMG/M
3300005764|Ga0066903_107580605Not Available559Open in IMG/M
3300005764|Ga0066903_107899851Not Available546Open in IMG/M
3300005764|Ga0066903_108001120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300005764|Ga0066903_108310099Not Available530Open in IMG/M
3300005764|Ga0066903_108666383Not Available517Open in IMG/M
3300005764|Ga0066903_108746907Not Available514Open in IMG/M
3300005764|Ga0066903_108888727Not Available509Open in IMG/M
3300005937|Ga0081455_10032021All Organisms → cellular organisms → Bacteria4746Open in IMG/M
3300005937|Ga0081455_10392482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium966Open in IMG/M
3300006028|Ga0070717_10071722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2890Open in IMG/M
3300006175|Ga0070712_100082110All Organisms → cellular organisms → Bacteria2337Open in IMG/M
3300006175|Ga0070712_101104056Not Available688Open in IMG/M
3300006606|Ga0074062_12772799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae628Open in IMG/M
3300006797|Ga0066659_11246215Not Available620Open in IMG/M
3300006800|Ga0066660_11205906Not Available594Open in IMG/M
3300006844|Ga0075428_100103877All Organisms → cellular organisms → Bacteria3098Open in IMG/M
3300006845|Ga0075421_102202187Not Available582Open in IMG/M
3300006845|Ga0075421_102387096Not Available554Open in IMG/M
3300006854|Ga0075425_100480463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1430Open in IMG/M
3300006904|Ga0075424_101760796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300006938|Ga0081245_1008357All Organisms → cellular organisms → Bacteria1445Open in IMG/M
3300006939|Ga0081244_1005241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria563Open in IMG/M
3300006953|Ga0074063_10090464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria799Open in IMG/M
3300006953|Ga0074063_10107892Not Available1794Open in IMG/M
3300006953|Ga0074063_14246019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium766Open in IMG/M
3300007076|Ga0075435_101768326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300007258|Ga0099793_10670385Not Available522Open in IMG/M
3300009100|Ga0075418_10090650All Organisms → cellular organisms → Bacteria3248Open in IMG/M
3300009143|Ga0099792_10068188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1786Open in IMG/M
3300009147|Ga0114129_12490546Not Available619Open in IMG/M
3300009162|Ga0075423_11151201Not Available827Open in IMG/M
3300009174|Ga0105241_11816225Not Available595Open in IMG/M
3300009792|Ga0126374_10345553Not Available1018Open in IMG/M
3300009792|Ga0126374_10492912Not Available881Open in IMG/M
3300009792|Ga0126374_10532772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria853Open in IMG/M
3300009792|Ga0126374_11230583All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300010043|Ga0126380_10486130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria943Open in IMG/M
3300010043|Ga0126380_10576226Not Available881Open in IMG/M
3300010043|Ga0126380_10804436All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300010046|Ga0126384_12345693Not Available516Open in IMG/M
3300010047|Ga0126382_10367558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1109Open in IMG/M
3300010048|Ga0126373_10115641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2502Open in IMG/M
3300010048|Ga0126373_11192049All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300010159|Ga0099796_10356358Not Available632Open in IMG/M
3300010162|Ga0131853_10724429Not Available818Open in IMG/M
3300010358|Ga0126370_11200168All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300010360|Ga0126372_10071566Not Available2471Open in IMG/M
3300010360|Ga0126372_10641150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1027Open in IMG/M
3300010362|Ga0126377_10310040All Organisms → cellular organisms → Bacteria1559Open in IMG/M
3300010366|Ga0126379_10564106All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300010366|Ga0126379_11149778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria882Open in IMG/M
3300010366|Ga0126379_11664752Not Available743Open in IMG/M
3300010366|Ga0126379_12064897Not Available672Open in IMG/M
3300010371|Ga0134125_10331987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1688Open in IMG/M
3300010373|Ga0134128_12983613All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300010375|Ga0105239_12636034All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300010376|Ga0126381_102694263All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300010376|Ga0126381_104635076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300010398|Ga0126383_10167307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2072Open in IMG/M
3300010398|Ga0126383_10378438All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300010398|Ga0126383_10714452All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300010398|Ga0126383_11586591All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300010398|Ga0126383_11737018Not Available713Open in IMG/M
3300010398|Ga0126383_12149428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium645Open in IMG/M
3300010399|Ga0134127_12060042Not Available649Open in IMG/M
3300010868|Ga0124844_1017493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1997Open in IMG/M
3300010868|Ga0124844_1110592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1047Open in IMG/M
3300010868|Ga0124844_1138362All Organisms → cellular organisms → Bacteria → Proteobacteria925Open in IMG/M
3300012105|Ga0153986_1026940Not Available521Open in IMG/M
3300012199|Ga0137383_10223524All Organisms → cellular organisms → Bacteria1380Open in IMG/M
3300012200|Ga0137382_10979465Not Available608Open in IMG/M
3300012201|Ga0137365_10498668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria895Open in IMG/M
3300012202|Ga0137363_11476005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300012205|Ga0137362_11655573Not Available527Open in IMG/M
3300012209|Ga0137379_11095556Not Available702Open in IMG/M
3300012356|Ga0137371_10706995Not Available771Open in IMG/M
3300012359|Ga0137385_11317060Not Available585Open in IMG/M
3300012515|Ga0157338_1027271Not Available706Open in IMG/M
3300012915|Ga0157302_10460572Not Available540Open in IMG/M
3300012918|Ga0137396_11135519Not Available556Open in IMG/M
3300012923|Ga0137359_10367652All Organisms → cellular organisms → Bacteria → Proteobacteria1278Open in IMG/M
3300012924|Ga0137413_10904001All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia youngii686Open in IMG/M
3300012924|Ga0137413_11663934Not Available523Open in IMG/M
3300012948|Ga0126375_12073355Not Available504Open in IMG/M
3300012957|Ga0164303_11300387Not Available538Open in IMG/M
3300012961|Ga0164302_10545840All Organisms → cellular organisms → Bacteria → Proteobacteria828Open in IMG/M
3300012961|Ga0164302_11867455Not Available510Open in IMG/M
3300012971|Ga0126369_10237581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1784Open in IMG/M
3300012971|Ga0126369_10592517All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300012971|Ga0126369_10794791All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300012971|Ga0126369_13647425Not Available504Open in IMG/M
3300012971|Ga0126369_13658335All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300015372|Ga0132256_100610955Not Available1205Open in IMG/M
3300015372|Ga0132256_100682190All Organisms → cellular organisms → Bacteria → Proteobacteria1143Open in IMG/M
3300015373|Ga0132257_100364970All Organisms → cellular organisms → Bacteria → Proteobacteria1748Open in IMG/M
3300015374|Ga0132255_106031096Not Available513Open in IMG/M
3300016270|Ga0182036_10752871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae791Open in IMG/M
3300016294|Ga0182041_10289399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1352Open in IMG/M
3300016294|Ga0182041_11275628All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300016319|Ga0182033_10578348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis973Open in IMG/M
3300016341|Ga0182035_10193735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1601Open in IMG/M
3300016357|Ga0182032_10184618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1574Open in IMG/M
3300016371|Ga0182034_10613413Not Available919Open in IMG/M
3300016371|Ga0182034_11367206All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300016387|Ga0182040_10055293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_72492Open in IMG/M
3300016387|Ga0182040_10132810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1747Open in IMG/M
3300016387|Ga0182040_10405915All Organisms → cellular organisms → Bacteria → Proteobacteria1070Open in IMG/M
3300016387|Ga0182040_11213811Not Available635Open in IMG/M
3300016387|Ga0182040_11574709All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300016404|Ga0182037_10414821All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1112Open in IMG/M
3300016404|Ga0182037_11081999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis701Open in IMG/M
3300016404|Ga0182037_11430215All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300016422|Ga0182039_10072292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_72445Open in IMG/M
3300016422|Ga0182039_10118478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1991Open in IMG/M
3300016422|Ga0182039_10160956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1751Open in IMG/M
3300016422|Ga0182039_10693221All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium897Open in IMG/M
3300016445|Ga0182038_10388208Not Available1167Open in IMG/M
3300016445|Ga0182038_10509094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1028Open in IMG/M
3300016445|Ga0182038_12115109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300018067|Ga0184611_1009936Not Available2678Open in IMG/M
3300018073|Ga0184624_10001476All Organisms → cellular organisms → Bacteria → Proteobacteria6665Open in IMG/M
3300021168|Ga0210406_10504839All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium956Open in IMG/M
3300021178|Ga0210408_10385751Not Available1116Open in IMG/M
3300021344|Ga0193719_10007787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4453Open in IMG/M
3300021432|Ga0210384_10640537Not Available953Open in IMG/M
3300021560|Ga0126371_11804657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria733Open in IMG/M
3300021560|Ga0126371_13823556All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300024288|Ga0179589_10217310Not Available841Open in IMG/M
3300024347|Ga0179591_1120113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2225Open in IMG/M
3300025898|Ga0207692_10003176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6379Open in IMG/M
3300025898|Ga0207692_11108545Not Available524Open in IMG/M
3300025905|Ga0207685_10685882Not Available556Open in IMG/M
3300025910|Ga0207684_10010362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales8205Open in IMG/M
3300025910|Ga0207684_10013981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6934Open in IMG/M
3300025910|Ga0207684_10837069Not Available776Open in IMG/M
3300025915|Ga0207693_11186204Not Available576Open in IMG/M
3300025915|Ga0207693_11425346Not Available513Open in IMG/M
3300025916|Ga0207663_10025678All Organisms → cellular organisms → Bacteria → Proteobacteria3409Open in IMG/M
3300025928|Ga0207700_10222687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1600Open in IMG/M
3300025939|Ga0207665_10221101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1388Open in IMG/M
3300025939|Ga0207665_11385167Not Available560Open in IMG/M
3300025961|Ga0207712_11737354Not Available559Open in IMG/M
3300025972|Ga0207668_11971803Not Available526Open in IMG/M
3300026121|Ga0207683_11347715Not Available660Open in IMG/M
3300026555|Ga0179593_1002027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1842Open in IMG/M
3300027527|Ga0209684_1029570All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300027646|Ga0209466_1007278All Organisms → cellular organisms → Bacteria2343Open in IMG/M
3300027654|Ga0209799_1013026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1796Open in IMG/M
3300027874|Ga0209465_10036997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2312Open in IMG/M
3300027874|Ga0209465_10250110All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300027903|Ga0209488_10523076All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300027909|Ga0209382_10015684All Organisms → cellular organisms → Bacteria9258Open in IMG/M
3300028708|Ga0307295_10007317Not Available2569Open in IMG/M
3300028712|Ga0307285_10010840Not Available1961Open in IMG/M
3300028754|Ga0307297_10016282Not Available2042Open in IMG/M
3300029636|Ga0222749_10619154Not Available592Open in IMG/M
3300031231|Ga0170824_104551030All Organisms → cellular organisms → Bacteria → Proteobacteria647Open in IMG/M
3300031446|Ga0170820_17003454Not Available756Open in IMG/M
3300031474|Ga0170818_106929176All Organisms → cellular organisms → Bacteria → Proteobacteria611Open in IMG/M
3300031543|Ga0318516_10044816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2390Open in IMG/M
3300031543|Ga0318516_10102526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1618Open in IMG/M
3300031543|Ga0318516_10363825Not Available834Open in IMG/M
3300031543|Ga0318516_10889726Not Available501Open in IMG/M
3300031545|Ga0318541_10049748All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300031545|Ga0318541_10160078All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1238Open in IMG/M
3300031545|Ga0318541_10261529All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300031545|Ga0318541_10573448Not Available631Open in IMG/M
3300031545|Ga0318541_10622792All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300031545|Ga0318541_10634069Not Available597Open in IMG/M
3300031546|Ga0318538_10115279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1399Open in IMG/M
3300031546|Ga0318538_10266011All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300031546|Ga0318538_10408988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300031546|Ga0318538_10777915All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031549|Ga0318571_10049800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1244Open in IMG/M
3300031549|Ga0318571_10183289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300031561|Ga0318528_10076261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1733Open in IMG/M
3300031561|Ga0318528_10144663All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300031561|Ga0318528_10560374Not Available613Open in IMG/M
3300031564|Ga0318573_10094517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1527Open in IMG/M
3300031572|Ga0318515_10393570Not Available742Open in IMG/M
3300031573|Ga0310915_10135003Not Available1696Open in IMG/M
3300031573|Ga0310915_10186066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha1448Open in IMG/M
3300031573|Ga0310915_10217532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1339Open in IMG/M
3300031573|Ga0310915_10290803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1154Open in IMG/M
3300031573|Ga0310915_10517440All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300031573|Ga0310915_10864773All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300031573|Ga0310915_11027484Not Available574Open in IMG/M
3300031573|Ga0310915_11093120Not Available554Open in IMG/M
3300031668|Ga0318542_10270445Not Available867Open in IMG/M
3300031668|Ga0318542_10347619Not Available762Open in IMG/M
3300031679|Ga0318561_10694537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria559Open in IMG/M
3300031680|Ga0318574_10252857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1019Open in IMG/M
3300031680|Ga0318574_10938104All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031719|Ga0306917_10133957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1821Open in IMG/M
3300031719|Ga0306917_10215849Not Available1458Open in IMG/M
3300031719|Ga0306917_10282252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1279Open in IMG/M
3300031719|Ga0306917_10836070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria721Open in IMG/M
3300031719|Ga0306917_11114419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300031719|Ga0306917_11299171Not Available563Open in IMG/M
3300031736|Ga0318501_10146543All Organisms → cellular organisms → Bacteria → Proteobacteria1212Open in IMG/M
3300031744|Ga0306918_10256811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1335Open in IMG/M
3300031744|Ga0306918_10282853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1274Open in IMG/M
3300031744|Ga0306918_10545334Not Available908Open in IMG/M
3300031744|Ga0306918_10937850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300031744|Ga0306918_10942880All Organisms → cellular organisms → Bacteria → Proteobacteria671Open in IMG/M
3300031744|Ga0306918_11085302Not Available620Open in IMG/M
3300031747|Ga0318502_10819641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300031748|Ga0318492_10150094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1175Open in IMG/M
3300031748|Ga0318492_10162883All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300031751|Ga0318494_10543756All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300031763|Ga0318537_10111194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1016Open in IMG/M
3300031763|Ga0318537_10128306All Organisms → cellular organisms → Bacteria → Proteobacteria943Open in IMG/M
3300031765|Ga0318554_10056846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2150Open in IMG/M
3300031765|Ga0318554_10544455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria655Open in IMG/M
3300031765|Ga0318554_10558051Not Available646Open in IMG/M
3300031768|Ga0318509_10152635Not Available1274Open in IMG/M
3300031768|Ga0318509_10333902All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria848Open in IMG/M
3300031768|Ga0318509_10544959Not Available647Open in IMG/M
3300031768|Ga0318509_10790543Not Available525Open in IMG/M
3300031770|Ga0318521_10854622All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031771|Ga0318546_10236290Not Available1255Open in IMG/M
3300031778|Ga0318498_10122948Not Available1180Open in IMG/M
3300031782|Ga0318552_10518578All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300031793|Ga0318548_10648522Not Available513Open in IMG/M
3300031794|Ga0318503_10019817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1885Open in IMG/M
3300031794|Ga0318503_10049374Not Available1279Open in IMG/M
3300031796|Ga0318576_10360857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria686Open in IMG/M
3300031799|Ga0318565_10103335All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300031799|Ga0318565_10392991All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300031821|Ga0318567_10152201All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300031833|Ga0310917_10061901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2326Open in IMG/M
3300031845|Ga0318511_10173038All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300031845|Ga0318511_10194052All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. ANT_WB101901Open in IMG/M
3300031845|Ga0318511_10440801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria599Open in IMG/M
3300031846|Ga0318512_10014936All Organisms → cellular organisms → Bacteria3093Open in IMG/M
3300031859|Ga0318527_10141350All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300031879|Ga0306919_10187537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1530Open in IMG/M
3300031879|Ga0306919_10319374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1181Open in IMG/M
3300031879|Ga0306919_10348637Not Available1130Open in IMG/M
3300031879|Ga0306919_10504797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria932Open in IMG/M
3300031879|Ga0306919_10849681All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300031879|Ga0306919_10881635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria686Open in IMG/M
3300031879|Ga0306919_10941501Not Available661Open in IMG/M
3300031879|Ga0306919_11304863Not Available549Open in IMG/M
3300031880|Ga0318544_10249437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300031890|Ga0306925_10059130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4012Open in IMG/M
3300031890|Ga0306925_10220460Not Available2045Open in IMG/M
3300031890|Ga0306925_10272423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1823Open in IMG/M
3300031890|Ga0306925_10672189All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300031890|Ga0306925_10695762All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300031890|Ga0306925_11416996All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300031890|Ga0306925_11902203All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031890|Ga0306925_12191099Not Available514Open in IMG/M
3300031890|Ga0306925_12277292Not Available501Open in IMG/M
3300031896|Ga0318551_10100856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1535Open in IMG/M
3300031897|Ga0318520_10033734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2581Open in IMG/M
3300031897|Ga0318520_10734848All Organisms → cellular organisms → Bacteria → Proteobacteria618Open in IMG/M
3300031897|Ga0318520_10735092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis617Open in IMG/M
3300031897|Ga0318520_11062721Not Available512Open in IMG/M
3300031910|Ga0306923_11238380Not Available795Open in IMG/M
3300031910|Ga0306923_11245669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium792Open in IMG/M
3300031912|Ga0306921_10381971All Organisms → cellular organisms → Bacteria1645Open in IMG/M
3300031912|Ga0306921_11208965All Organisms → cellular organisms → Bacteria → Proteobacteria841Open in IMG/M
3300031912|Ga0306921_11232899All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300031912|Ga0306921_12280142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300031941|Ga0310912_10624796Not Available837Open in IMG/M
3300031942|Ga0310916_10977019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria707Open in IMG/M
3300031942|Ga0310916_11039211All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031945|Ga0310913_10318622Not Available1098Open in IMG/M
3300031945|Ga0310913_10454826All Organisms → cellular organisms → Bacteria → Proteobacteria909Open in IMG/M
3300031945|Ga0310913_11138496Not Available544Open in IMG/M
3300031946|Ga0310910_10123836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1949Open in IMG/M
3300031946|Ga0310910_10212761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1502Open in IMG/M
3300031946|Ga0310910_10311571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1239Open in IMG/M
3300031946|Ga0310910_11221657All Organisms → cellular organisms → Bacteria → Proteobacteria582Open in IMG/M
3300031946|Ga0310910_11271534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300031946|Ga0310910_11338011Not Available552Open in IMG/M
3300031947|Ga0310909_10427807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1111Open in IMG/M
3300031947|Ga0310909_11061648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi659Open in IMG/M
3300031947|Ga0310909_11655229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria506Open in IMG/M
3300031954|Ga0306926_10345350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1840Open in IMG/M
3300031954|Ga0306926_10639697Not Available1295Open in IMG/M
3300031959|Ga0318530_10332998Not Available628Open in IMG/M
3300031959|Ga0318530_10459512All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300031981|Ga0318531_10106005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1241Open in IMG/M
3300032001|Ga0306922_10315127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1679Open in IMG/M
3300032001|Ga0306922_10474289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1335Open in IMG/M
3300032001|Ga0306922_10533786All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300032001|Ga0306922_11067519Not Available829Open in IMG/M
3300032001|Ga0306922_11551775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria660Open in IMG/M
3300032010|Ga0318569_10149619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1074Open in IMG/M
3300032035|Ga0310911_10061007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1990Open in IMG/M
3300032035|Ga0310911_10103711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1562Open in IMG/M
3300032035|Ga0310911_10144418All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300032035|Ga0310911_10411784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium782Open in IMG/M
3300032035|Ga0310911_10494183Not Available709Open in IMG/M
3300032039|Ga0318559_10089890Not Available1349Open in IMG/M
3300032044|Ga0318558_10092612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1405Open in IMG/M
3300032051|Ga0318532_10233388Not Available653Open in IMG/M
3300032063|Ga0318504_10088593Not Available1370Open in IMG/M
3300032064|Ga0318510_10070909Not Available1277Open in IMG/M
3300032066|Ga0318514_10457989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria678Open in IMG/M
3300032068|Ga0318553_10163335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1155Open in IMG/M
3300032068|Ga0318553_10423218All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300032076|Ga0306924_10468497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1438Open in IMG/M
3300032076|Ga0306924_10691111All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300032089|Ga0318525_10522736All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300032090|Ga0318518_10510840All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M
3300032091|Ga0318577_10059213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1735Open in IMG/M
3300032091|Ga0318577_10135923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1166Open in IMG/M
3300032091|Ga0318577_10218594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium912Open in IMG/M
3300032261|Ga0306920_100138563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3622Open in IMG/M
3300032261|Ga0306920_101293696Not Available1049Open in IMG/M
3300032261|Ga0306920_101715296All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300032261|Ga0306920_101968551All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300032261|Ga0306920_102470787All Organisms → cellular organisms → Bacteria → Proteobacteria715Open in IMG/M
3300032261|Ga0306920_103664809Not Available564Open in IMG/M
3300032261|Ga0306920_103911742All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300032261|Ga0306920_103935425Not Available540Open in IMG/M
3300033289|Ga0310914_10381466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1275Open in IMG/M
3300033289|Ga0310914_10410617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1225Open in IMG/M
3300033289|Ga0310914_10546453All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300033289|Ga0310914_10620202All Organisms → cellular organisms → Bacteria → Proteobacteria974Open in IMG/M
3300033289|Ga0310914_10832267All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300033289|Ga0310914_11387407Not Available605Open in IMG/M
3300033289|Ga0310914_11396381Not Available603Open in IMG/M
3300033290|Ga0318519_10140364All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300033290|Ga0318519_10396751All Organisms → cellular organisms → Bacteria → Proteobacteria821Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil19.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.24%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.18%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.41%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.94%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.71%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.71%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.47%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.47%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.24%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.24%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.24%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.24%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.24%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2209111022Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichmentEnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004629Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006938Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A001 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300006939Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010162Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)Host-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300012105Attine ant fungus gardens microbial communities from Georgia, USA - TSGA070 MetaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_017911702088090014SoilMLAEIYILKLEAAVRAVKKAATTASTSRFVPVTLPAAKAS
E1_084599702170459002Grass SoilMLAEIYILRLEAAVRAAKEAATTVSTSRFVPVTLPAKAS
E4A_103115102170459003Grass SoilMLAEIYLLKLEAAVRAAKEAATTATTSRFVPVTLPAAKAS
F62_098993802170459010Grass SoilAEIYLLKLEAAVRAAKATATTVSTSRFVPVTLPAAKAS
FD2_044788802189573001Grass SoilMLAEIYILKLEAAKETATTASTSRFVPVILPAAKAS
22220027432209111022Grass SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAFKAS
AF_2010_repII_A1DRAFT_1001221353300000597Forest SoilLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAAXTASTSRFVPVTLPAGKAS*
JGI1027J12803_10250807413300000955SoilMLAEIYILKLEAAVRAVKKAATTASTSRFVPVTLPAAKAS*
JGI25617J43924_1018813813300002914Grasslands SoilESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS*
JGI25405J52794_1007198223300003911Tabebuia Heterophylla RhizosphereMLAEIYMLKLEAAVRATKEAATAASTSRFVPATLPAAKAS*
Ga0062595_10201666813300004479SoilMEHGRAGGIYLLKLEAAVRAAKGAATAASTSQFVPVTLLAAKAS*
Ga0008092_1134551813300004629Tropical Rainforest SoilMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAKAS*
Ga0066395_1068904913300004633Tropical Forest SoilMLAEIYILKLEAAVRAVKEAANTASTSRFVPVILPAAKAS*
Ga0066388_10013366243300005332Tropical Forest SoilVPAEIYLLKLEAAVQAAKEAATTASTSRFVPVTSPAAKAS*
Ga0066388_10015337943300005332Tropical Forest SoilMLAEIYLQKLEAAVRAAKEAATTASTSRFVPVTLPAKAS*
Ga0066388_10033130933300005332Tropical Forest SoilMLAEIYLLKLEVAVRTAKEAATTASTSRFVPVSLPAAEAS*
Ga0066388_10056477713300005332Tropical Forest SoilAMLAEIYLLKLEAAVRAAKEAATTASTSRLPVTLPAGKAS*
Ga0066388_10057146133300005332Tropical Forest SoilTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTFPAGKAS*
Ga0066388_10095377423300005332Tropical Forest SoilMLAEIYLLKLEAAVWAAKEAATTASTSRFVPVTLPAARAS*
Ga0066388_10106780543300005332Tropical Forest SoilMLAEIYLLKLEATVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0066388_10267192813300005332Tropical Forest SoilMSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPATLPAKAS*
Ga0066388_10405985723300005332Tropical Forest SoilMLAEIYILKPEARVRAVKEAATTASTSRFVPVTLPAAKAS*
Ga0066388_10416085213300005332Tropical Forest SoilMLAEIYLLKLETAVRAAKEAATTAPTSRFVPVTLPALKAS*
Ga0066388_10426919613300005332Tropical Forest SoilMVAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS*
Ga0066388_10467726923300005332Tropical Forest SoilMLAEIYLLKLEAPARAAKEAATTASTSRFVPVTLPAAKAS*
Ga0066388_10530950813300005332Tropical Forest SoilMLVEIYLLKLEAAGRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0066388_10634563723300005332Tropical Forest SoilESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTFPAAKAS*
Ga0066388_10654024323300005332Tropical Forest SoilMPAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS*
Ga0066388_10656089123300005332Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTAPTSRFVPVTLPAGKAS*
Ga0066388_10721795813300005332Tropical Forest SoilQVNRKLGPLTKRQSTPRSTAMLAEIYMLKLEAAVRATKEAATAVSTSRFVPATLPAAKAS
Ga0066388_10747278423300005332Tropical Forest SoilMLAEIYLLKLEAAVRAAKEPATTAVTSRFVPVTLPAAKAS*
Ga0066388_10861121913300005332Tropical Forest SoilMLAEICLLKLEAAVRAAKEAATTAPTSRFVPVTLPAAEAPVFHR
Ga0066388_10872352513300005332Tropical Forest SoilMLAEIYLLKLEATVRAAKEAATTTSTSRFVPVTLPAAKAS*
Ga0070689_10211769013300005340Switchgrass RhizosphereMLAEICLLKLEEAVRAAKEAATTASTSRFVPVTLPAKAS*
Ga0070668_10085521813300005347Switchgrass RhizosphereMCTAMMAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAVKAS*
Ga0008090_1015545013300005363Tropical Rainforest SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS*
Ga0008090_1023279913300005363Tropical Rainforest SoilSSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPPSRFVPVTLPAGKAS*
Ga0070703_1008756613300005406Corn, Switchgrass And Miscanthus RhizosphereMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0070709_1050293323300005434Corn, Switchgrass And Miscanthus RhizosphereMLAEIYMKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS*
Ga0070709_1129468013300005434Corn, Switchgrass And Miscanthus RhizosphereVCPQLAEIYLLKLEAAVRAAKEAAATASTSRFVPVTLPAA
Ga0070714_10046153923300005435Agricultural SoilVLAEIYLPKLEAAVRAAKGAATTPSTSRFVPVTLPATKAS*
Ga0070714_10106770823300005435Agricultural SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0070714_10142702623300005435Agricultural SoilVCPQLAEIYLLKLEAAVRAAKEAAATASTSRFVPVTLPAAEAS*
Ga0070713_10014941323300005436Corn, Switchgrass And Miscanthus RhizosphereVNRKLGSTAMLAEIYILKLEAAVRAAKEAATTAATSRFVPVTLPAAKAS*
Ga0070713_10206557913300005436Corn, Switchgrass And Miscanthus RhizosphereRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0070710_1014428023300005437Corn, Switchgrass And Miscanthus RhizosphereMLAEIYILKLEAAVRAAKEAATTAATSRFVPVTLPAAKAS*
Ga0066689_1062704213300005447SoilMLAEIYLLELEAAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0066687_1089535323300005454SoilMLAEIYLLKLEAAVRAAKEAATAASTSRFVPVTSPAAQAS*
Ga0070678_10088200413300005456Miscanthus RhizosphereMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS*
Ga0070706_10003283153300005467Corn, Switchgrass And Miscanthus RhizosphereMLAEIYLLELEAAVRAAKEAAITASTSRFVPVTLPAAKAS*
Ga0066905_10013507523300005713Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAVATASTSRFVPVTLPAAKAS*
Ga0066905_10040286523300005713Tropical Forest SoilMLAEIYLLKLEAAGRAAKEAATTASTSRFVPVTLPAKAS*
Ga0066905_10040530023300005713Tropical Forest SoilMLAEIYLLKLEAAARAAKEAATTASTSRFVPVTLPAGKAS*
Ga0066905_10049221713300005713Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAASTASTSRFVPVTLPAAKAS*
Ga0066905_10049889323300005713Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPA
Ga0066905_10073637913300005713Tropical Forest SoilLGPLTKRQSTPRSTAMLAEIYMLKLEAAVRATKEAATAASTSRFVPATLPAAKAS*
Ga0066905_10085396923300005713Tropical Forest SoilMLAEIYLLKLEAAMRAAKEAATTASTSRFVPVTLPATKAS*
Ga0066905_10105786113300005713Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFMPVTLPAAKAS*
Ga0066905_10115569023300005713Tropical Forest SoilMLAEIYLLKLEAAARAAKEGATTASTSRFVPVTLPAGKAS*
Ga0066905_10136387713300005713Tropical Forest SoilMLAEIYLLKLEAAVRAAKETAATASTSRFVPVTLPAATS*
Ga0066905_10160983113300005713Tropical Forest SoilMLAEIYLLKLEAAVRATKEAATTAPTSRFVPVTLPAAKAS*
Ga0066903_10011688343300005764Tropical Forest SoilMLAEMYLLKLEAAVRAAKEAATTASTSRFVPVTLP*
Ga0066903_10013793933300005764Tropical Forest SoilMAMLAEIYILKIEAAVRAVKEAATTASTSRFMPVTLPAAEAS*
Ga0066903_10025853733300005764Tropical Forest SoilWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPDAKAS*
Ga0066903_10027488873300005764Tropical Forest SoilMLAGIYLLRLEAAVRAAKEAATTAPTSRFVPITLPTAQAS*
Ga0066903_10032734443300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAP*
Ga0066903_10088991813300005764Tropical Forest SoilVNEKLGPPTDIYLLKLEAPVRAAKEAATTASTSRFVPVTLLAAKVS*
Ga0066903_10096858223300005764Tropical Forest SoilMLAEIYLLKLETAVRAAKEAASTSRFVPVILPAAKAS*
Ga0066903_10106019813300005764Tropical Forest SoilLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0066903_10132852723300005764Tropical Forest SoilMLAEIYLLKLEAAVRAVKEAATTASTSRFVAVTLPAAKAS*
Ga0066903_10150609523300005764Tropical Forest SoilMLAEIYLLKLEAAREAVTTAATSRFVPVTLPAAKAS*
Ga0066903_10154008513300005764Tropical Forest SoilTAMLAEIYLLKLEAAVRAAKETAATASTSRFVPVTLPAKAS*
Ga0066903_10165221223300005764Tropical Forest SoilMLAEIYILKLEAAVRAMKEAATTASTSRFVPVILPAAKAS*
Ga0066903_10172817123300005764Tropical Forest SoilMLAEIYLLMLEAAVRAAKEAATTAPTSRFEPAAKAS*
Ga0066903_10176913223300005764Tropical Forest SoilMGTAVLAEIYLPAKEAATTASTSRFVPVTLPAAKAS*
Ga0066903_10192829323300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAVTTASTSRFVPVTLPAAKAS*
Ga0066903_10269850823300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAASTAPTSRFVPVTLPAAKAS*
Ga0066903_10291567523300005764Tropical Forest SoilMLAEIYLLKLEAAVRTAKEAATTAPTSRFVPVTLPAAKAS*
Ga0066903_10313026023300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTFPAAKAS*
Ga0066903_10406932323300005764Tropical Forest SoilMLAEIYMLKLEAAVRAAKEAATTAPTSRFVPVTSPAANAP*
Ga0066903_10409014123300005764Tropical Forest SoilMLAEIYLVKLEAAVRAAKEAATTAWTPRFVPVTLPAAKAS*
Ga0066903_10433341713300005764Tropical Forest SoilMLAEIYLLKLEATVRAAKEAATTASTLRFVPVTLPAAKAS*
Ga0066903_10489371623300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTAPTSRFVPVTLPAANAS*
Ga0066903_10521641213300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLP
Ga0066903_10528884913300005764Tropical Forest SoilMLAEIYLVKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0066903_10531673513300005764Tropical Forest SoilQSTRSTAMLAEIYLLKLEAAVRAAKESATAASTSRFVPATVPAAKAS*
Ga0066903_10534389313300005764Tropical Forest SoilMLAENYLLKLEAAVRAAKEAATTAPTSRFVPVTLSAAKAS*
Ga0066903_10536082513300005764Tropical Forest SoilTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRLPVTLPAGKAS*
Ga0066903_10619348523300005764Tropical Forest SoilLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFVPVTLPAKAS*
Ga0066903_10621031813300005764Tropical Forest SoilMLAEIYILKLEAAVRAVKEAATPASASRFVPVTLPAGKAS*
Ga0066903_10641686213300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLP
Ga0066903_10651153923300005764Tropical Forest SoilMLAEIYLLKLEVAVRAAKETATTASTSRFVPVTLPAGKAS*
Ga0066903_10696685113300005764Tropical Forest SoilSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTLRFVPVTLPAGKAS*
Ga0066903_10703349813300005764Tropical Forest SoilWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFVPVTLPAGKAS*
Ga0066903_10729854213300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKETATTASRFVPVTLPAAKAS*
Ga0066903_10750923513300005764Tropical Forest SoilMLAEMYLLKLEAAVRAAKEAATTASTSRFVPVILPAGKAS*
Ga0066903_10758060523300005764Tropical Forest SoilMLAEIYLLKLDAAVRAAKEAATSRFVPVTLPAGKAS*
Ga0066903_10789985123300005764Tropical Forest SoilMLAEIYLLNLEAAVRAAKETATTASTSRFVPVTLPAAKAS*
Ga0066903_10800112013300005764Tropical Forest SoilMLAEIYLLKLEAAVRTAKEAATTASTSRFVPVTLPAGKAS*
Ga0066903_10831009913300005764Tropical Forest SoilMSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVP
Ga0066903_10866638323300005764Tropical Forest SoilTESSALPTNRQSTPWSTAMLAGIYLLKLEAAVRAAKEAATTAPTSRFVPVILPAAKAT*
Ga0066903_10874690713300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPG*
Ga0066903_10888872713300005764Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAAATASTSRFVPVTLPAGKAS*
Ga0081455_1003202143300005937Tabebuia Heterophylla RhizosphereMLAEIYLLKLEAAVRAAKETAATASTSRFVPVTLPAAKASLTTLLGGAAV*
Ga0081455_1039248213300005937Tabebuia Heterophylla RhizosphereMLAEIYLLKLEAAVRAAKETAATASTSRFVPVTLPAAKAS*
Ga0070717_1007172263300006028Corn, Switchgrass And Miscanthus RhizosphereMLAEICLLKLEEAVRAAKEAATTASTSRFVPVTLPA
Ga0070712_10008211033300006175Corn, Switchgrass And Miscanthus RhizosphereMLAEIYILKLEAAVRAAKEATTPLSTSRFVPVTLPAAKAS*
Ga0070712_10110405613300006175Corn, Switchgrass And Miscanthus RhizosphereMLAEIYLLKLGAAVRAAKEAATTAPTSRFVPVTLPAAKAS*
Ga0074062_1277279913300006606SoilMLAEIYLLKLEAVVRAKEAATTGSTSRFVPVTLPAAKAS*
Ga0066659_1124621513300006797SoilMLAEIYLLKLEAAVRAAKEAATTASTLRFVPVTLPAAKAS*
Ga0066660_1120590613300006800SoilMLAEIFLLKLEAAVRAAKEAATTASTSRFVPVTLPAA
Ga0075428_10010387753300006844Populus RhizosphereMLAEIYLLKLEAAVRAATEAAATASTSRFVPVTLPAAKAS*
Ga0075421_10220218723300006845Populus RhizosphereAEIYLLKLEATVRAAKEAAATAATSRFVPVTLPAAKAS*
Ga0075421_10238709623300006845Populus RhizosphereMLAEIFVLKLEAKVREGKDAASTASSSRFVPVTLPVVKAS*
Ga0075425_10048046333300006854Populus RhizosphereSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0075424_10176079613300006904Populus RhizosphereWSTAMLAEIYLLKLEAAVRAAKEAATTAATSRFVPVTLSAAKAS*
Ga0081245_100835733300006938Tropical Rainforest SoilMLAEIYLLKLEAAVRAAKEAAITASTSRFVPVTLPAGKAS*
Ga0081244_100524123300006939Tropical Rainforest SoilWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0074063_1009046423300006953SoilMLAEIYLLKLEAAVRAANEAATTASTSRFVPVIVAAGKAS*
Ga0074063_1010789213300006953SoilMLAEIYLQKLEAAVRAAKEAATTASTSRFVPVTLPA
Ga0074063_1424601913300006953SoilTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAASTSQFVPVTLPAGKAS*
Ga0075435_10176832613300007076Populus RhizosphereLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0099793_1067038513300007258Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAATTALTPRFVPVTLPAAKAS*
Ga0075418_1009065013300009100Populus RhizospherePWSTAMLAEIYLLKLEAAVRAATEAAATASTSRFVPVTLPAAKAS*
Ga0099792_1006818833300009143Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAF*
Ga0114129_1249054623300009147Populus RhizosphereMLAEIFVLKLEAKVREGKDAASTASSSRFVPVTLPVLKAS*
Ga0075423_1115120113300009162Populus RhizosphereMLAEIYLLKLEAAVRAATEAAATASTSRFVPVTLPAAKAT*
Ga0105241_1181622513300009174Corn RhizosphereMLAEIYILKLEAAVRATKEAATTAPTSRFVPVTLPAAKAS*
Ga0126374_1034555313300009792Tropical Forest SoilALPTNRQSAPWSMAMLAETYILKLEAAVRAVKEAATIASTSRFVPVTLPAKAS*
Ga0126374_1049291213300009792Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTAPTSRFVPVTLPAAKAS*
Ga0126374_1053277223300009792Tropical Forest SoilMAMLAEIYLLKLEAAVRAAKESATAASTSRFVPATLPAAKAS*
Ga0126374_1123058323300009792Tropical Forest SoilMLAEIYLLKLETAVRAAKEAATAASTSRFVPATLPAAKAS*
Ga0126380_1048613023300010043Tropical Forest SoilMLAEIYLLKLEAAVRAAKESATAASTSRFVPATLPAAKAS*
Ga0126380_1057622623300010043Tropical Forest SoilMLAEIFMLRLEATARAAKEAATTISTSRFVPVTLPVAKT*
Ga0126380_1080443613300010043Tropical Forest SoilTPWSTAMPAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS*
Ga0126384_1234569313300010046Tropical Forest SoilMLAEIYLLKFEAAVRAAKEAATTVTTSRFVPVTLPAAKTS*
Ga0126382_1036755833300010047Tropical Forest SoilMLAEIYILKLEAAVRAAKEAATSASTSRFVPITLPAAKAS*
Ga0126373_1011564133300010048Tropical Forest SoilTAMLAEIYLLKLEAAVRAAKETATTASRFVPVTLPAAKAS*
Ga0126373_1119204913300010048Tropical Forest SoilMPAEIYLLKLEAAVRAAKEAATTAPTSRFVPVTLP
Ga0099796_1035635813300010159Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVPLPAAKAS*
Ga0131853_1072442923300010162Termite GutMLPEIYLLKLEAAVRAAKEAATTASTSRFVLVTLPAGKAS*
Ga0126370_1120016813300010358Tropical Forest SoilWSTAMLAEIYLLKLEAAVRAAKETATTASTSRFVPATLPAKAS*
Ga0126372_1007156653300010360Tropical Forest SoilALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTLRFVPVTLPAAKAS*
Ga0126372_1064115023300010360Tropical Forest SoilEIYLLKLEATVRSAKEAATTASTSRFVPVTLPAAKAS*
Ga0126377_1031004043300010362Tropical Forest SoilMLAEIYLLKLVATVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0126379_1056410623300010366Tropical Forest SoilAEIYLLKLEAAVRAAKETATTASRFVPVTLPAAKAS*
Ga0126379_1114977813300010366Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAVTTAATSRFVPVTLPAAKAS*
Ga0126379_1166475213300010366Tropical Forest SoilMLAEMYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0126379_1206489713300010366Tropical Forest SoilAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAKAS*
Ga0134125_1033198713300010371Terrestrial SoilHGSTAMLAEIYMKLEAAVRAAKESATTASTSRFVPVTLPTAKAS*
Ga0134128_1298361313300010373Terrestrial SoilIYLLKLDAAVRAAKEAATTASTSRFVPVTLPTAKAS*
Ga0105239_1263603413300010375Corn RhizosphereWSTAMLAEIYILKLEAAVRAVKKAATTASTSRFVPVTLPAAKAS*
Ga0126381_10269426323300010376Tropical Forest SoilMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAAKAS*
Ga0126381_10463507613300010376Tropical Forest SoilPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0126383_1016730713300010398Tropical Forest SoilIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0126383_1037843813300010398Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAEAS*
Ga0126383_1071445233300010398Tropical Forest SoilMLAEMYLLKLEAAVRAAKEAATTASTSRFVLVTLP*
Ga0126383_1158659113300010398Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATAASTSRFVPVTLPAAKAS*
Ga0126383_1173701833300010398Tropical Forest SoilMLAEIYLLKLDAAVRAANEAATTASTSRFVPVTLPAAKAS*
Ga0126383_1214942813300010398Tropical Forest SoilSSALPTNRQSTPWSTAMLAEIYMLKLEAAVRAAKEAATTASTSRFVPVTLSAGKAS*
Ga0134127_1206004213300010399Terrestrial SoilMLAEIYLLKLEAAVRAAKGAATAASTSQFVPVTLLAAKAS*
Ga0124844_101749333300010868Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTAPTSRFVPVILPAAKAS*
Ga0124844_111059223300010868Tropical Forest SoilMLAEIYLLKLEAAIRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0124844_113836233300010868Tropical Forest SoilMLAEIYLLKLEAAVRAAKESATAASTSRFVPATVPAAKAS*
Ga0153986_102694013300012105Attine Ant Fungus GardensMLAEIYLLKLEAAVRPAKEAATTASTSRFVPVTLPAAKAS*
Ga0137383_1022352423300012199Vadose Zone SoilMLAEIYLLKRAAKEAVTTASTSRFVPVTLPAAKAF*
Ga0137382_1097946513300012200Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAATTASISRLVPVTLPAAKAS*
Ga0137365_1049866823300012201Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTFPAGKAS*
Ga0137363_1147600513300012202Vadose Zone SoilRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS*
Ga0137362_1165557313300012205Vadose Zone SoilMLAEILAAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0137379_1109555613300012209Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAATTASTSGFVPVTLPAGKAS*
Ga0137371_1070699513300012356Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAF*
Ga0137385_1131706023300012359Vadose Zone SoilANNRQSTSSSPAMPAEIYLLKLEAAVQADNEAATTASTSRFVPVTLPAAKAF*
Ga0157338_102727123300012515Arabidopsis RhizosphereMLAEIFLLKLEAAVRAAKEAASGASTSRFVPVTLPAATAS*
Ga0157302_1046057213300012915SoilMLAEIYLLKLEAAVRAAKEAATIGSTSRFVPVTLPAAKAS*
Ga0137396_1113551913300012918Vadose Zone SoilMDTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0137359_1036765223300012923Vadose Zone SoilYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS*
Ga0137413_1090400123300012924Vadose Zone SoilMLAEIYLLKLEPAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0137413_1166393413300012924Vadose Zone SoilMLAEIYILKLEAAVRAAKEAATTASTSRFVPVPLPAAKAS*
Ga0126375_1207335513300012948Tropical Forest SoilMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAGKAS*
Ga0164303_1130038713300012957SoilMLAEIYLLKLEAAVRAAKEAATTAATSRFVPVTFPAAKAS*
Ga0164302_1054584023300012961SoilMLSEIYLLKLEAAVRAAKEAATTAATSRFVPVTFPAAKAS*
Ga0164302_1186745513300012961SoilMLAEIYLLKLEAAVRAAKKAATTAPTSRFVPVTLPAAKAS*
Ga0126369_1023758143300012971Tropical Forest SoilLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0126369_1059251713300012971Tropical Forest SoilMLVEIYLLKLEAAGRAAKEAATTASTSRFVPVTLPAKAS*
Ga0126369_1079479123300012971Tropical Forest SoilMLAEIYILKLEAAVRAVKEAANTASTSRFVPVILPAAKAS
Ga0126369_1364742513300012971Tropical Forest SoilLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPGAKAS*
Ga0126369_1365833513300012971Tropical Forest SoilWSTAMLAEIYLLKLEAAVRAAKETATTASRFVPVTLPAAKAS*
Ga0132256_10061095513300015372Arabidopsis RhizosphereTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS*
Ga0132256_10068219023300015372Arabidopsis RhizosphereMLAEIYILKLEAAVRAAKEAATTASTSRFVSVALPTAKAS*
Ga0132257_10036497043300015373Arabidopsis RhizosphereMLAEIYILKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS*
Ga0132255_10603109613300015374Arabidopsis RhizosphereMLAEISLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS*
Ga0182036_1075287113300016270SoilSSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKESATTASTSRFVPVTLPAAMAS
Ga0182041_1028939913300016294SoilTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0182041_1127562823300016294SoilNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0182033_1057834823300016319SoilMLAEIYLLKLEATVRAAKEAATTASTSRFVLVTLPAAKAS
Ga0182035_1019373533300016341SoilPTNRQSTPWSTAMLAESYLLKLEAAVRAAKETATTASRFVPVTLPAAKAS
Ga0182032_1018461833300016357SoilPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0182034_1061341313300016371SoilMLAEIYLLKREAAVRAAKETATTASTSRFVPVTLPAKAS
Ga0182034_1136720613300016371SoilTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVQAATTASTSRFVPVTLPAAKAS
Ga0182040_1005529313300016387SoilLPTNRQSTPWSTAMLAEIYLLKLEAGVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0182040_1013281033300016387SoilPWSTAMLAEIYLLKLEAAVRAAKEAATTASISRLVPVTLPAAKAS
Ga0182040_1040591513300016387SoilRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0182040_1121381113300016387SoilMLAEIYLVKLEAAVRSAKETATTASTSRFVPITLP
Ga0182040_1157470913300016387SoilTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAGKAS
Ga0182037_1041482113300016404SoilSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKESATTASTSRFVPVTLPAAMAS
Ga0182037_1108199923300016404SoilRQSTPWSTAMLAEIYLLKLEATVRAAKEAATTASTSRFVLVTLPAAKAS
Ga0182037_1143021513300016404SoilNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAGKAS
Ga0182039_1007229253300016422SoilSALPTNRQSTPWSTAMLAEIYLLKLEAGVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0182039_1011847813300016422SoilPTNRQSTPWSTAMLAEIYLLKLEAAAGAAKEAATTASTSRFVPITLPAGKAS
Ga0182039_1016095633300016422SoilAMLAEIYLLKLEVAVRAAKEAATTASTLRFVPVTLPAGKAS
Ga0182039_1069322133300016422SoilMLAEIYLLKLEAAVRAAKEAATTASISRPVPVTLPSAKAS
Ga0182038_1038820813300016445SoilTNCQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTPVTLPAPKAS
Ga0182038_1050909423300016445SoilAESYLLKLEAAVRAAKETATTASRFVPVTLPAAKAS
Ga0182038_1211510913300016445SoilTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0184611_100993643300018067Groundwater SedimentMLAEIYLLTLEAAVRAAKEAATTASTSRFVPVTLPTAKAS
Ga0184624_1000147663300018073Groundwater SedimentSALPTNCQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS
Ga0210406_1050483923300021168SoilMLAEIYLLKLEAAVRAANEAATTASTSRFVPVIVAAGKAS
Ga0210408_1038575133300021178SoilLAEIFILKLEAAVRAAKEAATTAPTSRFVPVTLPAAKAS
Ga0193719_1000778753300021344SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS
Ga0210384_1064053743300021432SoilATLAEIFILKLEAAVRAAKEAATTAPTSRFVPVTLPAAKAS
Ga0126371_1180465723300021560Tropical Forest SoilMLAEIYLLKLEVAVRAAKQAATTASTSRFVPVTLPAGKASNPRLP
Ga0126371_1382355613300021560Tropical Forest SoilMMAEIYLLKLEAAVRAAKEAATTAATSQFVPVTLPAPKAS
Ga0179589_1021731013300024288Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAF
Ga0179591_112011323300024347Vadose Zone SoilVLAEIYLLKLEAAVRAAKEAATIVSTSRFVPVTLPAGKAS
Ga0207692_1000317653300025898Corn, Switchgrass And Miscanthus RhizosphereMLAEIYMKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS
Ga0207692_1110854513300025898Corn, Switchgrass And Miscanthus RhizosphereVLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0207685_1068588223300025905Corn, Switchgrass And Miscanthus RhizosphereMLAEIYILKLEAAVRAAKEAATTAATSRFVPVTLPAAKAS
Ga0207684_1001036293300025910Corn, Switchgrass And Miscanthus RhizosphereMLAEICLLKLEEAVRAAKEAATTASTSRFVPVTLPAKAS
Ga0207684_1001398163300025910Corn, Switchgrass And Miscanthus RhizosphereMLAEIYLLELEAAVRAAKEAAITASTSRFVPVTLPAAKAS
Ga0207684_1083706913300025910Corn, Switchgrass And Miscanthus RhizosphereMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0207693_1118620413300025915Corn, Switchgrass And Miscanthus RhizosphereMEHGRAGGIYLLKLEAAVRAAKGAATAASTSQFVPVTLLAAKAS
Ga0207693_1142534623300025915Corn, Switchgrass And Miscanthus RhizosphereMLAEIYLLKLGAAVRAAKEAATTAPTSRFVPVTLPAAKAS
Ga0207663_1002567843300025916Corn, Switchgrass And Miscanthus RhizosphereMLAEIYILKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0207700_1022268733300025928Corn, Switchgrass And Miscanthus RhizosphereAPPCPAILAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0207665_1022110133300025939Corn, Switchgrass And Miscanthus RhizosphereSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0207665_1138516713300025939Corn, Switchgrass And Miscanthus RhizosphereMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVIPAAKAS
Ga0207712_1173735413300025961Switchgrass RhizosphereMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAVKAS
Ga0207668_1197180323300025972Switchgrass RhizosphereMCTAMMAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAVKAS
Ga0207683_1134771523300026121Miscanthus RhizosphereVLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS
Ga0179593_100202723300026555Vadose Zone SoilMLAEIYILRLEAAVRAAKEAATTVSTSRFVPVTLPAAKAS
Ga0209684_102957023300027527Tropical Forest SoilMLAEIYLLKLEAAVRAAKEAATTASTLRFVPVTLPAAKAS
Ga0209466_100727823300027646Tropical Forest SoilMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAKAS
Ga0209799_101302643300027654Tropical Forest SoilMLAEIYLLKLEAAVRAANEAATTASTSRFVPVTLPAAKAS
Ga0209465_1003699733300027874Tropical Forest SoilIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0209465_1025011013300027874Tropical Forest SoilIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0209488_1052307613300027903Vadose Zone SoilMLAEIYLLKLEAAVRAAKEAAITASTSRFVPVTLPAAKSS
Ga0209382_1001568453300027909Populus RhizosphereMLAEIYLLKLEAAVRAATEAAATASTSRFVPVTLPAAKAS
Ga0307295_1000731713300028708SoilCQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS
Ga0307285_1001084023300028712SoilYLLKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS
Ga0307297_1001628213300028754SoilESSALPTNCQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPTAKAS
Ga0222749_1061915413300029636SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAATAS
Ga0170824_10455103013300031231Forest SoilMLAEIYLLKLEAAVRAAKEAAIMAATSRFVPVTLPAAKAS
Ga0170820_1700345413300031446Forest SoilMLAEIYLLKLEAAVRAAKEAATTAPTSRFVPVTLPAAKAS
Ga0170818_10692917623300031474Forest SoilMPAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0318516_1004481633300031543SoilTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTPVTLPAPKAS
Ga0318516_1010252633300031543SoilPPCPLTDQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0318516_1036382513300031543SoilMLAEIYLLKLEAAVRAAKEAATTALTSRFVPVTLPAGKAS
Ga0318516_1088972613300031543SoilMLAEIYLLKLEAAVRAAKEAATTASTPRFVPVTLPAAKAS
Ga0318541_1004974843300031545SoilMLAEIYLLKLEAAVRAAKEAATMASTSRFVPVTLPAGKAS
Ga0318541_1016007823300031545SoilRQSTPWSTAILAEIYLLKLEAAVRAAKETATTAPTSRFVPVTLPAAKAS
Ga0318541_1026152913300031545SoilRQSTPWSTAMLAESYLLKLEAAVRAAKETATTASRFVPVTLPAAKAS
Ga0318541_1057344813300031545SoilMLAEIYLLKLEAGVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0318541_1062279223300031545SoilAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0318541_1063406913300031545SoilMLAEIYLLKLEAAVQAATTASTSRFVPVTLPAAKAS
Ga0318538_1011527933300031546SoilYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0318538_1026601123300031546SoilLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0318538_1040898823300031546SoilMLAEIYLLKLEAAVRAAKEAATTASISRLVPVTLPAAKAS
Ga0318538_1077791523300031546SoilRLPTNRQSTPWSTAMLAEIYLLKLAAAVRAAKEAATTASTSWFVPVTLPAAKAS
Ga0318571_1004980023300031549SoilMLAEIYLLKLEAAVRAAKETATAASTSRFVPVTLPAKAS
Ga0318571_1018328923300031549SoilALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAKAS
Ga0318528_1007626133300031561SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKALPQRPATASVVG
Ga0318528_1014466323300031561SoilMLAEIYLLKLEAAMRAAKEAATTASTSRFVPVTLPAAAKAS
Ga0318528_1056037413300031561SoilMLAEIYLLKLEVAVRAAKEAATTASTLRFVPVTLPAGKAS
Ga0318573_1009451713300031564SoilSTPWSTAMLAEIYILKLKAAVRAVKETATTTSTSQFVPVTLPAKAS
Ga0318515_1039357013300031572SoilMLAEIYPLKLEAAVRATKEAATTASTSRFVLVTLRAAKAS
Ga0310915_1013500343300031573SoilLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTPVTLPAAKAS
Ga0310915_1018606623300031573SoilSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0310915_1021753223300031573SoilMLAEIYLLKLEAAVRAAKESATTASTSRFVPVTLPAAMAS
Ga0310915_1029080323300031573SoilMLAEIYRLKLEAAVRAAKEAATTASTSRFVPVTLPAGK
Ga0310915_1051744023300031573SoilMLAEIYLLKLEVAVRAAKEAATTASTLWFVPVTLPAAKAS
Ga0310915_1086477313300031573SoilMLAEIYLLKLAAAVRAAKEAATTASTSWFVPVTLPAAKAS
Ga0310915_1102748413300031573SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAGKAS
Ga0310915_1109312013300031573SoilMLAEIYLLKLEAGVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0318542_1027044513300031668SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLQ
Ga0318542_1034761923300031668SoilTRWSTAMLAEIYLLKLEAAVRAAKEAATMASTSRFVPVTLPAGKAS
Ga0318561_1069453723300031679SoilWSTAMLAEIYLLKLEAAMRAAKEAATTASTSRFVPVTLPAAAKAS
Ga0318574_1025285723300031680SoilPWSTAMLAEIYLLKLEVAVRAAKEAATTASTLRFVPVTLPAGKAS
Ga0318574_1093810413300031680SoilPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0306917_1013395733300031719SoilNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0306917_1021584913300031719SoilMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAAKAS
Ga0306917_1028225213300031719SoilIYLLKLEAAVRAAKETATTASTSRFAPVTLPAKAS
Ga0306917_1083607013300031719SoilMLAEIYLLKLEAAVRAAKEAATTAPTSRFVPVTLPAGKAS
Ga0306917_1111441913300031719SoilMLAEIYLLMLKLEAAAGAAKEAATTASTSRFVPITLPAGKAS
Ga0306917_1129917123300031719SoilMLAEIYLLKPEAAVRAAKETATTASTSRFVPVTLPAGKAS
Ga0318501_1014654323300031736SoilMLAEIYILKLKAAVRAVKETATTTSTSQFVPVTLPAKAS
Ga0306918_1025681133300031744SoilLAEIYLLKLEAAAGAAKEAATTASTSRFVPITLPAGKAS
Ga0306918_1028285323300031744SoilTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0306918_1054533413300031744SoilTAMLAEIYLLKLEAAVRAAKEAATMASTSRFVPVTLPAGKAS
Ga0306918_1093785013300031744SoilALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0306918_1094288023300031744SoilQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAKAS
Ga0306918_1108530213300031744SoilSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAAATASTSRFVPVTLPAGKAS
Ga0318502_1081964123300031747SoilSALPTNRQSTPWSTAMLAEIYLLKLEAAVQAATTASTSRFVPVTLPAAKAS
Ga0318492_1015009433300031748SoilSWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0318492_1016288323300031748SoilQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTPVTLPAPKAS
Ga0318494_1054375613300031751SoilMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPA
Ga0318537_1011119423300031763SoilSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0318537_1012830613300031763SoilTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAANEAATTTPTSRFVPVSLPAAKAS
Ga0318554_1005684653300031765SoilMLAEIYLLKLEAAVRAAKEAAATASTSRFVPVTLPAGKAS
Ga0318554_1054445523300031765SoilSALPTNCQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTPVTLPAPKAS
Ga0318554_1055805113300031765SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAK
Ga0318509_1015263513300031768SoilPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKALPQRPATASVVG
Ga0318509_1033390213300031768SoilMLAEIYLLKLEAAMRAAREAATTASTSRFVPVTLPAAAKAS
Ga0318509_1054495913300031768SoilQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0318509_1079054323300031768SoilHSTAWSTAMLAEIYLLKLEATVRAAKEAATTASTSRFVLVTLPAAKAS
Ga0318521_1085462223300031770SoilPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAGKAS
Ga0318546_1023629013300031771SoilALPTNRQSTPWSTAMLAEIYLLKLEAAVRAANEAATTTPTSRFVPVSLPAAKAS
Ga0318498_1012294813300031778SoilAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS
Ga0318552_1051857823300031782SoilRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAGKAS
Ga0318548_1064852213300031793SoilSALPTHRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTPRFVPVTLPAAKAS
Ga0318503_1001981713300031794SoilNCQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTPVTLPAPKAS
Ga0318503_1004937423300031794SoilPTNRQSTPWSTAMLAEIYLLKLEAAVRAANEAATTTPTSRFVPVSLPAAKAS
Ga0318576_1036085723300031796SoilGAAASALPTNRQSTPWSTAMLAEIYLLKLEVAVRAAKEAATTASTLRFVPVTLPAGKAS
Ga0318565_1010333513300031799SoilQSTQWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKTS
Ga0318565_1039299123300031799SoilSSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0318567_1015220113300031821SoilKIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0310917_1006190113300031833SoilPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAF
Ga0318511_1017303813300031845SoilHSTPWSTAMLAEIYLVKLEAAVRAAKETATTASTSRFVPITLPAGKAS
Ga0318511_1019405233300031845SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKASYPPLPS
Ga0318511_1044080113300031845SoilNRQSTPWSTAMLAEIYLLKLEAAVRAANEAATTTLTSRFVPVSLPAAKAS
Ga0318512_1001493613300031846SoilTESSALPTNRQSTPWSTAMLAEIYILKLEAAVRAVKETATTTSTSQFVPVTLPAKAS
Ga0318527_1014135013300031859SoilSTPWSTAMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAKAS
Ga0306919_1018753733300031879SoilMLAESYLLKLEAAVRAAKETATTASRFVPVTLPAAKAS
Ga0306919_1031937413300031879SoilTAMLAENYLLKLEAAVRAAKEAATTASTSRFVPVTSPAAKAS
Ga0306919_1034863713300031879SoilLAEIYLLKLEAAVRAAKEAATTALTSRFVPVTLPAGKAS
Ga0306919_1050479713300031879SoilMLAEIYLLKLEAAVRAVKEAATAAPTSRFVPVTLPAAKA
Ga0306919_1084968113300031879SoilTNRQSTPWSMAMLAEIYLLKLEVAVRAAKEAATTASTLWFVPVTLPAAKAS
Ga0306919_1088163513300031879SoilMLAEMYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0306919_1094150123300031879SoilMLAEIYPLKLEAAVRAAKEAATTAPTSRFVPVTLPAGKAS
Ga0306919_1130486313300031879SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKTS
Ga0318544_1024943723300031880SoilMLAEIYLVKLEAAVRAAKETATTASTSRFVPITLPAGKAS
Ga0306925_1005913013300031890SoilTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0306925_1022046043300031890SoilMLAEIYLLKLEAAVRAANEAATTTPTSRFVPVSLPAAKAS
Ga0306925_1027242333300031890SoilMLAEIYLLKLEAAARAAKEAAITASTSRLVPVTLPAGKAS
Ga0306925_1067218923300031890SoilMLAEIYLLKLEAAVRAVKEAATAAPTSRFVPVTLPAAKAS
Ga0306925_1069576223300031890SoilMLAEIYLLKLEAAVRAAEEAATTASTSRFVPVTFPAAKAS
Ga0306925_1120742713300031890SoilRRAAAASEPKAPPLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAGKAS
Ga0306925_1141699623300031890SoilMLAEIYLLKLEAAVRSAKEAATTASTWRFVPVTLPASKAS
Ga0306925_1190220323300031890SoilMLAEIYLLKLEASVRAAKEAATTAPTSRFVPVTLPAAKTS
Ga0306925_1219109913300031890SoilMLAEIYLLKLEAVVRAAKEAATTAPTSRFVPVTLPAAKAS
Ga0306925_1227729213300031890SoilMLAEIFILKLEAAVRAAKEAATAASTSRFVPVTLPAAKA
Ga0318551_1010085613300031896SoilPWSTAMLAEIYILKLEAAVRAVKETATTTSTSQFVPVTLPAKAS
Ga0318520_1003373443300031897SoilPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0318520_1073484823300031897SoilNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTALTSRFVPVTLPAGKAS
Ga0318520_1073509223300031897SoilGKRTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVQAATTASTSRFVPVTLPAAKAS
Ga0318520_1106272113300031897SoilPWSTAMLAEIYLLKLEAAARAAKEAAITASTSRLVPVTLPAGKAS
Ga0306923_1123838013300031910SoilMLAEIFILKLEAAVRAAKEAATAASTSRFVPVTLPAAKAS
Ga0306923_1124566913300031910SoilIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS
Ga0306921_1038197113300031912SoilMLAEIYRLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0306921_1120896513300031912SoilMLAEIYLLNLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0306921_1123289913300031912SoilMLAEIYLLKLEAAVRAAKEAATTALTSRFVPVTFPAPKAS
Ga0306921_1228014213300031912SoilIYLLKLEAAVRAAKETATTASTSRFVPVTLPAGKAS
Ga0310912_1062479613300031941SoilMLAEIYLVKLEAAVRAAKESATTASTSRFVPITLPAGKAS
Ga0310916_1097701923300031942SoilQSTPRSTAMLAEIYILKLEAVVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0310916_1103921123300031942SoilMLAEIYLLKLEVRAAKEAVTTASTSRFVLVTLPAGKAS
Ga0310913_1031862213300031945SoilSSALPTNRQSTRWSTAMLAEIYLLKLEAAVRAAKEAATMASTSRFVPVTLPAGKAS
Ga0310913_1045482613300031945SoilQSTPWSTAMLAEIYLLKLEAAVRAANEAATTTPTSRFVPVSLPAAKAS
Ga0310913_1113849613300031945SoilTESSALPTNRQDTSWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0310910_1012383643300031946SoilWSTAMLAEIFILKLEAAVRAAKEAATAASTSRFVPVTLPAAKAS
Ga0310910_1021276133300031946SoilLAEIYLLKLEAAVRAAKEAATTASISRLVPVTLPAAKAS
Ga0310910_1031157123300031946SoilMLAEIYRLKLEAAVRAAKEAATTASTSRFVPVTLPAGKA
Ga0310910_1122165713300031946SoilTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTALTSRFVPVTLPAGKAS
Ga0310910_1127153413300031946SoilSTPWSTAMLAEIYLLKLEAAVRAAEEAATTASTSRFVPVTSPAAKAS
Ga0310910_1133801123300031946SoilLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVRR
Ga0310909_1042780713300031947SoilTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAAATASTSRFVPVTLPAGKAS
Ga0310909_1106164813300031947SoilSTPWSTAMLAEIYLLKLEAAVRAAKEAATTALTSRFVPVTLPAGKAS
Ga0310909_1165522913300031947SoilPTKRQSTPWSTAMLAEIYLLKLEAAVRAAKEAAITASTSRFVPITLPAAKAS
Ga0306926_1034535033300031954SoilTESSALPTHRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTPRFVPVTLPAAKAS
Ga0306926_1063969713300031954SoilRQSTPWSTAMLAEIYLLKLEAAVRAANEAATTTPTSRFVPVSLPAAKAS
Ga0318530_1033299813300031959SoilQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0318530_1045951213300031959SoilAEIYLLKLEAAVRAAKEAATTALTSRFVPVTLPAGKAS
Ga0318531_1010600523300031981SoilNRQSTPWSTAMLAEMYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0306922_1031512713300032001SoilSTPWSTAMLAEIYLLKLEVAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0306922_1047428913300032001SoilEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0306922_1053378613300032001SoilTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0306922_1106751913300032001SoilTESSALPTNRQSTRWSTAMLAEIYLLKLEAAVRAAKEAATMASTSRFVPVTLPAGKAS
Ga0306922_1155177523300032001SoilLAEIYLLKLEAAVRAAKEAATTAWTSRFVPVTLPAGKVS
Ga0318569_1014961943300032010SoilQSTPWSTAMLAEIYLLKLEAAVRAAKEAAATASTSRFVPVTLPAGKAS
Ga0310911_1006100743300032035SoilRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0310911_1010371133300032035SoilWSTAMLAEIYLLKLEAAVRAAKEVATTASTSRFVPVRR
Ga0310911_1014441823300032035SoilIYLLKLEAAAGAAKEAATTASTSRFVPITLPAGKAS
Ga0310911_1041178413300032035SoilSSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAAATASTSRFVPVTLPAGKAS
Ga0310911_1049418313300032035SoilWSTAMLAEIYLLKLEAAARAAKEAAITASTSRLVPVTLPAGKAS
Ga0318559_1008989013300032039SoilMLAEIYLLKLEAAVRAANEAATTTLTSRFVPVSLPAAKAS
Ga0318558_1009261213300032044SoilPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS
Ga0318532_1023338823300032051SoilSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAKAS
Ga0318504_1008859313300032063SoilTESSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAKAS
Ga0318510_1007090913300032064SoilQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0318514_1045798913300032066SoilMLAEIYLLKLEAAVRAAKEAAITASTSRFVPITLPAAKAS
Ga0318553_1016333523300032068SoilSALATNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTPVTLPAPKAS
Ga0318553_1042321823300032068SoilTNRQSTRWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0306924_1046849733300032076SoilAMLAEIDPLKLEAAVRATKEAATTASTSRFVLVTLRAAKAS
Ga0306924_1069111123300032076SoilQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTLRFVPVTLPAGKAS
Ga0318525_1052273623300032089SoilSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKALPQRPATASVVG
Ga0318518_1051084013300032090SoilWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAGKAS
Ga0318577_1005921313300032091SoilPPMPTNRQSTQWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKTS
Ga0318577_1013592333300032091SoilLTVRAHPWSTAMLAEIYLLKLEVAVRAAKEAATTASTLRFVPVTLPAGKAS
Ga0318577_1021859433300032091SoilRQSTPWSTAMLAEIYLLKLAAAVRAAKEAATTASTSWFVPVTLPAAKAS
Ga0306920_10013856313300032261SoilMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0306920_10129369613300032261SoilMLAEIYLLMLEAAVRAAKEAATTAPTSRFEPAAKAS
Ga0306920_10171529613300032261SoilSSALPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAAKAS
Ga0306920_10196855113300032261SoilLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAGKAS
Ga0306920_10247078713300032261SoilEIYPLKLEAAVRATKEAATTASTSRFVLVTLRAAKAS
Ga0306920_10366480913300032261SoilTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFAPVTLPAKAS
Ga0306920_10391174223300032261SoilWSTAMLAEIYLLKLEAAVRAAKETATTASTSRFVPVTLPAKAS
Ga0306920_10393542513300032261SoilMLAEIYLLKLEAVVRAAKEAATTAPTSRFVPVTLPAAKA
Ga0310914_1038146613300033289SoilMLAEIYILKLEAAVRAVKEAATTASTSRFVPVILPAAKAF
Ga0310914_1041061723300033289SoilLPTNRQSTPWSTAMLAEIYLLKLEAAVRAAKEAATTAPTSRFAPVTLPAAKAS
Ga0310914_1054645313300033289SoilNRQSTQWSTAMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKTS
Ga0310914_1062020213300033289SoilMLAEIYLLKLEAAVRAGKEAATTASTSRFVPVTLP
Ga0310914_1083226713300033289SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKALP
Ga0310914_1138740723300033289SoilYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKAS
Ga0310914_1139638123300033289SoilMLAEIYLLKLEAAVRAEKETATTASTSRFVPVTLPAAKAS
Ga0318519_1014036413300033290SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVAVTLPAAKAS
Ga0318519_1039675123300033290SoilMLAEIYLLKLEAAVRAAKEAATTASTSRFVPVTLPAAKALPQRPA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.