 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F004745 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 425 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MDAVRAKLKQAILYIERNPKLVRSITSFPYIVNSL |
| Number of Associated Samples | 251 |
| Number of Associated Scaffolds | 425 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.18 % |
| % of genes near scaffold ends (potentially truncated) | 82.59 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 234 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.824 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.353 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.059 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.588 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.44% β-sheet: 0.00% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 425 Family Scaffolds |
|---|---|---|
| PF13358 | DDE_3 | 2.35 |
| PF04392 | ABC_sub_bind | 1.88 |
| PF13592 | HTH_33 | 1.41 |
| PF03401 | TctC | 1.18 |
| PF02371 | Transposase_20 | 1.18 |
| PF00078 | RVT_1 | 1.18 |
| PF01494 | FAD_binding_3 | 0.94 |
| PF13340 | DUF4096 | 0.94 |
| PF00005 | ABC_tran | 0.71 |
| PF02899 | Phage_int_SAM_1 | 0.71 |
| PF05598 | DUF772 | 0.71 |
| PF13701 | DDE_Tnp_1_4 | 0.71 |
| PF13551 | HTH_29 | 0.71 |
| PF03466 | LysR_substrate | 0.71 |
| PF00873 | ACR_tran | 0.47 |
| PF13545 | HTH_Crp_2 | 0.47 |
| PF13586 | DDE_Tnp_1_2 | 0.47 |
| PF00211 | Guanylate_cyc | 0.47 |
| PF04909 | Amidohydro_2 | 0.47 |
| PF02518 | HATPase_c | 0.47 |
| PF03050 | DDE_Tnp_IS66 | 0.47 |
| PF01627 | Hpt | 0.47 |
| PF02586 | SRAP | 0.47 |
| PF08388 | GIIM | 0.47 |
| PF02265 | S1-P1_nuclease | 0.47 |
| PF00313 | CSD | 0.47 |
| PF13531 | SBP_bac_11 | 0.47 |
| PF00072 | Response_reg | 0.47 |
| PF13361 | UvrD_C | 0.47 |
| PF13442 | Cytochrome_CBB3 | 0.47 |
| PF01609 | DDE_Tnp_1 | 0.47 |
| PF00296 | Bac_luciferase | 0.47 |
| PF13751 | DDE_Tnp_1_6 | 0.47 |
| PF00768 | Peptidase_S11 | 0.24 |
| PF00753 | Lactamase_B | 0.24 |
| PF07883 | Cupin_2 | 0.24 |
| PF13480 | Acetyltransf_6 | 0.24 |
| PF06532 | NrsF | 0.24 |
| PF13245 | AAA_19 | 0.24 |
| PF10397 | ADSL_C | 0.24 |
| PF03641 | Lysine_decarbox | 0.24 |
| PF13185 | GAF_2 | 0.24 |
| PF09195 | Endonuc-BglII | 0.24 |
| PF05853 | BKACE | 0.24 |
| PF13495 | Phage_int_SAM_4 | 0.24 |
| PF13408 | Zn_ribbon_recom | 0.24 |
| PF00581 | Rhodanese | 0.24 |
| PF05068 | MtlR | 0.24 |
| PF12802 | MarR_2 | 0.24 |
| PF01475 | FUR | 0.24 |
| PF00213 | OSCP | 0.24 |
| PF04367 | DUF502 | 0.24 |
| PF03781 | FGE-sulfatase | 0.24 |
| PF06707 | DUF1194 | 0.24 |
| PF04226 | Transgly_assoc | 0.24 |
| PF07183 | DUF1403 | 0.24 |
| PF00665 | rve | 0.24 |
| PF03237 | Terminase_6N | 0.24 |
| PF13189 | Cytidylate_kin2 | 0.24 |
| PF00589 | Phage_integrase | 0.24 |
| PF13414 | TPR_11 | 0.24 |
| PF00664 | ABC_membrane | 0.24 |
| PF01695 | IstB_IS21 | 0.24 |
| PF12860 | PAS_7 | 0.24 |
| PF07676 | PD40 | 0.24 |
| PF00069 | Pkinase | 0.24 |
| PF00690 | Cation_ATPase_N | 0.24 |
| PF02738 | MoCoBD_1 | 0.24 |
| PF03808 | Glyco_tran_WecG | 0.24 |
| PF01047 | MarR | 0.24 |
| PF12710 | HAD | 0.24 |
| PF14430 | Imm1 | 0.24 |
| PF13817 | DDE_Tnp_IS66_C | 0.24 |
| PF03734 | YkuD | 0.24 |
| PF02627 | CMD | 0.24 |
| PF13561 | adh_short_C2 | 0.24 |
| PF14690 | zf-ISL3 | 0.24 |
| PF13410 | GST_C_2 | 0.24 |
| PF02775 | TPP_enzyme_C | 0.24 |
| PF01522 | Polysacc_deac_1 | 0.24 |
| PF02705 | K_trans | 0.24 |
| PF14659 | Phage_int_SAM_3 | 0.24 |
| PF13565 | HTH_32 | 0.24 |
| PF00359 | PTS_EIIA_2 | 0.24 |
| PF01717 | Meth_synt_2 | 0.24 |
| PF06808 | DctM | 0.24 |
| PF02195 | ParBc | 0.24 |
| PF02668 | TauD | 0.24 |
| PF00067 | p450 | 0.24 |
| PF05988 | DUF899 | 0.24 |
| PF03924 | CHASE | 0.24 |
| PF01053 | Cys_Met_Meta_PP | 0.24 |
| PF07719 | TPR_2 | 0.24 |
| PF01625 | PMSR | 0.24 |
| PF08241 | Methyltransf_11 | 0.24 |
| PF07508 | Recombinase | 0.24 |
| PF09360 | zf-CDGSH | 0.24 |
| PF00171 | Aldedh | 0.24 |
| PF01797 | Y1_Tnp | 0.24 |
| PF05724 | TPMT | 0.24 |
| PF01370 | Epimerase | 0.24 |
| PF02245 | Pur_DNA_glyco | 0.24 |
| PF03358 | FMN_red | 0.24 |
| PF12071 | DUF3551 | 0.24 |
| PF06411 | HdeA | 0.24 |
| PF00400 | WD40 | 0.24 |
| PF00696 | AA_kinase | 0.24 |
| PF06983 | 3-dmu-9_3-mt | 0.24 |
| PF01402 | RHH_1 | 0.24 |
| PF14319 | Zn_Tnp_IS91 | 0.24 |
| PF02566 | OsmC | 0.24 |
| PF07238 | PilZ | 0.24 |
| PF12536 | DUF3734 | 0.24 |
| PF12848 | ABC_tran_Xtn | 0.24 |
| PF00378 | ECH_1 | 0.24 |
| PF07969 | Amidohydro_3 | 0.24 |
| PF06048 | DUF927 | 0.24 |
| PF01061 | ABC2_membrane | 0.24 |
| PF13677 | MotB_plug | 0.24 |
| PF13683 | rve_3 | 0.24 |
| PF01259 | SAICAR_synt | 0.24 |
| PF13505 | OMP_b-brl | 0.24 |
| PF12697 | Abhydrolase_6 | 0.24 |
| PF03315 | SDH_beta | 0.24 |
| PF01179 | Cu_amine_oxid | 0.24 |
| PF13924 | Lipocalin_5 | 0.24 |
| PF01841 | Transglut_core | 0.24 |
| PF02653 | BPD_transp_2 | 0.24 |
| PF00490 | ALAD | 0.24 |
| PF13458 | Peripla_BP_6 | 0.24 |
| PF00583 | Acetyltransf_1 | 0.24 |
| PF13276 | HTH_21 | 0.24 |
| PF04138 | GtrA | 0.24 |
| PF04885 | Stig1 | 0.24 |
| PF00903 | Glyoxalase | 0.24 |
| PF16576 | HlyD_D23 | 0.24 |
| PF00486 | Trans_reg_C | 0.24 |
| PF07045 | DUF1330 | 0.24 |
| PF05050 | Methyltransf_21 | 0.24 |
| PF04986 | Y2_Tnp | 0.24 |
| PF00872 | Transposase_mut | 0.24 |
| PF12727 | PBP_like | 0.24 |
| PF00180 | Iso_dh | 0.24 |
| PF00528 | BPD_transp_1 | 0.24 |
| PF13614 | AAA_31 | 0.24 |
| PF03288 | Pox_D5 | 0.24 |
| PF13181 | TPR_8 | 0.24 |
| PF01965 | DJ-1_PfpI | 0.24 |
| PF01058 | Oxidored_q6 | 0.24 |
| COG ID | Name | Functional Category | % Frequency in 425 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.88 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.88 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.18 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.18 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 0.94 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.94 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.94 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.94 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.71 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.71 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.47 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.47 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.47 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.47 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.47 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.47 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.47 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.24 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.24 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 0.24 |
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 0.24 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.24 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.24 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.24 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.24 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.24 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.24 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.24 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.24 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.24 |
| COG0712 | FoF1-type ATP synthase, delta subunit | Energy production and conversion [C] | 0.24 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.24 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.24 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.24 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.24 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.24 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.24 |
| COG1760 | L-serine deaminase | Amino acid transport and metabolism [E] | 0.24 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.24 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.24 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.24 |
| COG1922 | UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.24 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.24 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.24 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.24 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.24 |
| COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 0.24 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.24 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.24 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.24 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.24 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.24 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.24 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.24 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.24 |
| COG2928 | Uncharacterized membrane protein | Function unknown [S] | 0.24 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.24 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.24 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.24 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.24 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.24 |
| COG3378 | DNA primase, phage- or plasmid-associated | Mobilome: prophages, transposons [X] | 0.24 |
| COG3452 | Extracellular (periplasmic) sensor domain CHASE (specificity unknown) | Signal transduction mechanisms [T] | 0.24 |
| COG3614 | Extracytoplasmic sensor domain CHASE1 (specificity unknown) | Signal transduction mechanisms [T] | 0.24 |
| COG3722 | DNA-binding transcriptional regulator, MltR family | Transcription [K] | 0.24 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.24 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.24 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.24 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.24 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.24 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.24 |
| COG4944 | Uncharacterized conserved protein | Function unknown [S] | 0.24 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.24 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.06 % |
| Unclassified | root | N/A | 28.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17173190 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 2170459015|G14TP7Y02FYHT2 | Not Available | 549 | Open in IMG/M |
| 2170459022|GZEQPF101DMNI3 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 2228664022|INPgaii200_c1144184 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300001383|JGI20194J14741_1018241 | Not Available | 572 | Open in IMG/M |
| 3300001402|JGI20195J14853_1045469 | Not Available | 575 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100490747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1105 | Open in IMG/M |
| 3300004633|Ga0066395_10203408 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005531|Ga0070738_10028184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4007 | Open in IMG/M |
| 3300005568|Ga0066703_10742578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 563 | Open in IMG/M |
| 3300005591|Ga0070761_10286354 | Not Available | 989 | Open in IMG/M |
| 3300005764|Ga0066903_101398528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 1314 | Open in IMG/M |
| 3300005764|Ga0066903_101851949 | Not Available | 1154 | Open in IMG/M |
| 3300005764|Ga0066903_102308425 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300005764|Ga0066903_102427471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300005764|Ga0066903_102654040 | Not Available | 971 | Open in IMG/M |
| 3300005764|Ga0066903_102768760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 951 | Open in IMG/M |
| 3300005764|Ga0066903_102915482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 927 | Open in IMG/M |
| 3300005764|Ga0066903_102999859 | Not Available | 914 | Open in IMG/M |
| 3300005764|Ga0066903_103055121 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300005764|Ga0066903_103289061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 873 | Open in IMG/M |
| 3300005764|Ga0066903_104029422 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005764|Ga0066903_104332056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300005764|Ga0066903_104644990 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005764|Ga0066903_106140835 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005764|Ga0066903_107392805 | Not Available | 567 | Open in IMG/M |
| 3300005764|Ga0066903_107583467 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005937|Ga0081455_10114491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2137 | Open in IMG/M |
| 3300006028|Ga0070717_10466845 | Not Available | 1139 | Open in IMG/M |
| 3300006050|Ga0075028_100077518 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300006052|Ga0075029_100390875 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300006102|Ga0075015_100503897 | Not Available | 697 | Open in IMG/M |
| 3300006102|Ga0075015_100840359 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006162|Ga0075030_100127153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2069 | Open in IMG/M |
| 3300006172|Ga0075018_10357503 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006176|Ga0070765_100647523 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300006176|Ga0070765_101760071 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006354|Ga0075021_10409278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 851 | Open in IMG/M |
| 3300006642|Ga0075521_10283698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
| 3300006806|Ga0079220_12035849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 513 | Open in IMG/M |
| 3300006914|Ga0075436_100619695 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300007255|Ga0099791_10015943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3199 | Open in IMG/M |
| 3300007788|Ga0099795_10587608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300007982|Ga0102924_1030622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3560 | Open in IMG/M |
| 3300007982|Ga0102924_1040562 | All Organisms → cellular organisms → Bacteria | 2885 | Open in IMG/M |
| 3300007982|Ga0102924_1064280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2039 | Open in IMG/M |
| 3300009012|Ga0066710_102492439 | Not Available | 748 | Open in IMG/M |
| 3300009088|Ga0099830_10706760 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300009088|Ga0099830_10908734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 728 | Open in IMG/M |
| 3300009137|Ga0066709_104271155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300009520|Ga0116214_1059402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1390 | Open in IMG/M |
| 3300009522|Ga0116218_1243980 | Not Available | 807 | Open in IMG/M |
| 3300009523|Ga0116221_1343055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300009523|Ga0116221_1500472 | Not Available | 532 | Open in IMG/M |
| 3300009525|Ga0116220_10208597 | Not Available | 847 | Open in IMG/M |
| 3300009525|Ga0116220_10295436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 712 | Open in IMG/M |
| 3300009525|Ga0116220_10566762 | Not Available | 520 | Open in IMG/M |
| 3300009633|Ga0116129_1009841 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
| 3300009637|Ga0116118_1236344 | Not Available | 564 | Open in IMG/M |
| 3300009645|Ga0116106_1073911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1116 | Open in IMG/M |
| 3300009672|Ga0116215_1180482 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300009698|Ga0116216_10398794 | Not Available | 835 | Open in IMG/M |
| 3300009700|Ga0116217_10979788 | Not Available | 518 | Open in IMG/M |
| 3300009759|Ga0116101_1088243 | Not Available | 709 | Open in IMG/M |
| 3300009759|Ga0116101_1193132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300009792|Ga0126374_10145715 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300009792|Ga0126374_10251360 | Not Available | 1154 | Open in IMG/M |
| 3300009839|Ga0116223_10121443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1640 | Open in IMG/M |
| 3300010043|Ga0126380_10049838 | All Organisms → Viruses → Predicted Viral | 2254 | Open in IMG/M |
| 3300010043|Ga0126380_10265376 | Not Available | 1198 | Open in IMG/M |
| 3300010046|Ga0126384_10796945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 845 | Open in IMG/M |
| 3300010048|Ga0126373_10071649 | All Organisms → cellular organisms → Bacteria | 3132 | Open in IMG/M |
| 3300010048|Ga0126373_11770060 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010048|Ga0126373_12427189 | Not Available | 584 | Open in IMG/M |
| 3300010339|Ga0074046_10693023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 599 | Open in IMG/M |
| 3300010339|Ga0074046_10702577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300010341|Ga0074045_10807640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 593 | Open in IMG/M |
| 3300010343|Ga0074044_10515020 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300010343|Ga0074044_10874007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 587 | Open in IMG/M |
| 3300010343|Ga0074044_10980350 | Not Available | 553 | Open in IMG/M |
| 3300010358|Ga0126370_10040529 | Not Available | 2889 | Open in IMG/M |
| 3300010358|Ga0126370_10280949 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300010358|Ga0126370_11007056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 761 | Open in IMG/M |
| 3300010359|Ga0126376_10083333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2384 | Open in IMG/M |
| 3300010359|Ga0126376_10674626 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300010359|Ga0126376_11657557 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010360|Ga0126372_10560906 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300010362|Ga0126377_13481973 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010366|Ga0126379_12078284 | Not Available | 670 | Open in IMG/M |
| 3300010376|Ga0126381_100177619 | Not Available | 2825 | Open in IMG/M |
| 3300010376|Ga0126381_100948500 | Not Available | 1240 | Open in IMG/M |
| 3300010376|Ga0126381_101813506 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300010376|Ga0126381_102001725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 835 | Open in IMG/M |
| 3300010376|Ga0126381_102731331 | Not Available | 705 | Open in IMG/M |
| 3300010376|Ga0126381_103784816 | Not Available | 591 | Open in IMG/M |
| 3300010376|Ga0126381_104418684 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010379|Ga0136449_100066891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7773 | Open in IMG/M |
| 3300010379|Ga0136449_100291280 | All Organisms → cellular organisms → Bacteria | 2986 | Open in IMG/M |
| 3300010379|Ga0136449_100890629 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 1452 | Open in IMG/M |
| 3300010379|Ga0136449_101058148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1297 | Open in IMG/M |
| 3300010379|Ga0136449_101129548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1243 | Open in IMG/M |
| 3300010379|Ga0136449_101171113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1214 | Open in IMG/M |
| 3300010379|Ga0136449_101718765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 944 | Open in IMG/M |
| 3300010379|Ga0136449_101871301 | Not Available | 894 | Open in IMG/M |
| 3300010379|Ga0136449_101934433 | Not Available | 874 | Open in IMG/M |
| 3300010379|Ga0136449_102193023 | Not Available | 806 | Open in IMG/M |
| 3300010379|Ga0136449_102318640 | Not Available | 778 | Open in IMG/M |
| 3300010379|Ga0136449_103328458 | Not Available | 617 | Open in IMG/M |
| 3300010379|Ga0136449_103894058 | Not Available | 560 | Open in IMG/M |
| 3300010379|Ga0136449_104378643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 521 | Open in IMG/M |
| 3300010379|Ga0136449_104379354 | Not Available | 521 | Open in IMG/M |
| 3300010379|Ga0136449_104416190 | Not Available | 518 | Open in IMG/M |
| 3300010379|Ga0136449_104650990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 502 | Open in IMG/M |
| 3300010398|Ga0126383_10452289 | Not Available | 1334 | Open in IMG/M |
| 3300010398|Ga0126383_10546065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1224 | Open in IMG/M |
| 3300010398|Ga0126383_12146262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 645 | Open in IMG/M |
| 3300010398|Ga0126383_12291246 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300010398|Ga0126383_12395281 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300010880|Ga0126350_11705392 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010937|Ga0137776_1211471 | Not Available | 746 | Open in IMG/M |
| 3300011270|Ga0137391_10109822 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300011270|Ga0137391_10214934 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300011271|Ga0137393_11718074 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300011434|Ga0137464_1275085 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012019|Ga0120139_1005606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3030 | Open in IMG/M |
| 3300012038|Ga0137431_1032185 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300012089|Ga0153924_1009992 | Not Available | 2204 | Open in IMG/M |
| 3300012096|Ga0137389_10192027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1696 | Open in IMG/M |
| 3300012096|Ga0137389_10998005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300012096|Ga0137389_11659471 | Not Available | 535 | Open in IMG/M |
| 3300012169|Ga0153990_1028536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 1263 | Open in IMG/M |
| 3300012189|Ga0137388_11029490 | Not Available | 759 | Open in IMG/M |
| 3300012189|Ga0137388_11879764 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012198|Ga0137364_10997547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Solimicrobium → Solimicrobium silvestre | 633 | Open in IMG/M |
| 3300012201|Ga0137365_10652087 | Not Available | 771 | Open in IMG/M |
| 3300012203|Ga0137399_10550214 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300012205|Ga0137362_10293783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1406 | Open in IMG/M |
| 3300012207|Ga0137381_11216990 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012209|Ga0137379_10741844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300012285|Ga0137370_10873756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
| 3300012354|Ga0137366_11018968 | Not Available | 575 | Open in IMG/M |
| 3300012361|Ga0137360_10025575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4014 | Open in IMG/M |
| 3300012361|Ga0137360_10156377 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300012362|Ga0137361_11324594 | Not Available | 644 | Open in IMG/M |
| 3300012469|Ga0150984_123202454 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012897|Ga0157285_10009990 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300012918|Ga0137396_10895391 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012944|Ga0137410_12049202 | Not Available | 509 | Open in IMG/M |
| 3300012948|Ga0126375_12006414 | Not Available | 511 | Open in IMG/M |
| 3300012961|Ga0164302_11241685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 598 | Open in IMG/M |
| 3300012971|Ga0126369_10011241 | All Organisms → cellular organisms → Bacteria | 6904 | Open in IMG/M |
| 3300012971|Ga0126369_10086857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2793 | Open in IMG/M |
| 3300012971|Ga0126369_10511797 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300012971|Ga0126369_11783394 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 704 | Open in IMG/M |
| 3300012971|Ga0126369_12404440 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012971|Ga0126369_12638508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 587 | Open in IMG/M |
| 3300012971|Ga0126369_13630044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300012985|Ga0164308_11063104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 723 | Open in IMG/M |
| 3300014156|Ga0181518_10242525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
| 3300014164|Ga0181532_10001999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 19252 | Open in IMG/M |
| 3300014165|Ga0181523_10552444 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300014165|Ga0181523_10571258 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300014199|Ga0181535_10251214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1067 | Open in IMG/M |
| 3300014325|Ga0163163_11428349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 753 | Open in IMG/M |
| 3300014489|Ga0182018_10156242 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300014498|Ga0182019_10976985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 614 | Open in IMG/M |
| 3300014501|Ga0182024_10671850 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300014501|Ga0182024_11441815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense | 790 | Open in IMG/M |
| 3300014501|Ga0182024_11840124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 676 | Open in IMG/M |
| 3300014501|Ga0182024_12359803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 577 | Open in IMG/M |
| 3300014501|Ga0182024_12419456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300014638|Ga0181536_10027745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella bronchiseptica | 4317 | Open in IMG/M |
| 3300014638|Ga0181536_10048212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2840 | Open in IMG/M |
| 3300014638|Ga0181536_10153374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300014638|Ga0181536_10248990 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300015259|Ga0180085_1234791 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300015374|Ga0132255_100629778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1588 | Open in IMG/M |
| 3300015374|Ga0132255_102425303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 801 | Open in IMG/M |
| 3300016270|Ga0182036_10263830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1295 | Open in IMG/M |
| 3300016270|Ga0182036_10382971 | Not Available | 1092 | Open in IMG/M |
| 3300016270|Ga0182036_10995558 | Not Available | 691 | Open in IMG/M |
| 3300016270|Ga0182036_11606282 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300016294|Ga0182041_10134499 | Not Available | 1881 | Open in IMG/M |
| 3300016294|Ga0182041_10847388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| 3300016294|Ga0182041_11578073 | Not Available | 606 | Open in IMG/M |
| 3300016294|Ga0182041_11924799 | Not Available | 550 | Open in IMG/M |
| 3300016294|Ga0182041_12057031 | Not Available | 532 | Open in IMG/M |
| 3300016294|Ga0182041_12278530 | Not Available | 507 | Open in IMG/M |
| 3300016319|Ga0182033_10281885 | Not Available | 1364 | Open in IMG/M |
| 3300016319|Ga0182033_10564525 | Not Available | 985 | Open in IMG/M |
| 3300016319|Ga0182033_10622834 | Not Available | 939 | Open in IMG/M |
| 3300016319|Ga0182033_10969426 | Not Available | 755 | Open in IMG/M |
| 3300016319|Ga0182033_11136419 | Not Available | 698 | Open in IMG/M |
| 3300016319|Ga0182033_11283395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300016357|Ga0182032_10238946 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300016371|Ga0182034_10507586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
| 3300016371|Ga0182034_11161621 | Not Available | 671 | Open in IMG/M |
| 3300016387|Ga0182040_10050367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2588 | Open in IMG/M |
| 3300016387|Ga0182040_10543431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 934 | Open in IMG/M |
| 3300016387|Ga0182040_11946742 | Not Available | 504 | Open in IMG/M |
| 3300016404|Ga0182037_10146574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1773 | Open in IMG/M |
| 3300016404|Ga0182037_11012001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300016422|Ga0182039_11059773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 729 | Open in IMG/M |
| 3300016422|Ga0182039_11092385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → Thioalkalivibrio nitratireducens | 718 | Open in IMG/M |
| 3300016422|Ga0182039_11944819 | Not Available | 540 | Open in IMG/M |
| 3300016422|Ga0182039_12066961 | Not Available | 524 | Open in IMG/M |
| 3300016445|Ga0182038_11704054 | Not Available | 568 | Open in IMG/M |
| 3300017821|Ga0187812_1270623 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300017822|Ga0187802_10327470 | Not Available | 599 | Open in IMG/M |
| 3300017925|Ga0187856_1006820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7105 | Open in IMG/M |
| 3300017928|Ga0187806_1096063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
| 3300017932|Ga0187814_10377317 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300017943|Ga0187819_10061347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2234 | Open in IMG/M |
| 3300017943|Ga0187819_10874651 | Not Available | 503 | Open in IMG/M |
| 3300017946|Ga0187879_10104075 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300017955|Ga0187817_10336106 | Not Available | 963 | Open in IMG/M |
| 3300017973|Ga0187780_10962334 | Not Available | 621 | Open in IMG/M |
| 3300017975|Ga0187782_10748283 | Not Available | 755 | Open in IMG/M |
| 3300017993|Ga0187823_10007945 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2471 | Open in IMG/M |
| 3300017994|Ga0187822_10314602 | Not Available | 556 | Open in IMG/M |
| 3300017994|Ga0187822_10347468 | Not Available | 535 | Open in IMG/M |
| 3300017995|Ga0187816_10175376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 930 | Open in IMG/M |
| 3300017996|Ga0187891_1136477 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300017999|Ga0187767_10009786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1853 | Open in IMG/M |
| 3300018001|Ga0187815_10033841 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300018008|Ga0187888_1269394 | Not Available | 660 | Open in IMG/M |
| 3300018014|Ga0187860_1333240 | Not Available | 580 | Open in IMG/M |
| 3300018027|Ga0184605_10492760 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018047|Ga0187859_10070891 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300018047|Ga0187859_10346837 | Not Available | 809 | Open in IMG/M |
| 3300018058|Ga0187766_10250043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1134 | Open in IMG/M |
| 3300018058|Ga0187766_10272414 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
| 3300018058|Ga0187766_10932622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 614 | Open in IMG/M |
| 3300018062|Ga0187784_10400237 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300018064|Ga0187773_11228438 | Not Available | 505 | Open in IMG/M |
| 3300018073|Ga0184624_10070347 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300018085|Ga0187772_10309033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1085 | Open in IMG/M |
| 3300018085|Ga0187772_10356435 | Not Available | 1012 | Open in IMG/M |
| 3300018085|Ga0187772_10601640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 782 | Open in IMG/M |
| 3300018086|Ga0187769_10438839 | Not Available | 983 | Open in IMG/M |
| 3300018086|Ga0187769_10527406 | Not Available | 892 | Open in IMG/M |
| 3300018086|Ga0187769_11393125 | Not Available | 530 | Open in IMG/M |
| 3300018089|Ga0187774_10816204 | Not Available | 631 | Open in IMG/M |
| 3300018433|Ga0066667_11418089 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300019886|Ga0193727_1155848 | Not Available | 615 | Open in IMG/M |
| 3300019888|Ga0193751_1212631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cytisi | 636 | Open in IMG/M |
| 3300019890|Ga0193728_1131869 | Not Available | 1120 | Open in IMG/M |
| 3300020001|Ga0193731_1099678 | Not Available | 749 | Open in IMG/M |
| 3300020018|Ga0193721_1055369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 139 | 1040 | Open in IMG/M |
| 3300020170|Ga0179594_10250457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 668 | Open in IMG/M |
| 3300020199|Ga0179592_10429086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300020199|Ga0179592_10464356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300020579|Ga0210407_10164030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1716 | Open in IMG/M |
| 3300020579|Ga0210407_10301402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1251 | Open in IMG/M |
| 3300020579|Ga0210407_10717449 | Not Available | 775 | Open in IMG/M |
| 3300020580|Ga0210403_10338597 | Not Available | 1231 | Open in IMG/M |
| 3300020583|Ga0210401_11021033 | Not Available | 686 | Open in IMG/M |
| 3300021086|Ga0179596_10365124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300021168|Ga0210406_10234664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1510 | Open in IMG/M |
| 3300021171|Ga0210405_10068923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2790 | Open in IMG/M |
| 3300021178|Ga0210408_10212693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
| 3300021362|Ga0213882_10489604 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021377|Ga0213874_10161450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
| 3300021401|Ga0210393_10093303 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300021402|Ga0210385_10841534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300021404|Ga0210389_10322105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1213 | Open in IMG/M |
| 3300021405|Ga0210387_10974606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 744 | Open in IMG/M |
| 3300021406|Ga0210386_11239081 | Not Available | 630 | Open in IMG/M |
| 3300021420|Ga0210394_10685892 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300021420|Ga0210394_11206821 | Not Available | 649 | Open in IMG/M |
| 3300021420|Ga0210394_11476422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300021433|Ga0210391_10098726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2302 | Open in IMG/M |
| 3300021433|Ga0210391_11222114 | Not Available | 581 | Open in IMG/M |
| 3300021476|Ga0187846_10076202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1460 | Open in IMG/M |
| 3300021477|Ga0210398_10240555 | Not Available | 1475 | Open in IMG/M |
| 3300021478|Ga0210402_10536999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1085 | Open in IMG/M |
| 3300021478|Ga0210402_10670720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300021478|Ga0210402_11263137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300021559|Ga0210409_10797000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter aalborgensis | 817 | Open in IMG/M |
| 3300021560|Ga0126371_10133996 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
| 3300021560|Ga0126371_10993485 | Not Available | 981 | Open in IMG/M |
| 3300021560|Ga0126371_11357797 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300021560|Ga0126371_12055789 | Not Available | 688 | Open in IMG/M |
| 3300021560|Ga0126371_12314331 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300021560|Ga0126371_13264120 | Not Available | 548 | Open in IMG/M |
| 3300021560|Ga0126371_13690884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 516 | Open in IMG/M |
| 3300022557|Ga0212123_10004982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 24189 | Open in IMG/M |
| 3300022557|Ga0212123_10070625 | All Organisms → cellular organisms → Bacteria | 3012 | Open in IMG/M |
| 3300022737|Ga0247747_1023330 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300024288|Ga0179589_10363218 | Not Available | 659 | Open in IMG/M |
| 3300025463|Ga0208193_1070876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 716 | Open in IMG/M |
| 3300025612|Ga0208691_1025089 | Not Available | 1397 | Open in IMG/M |
| 3300025627|Ga0208220_1061396 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300025906|Ga0207699_10205065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1338 | Open in IMG/M |
| 3300025906|Ga0207699_10819819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 684 | Open in IMG/M |
| 3300025906|Ga0207699_10948181 | Not Available | 635 | Open in IMG/M |
| 3300025916|Ga0207663_10765654 | Not Available | 767 | Open in IMG/M |
| 3300025929|Ga0207664_10296559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. S69 | 1421 | Open in IMG/M |
| 3300025981|Ga0207640_10567991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 956 | Open in IMG/M |
| 3300026223|Ga0209840_1076542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. STM 3843 | 732 | Open in IMG/M |
| 3300026467|Ga0257154_1015807 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300026497|Ga0257164_1054428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300026538|Ga0209056_10508806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 627 | Open in IMG/M |
| 3300026557|Ga0179587_10003670 | All Organisms → cellular organisms → Bacteria | 7454 | Open in IMG/M |
| 3300026865|Ga0207746_1002360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1858 | Open in IMG/M |
| 3300026990|Ga0207824_1009275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1092 | Open in IMG/M |
| 3300027063|Ga0207762_1036468 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300027288|Ga0208525_1038616 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027384|Ga0209854_1076698 | Not Available | 590 | Open in IMG/M |
| 3300027512|Ga0209179_1092340 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300027521|Ga0209524_1018837 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300027570|Ga0208043_1049620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1231 | Open in IMG/M |
| 3300027570|Ga0208043_1090059 | Not Available | 840 | Open in IMG/M |
| 3300027570|Ga0208043_1188500 | Not Available | 525 | Open in IMG/M |
| 3300027604|Ga0208324_1132193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300027826|Ga0209060_10001598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 24063 | Open in IMG/M |
| 3300027842|Ga0209580_10102351 | Not Available | 1386 | Open in IMG/M |
| 3300027842|Ga0209580_10426811 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027854|Ga0209517_10490817 | Not Available | 671 | Open in IMG/M |
| 3300027867|Ga0209167_10302712 | Not Available | 865 | Open in IMG/M |
| 3300027882|Ga0209590_10611363 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300027882|Ga0209590_10971438 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027884|Ga0209275_10059597 | Not Available | 1861 | Open in IMG/M |
| 3300027895|Ga0209624_11095008 | Not Available | 513 | Open in IMG/M |
| 3300027905|Ga0209415_10699016 | Not Available | 727 | Open in IMG/M |
| 3300027910|Ga0209583_10042974 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300028060|Ga0255359_125103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LTSP885 | 537 | Open in IMG/M |
| 3300028380|Ga0268265_10124008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2134 | Open in IMG/M |
| 3300028746|Ga0302233_10265305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 651 | Open in IMG/M |
| 3300028748|Ga0302156_10174396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1028 | Open in IMG/M |
| 3300028773|Ga0302234_10024580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2848 | Open in IMG/M |
| 3300028906|Ga0308309_11643784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300028906|Ga0308309_11808940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
| 3300029984|Ga0311332_11794587 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300029999|Ga0311339_10070089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4530 | Open in IMG/M |
| 3300030002|Ga0311350_11858761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 531 | Open in IMG/M |
| 3300030007|Ga0311338_10074406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4359 | Open in IMG/M |
| 3300030007|Ga0311338_10601183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1131 | Open in IMG/M |
| 3300030399|Ga0311353_10269600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1571 | Open in IMG/M |
| 3300030706|Ga0310039_10010444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4943 | Open in IMG/M |
| 3300031128|Ga0170823_15253875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. PW1 | 2304 | Open in IMG/M |
| 3300031231|Ga0170824_122299258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. S69 | 623 | Open in IMG/M |
| 3300031240|Ga0265320_10300020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 710 | Open in IMG/M |
| 3300031250|Ga0265331_10418209 | Not Available | 601 | Open in IMG/M |
| 3300031543|Ga0318516_10048050 | Not Available | 2314 | Open in IMG/M |
| 3300031672|Ga0307373_10637438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
| 3300031680|Ga0318574_10615284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 637 | Open in IMG/M |
| 3300031708|Ga0310686_102179665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4412 | Open in IMG/M |
| 3300031708|Ga0310686_113145953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300031719|Ga0306917_10409715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1059 | Open in IMG/M |
| 3300031723|Ga0318493_10622393 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031726|Ga0302321_102394461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 616 | Open in IMG/M |
| 3300031744|Ga0306918_10536364 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300031744|Ga0306918_10795016 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300031744|Ga0306918_11262097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300031744|Ga0306918_11543637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 3300031771|Ga0318546_10516639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300031781|Ga0318547_10067496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1973 | Open in IMG/M |
| 3300031798|Ga0318523_10542507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. JYMT SZCCT0428 | 574 | Open in IMG/M |
| 3300031805|Ga0318497_10335202 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031823|Ga0307478_10504533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1008 | Open in IMG/M |
| 3300031834|Ga0315290_10585287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 970 | Open in IMG/M |
| 3300031834|Ga0315290_11000835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 704 | Open in IMG/M |
| 3300031835|Ga0318517_10403260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 618 | Open in IMG/M |
| 3300031847|Ga0310907_10166825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
| 3300031890|Ga0306925_10109021 | All Organisms → cellular organisms → Bacteria | 2953 | Open in IMG/M |
| 3300031890|Ga0306925_10179873 | Not Available | 2278 | Open in IMG/M |
| 3300031890|Ga0306925_11970477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
| 3300031890|Ga0306925_12196069 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031897|Ga0318520_10200094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 1178 | Open in IMG/M |
| 3300031910|Ga0306923_10604048 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300031910|Ga0306923_10624954 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300031912|Ga0306921_10375409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 139 | 1661 | Open in IMG/M |
| 3300031912|Ga0306921_10523673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1377 | Open in IMG/M |
| 3300031912|Ga0306921_11045584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300031912|Ga0306921_11117364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 882 | Open in IMG/M |
| 3300031912|Ga0306921_11127927 | Not Available | 877 | Open in IMG/M |
| 3300031941|Ga0310912_10147105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1776 | Open in IMG/M |
| 3300031941|Ga0310912_11167670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300031942|Ga0310916_10414401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1147 | Open in IMG/M |
| 3300031942|Ga0310916_10557682 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300031942|Ga0310916_10778407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300031946|Ga0310910_10413769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1069 | Open in IMG/M |
| 3300031947|Ga0310909_10578378 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300031947|Ga0310909_10911526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 721 | Open in IMG/M |
| 3300031954|Ga0306926_10321228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1915 | Open in IMG/M |
| 3300031954|Ga0306926_10749424 | Not Available | 1181 | Open in IMG/M |
| 3300031954|Ga0306926_12966087 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300032001|Ga0306922_10264096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1850 | Open in IMG/M |
| 3300032001|Ga0306922_10487756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1314 | Open in IMG/M |
| 3300032001|Ga0306922_10546000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1232 | Open in IMG/M |
| 3300032001|Ga0306922_11291391 | Not Available | 739 | Open in IMG/M |
| 3300032051|Ga0318532_10362884 | Not Available | 514 | Open in IMG/M |
| 3300032059|Ga0318533_10096941 | Not Available | 2036 | Open in IMG/M |
| 3300032059|Ga0318533_11341310 | Not Available | 523 | Open in IMG/M |
| 3300032064|Ga0318510_10224527 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300032076|Ga0306924_11503092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
| 3300032160|Ga0311301_10644836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1509 | Open in IMG/M |
| 3300032160|Ga0311301_10656701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1490 | Open in IMG/M |
| 3300032160|Ga0311301_10894659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1197 | Open in IMG/M |
| 3300032160|Ga0311301_10930744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1164 | Open in IMG/M |
| 3300032160|Ga0311301_11330374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300032160|Ga0311301_11784210 | Not Available | 734 | Open in IMG/M |
| 3300032160|Ga0311301_11866591 | Not Available | 711 | Open in IMG/M |
| 3300032160|Ga0311301_12163496 | Not Available | 640 | Open in IMG/M |
| 3300032261|Ga0306920_100002488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 23296 | Open in IMG/M |
| 3300032261|Ga0306920_100593329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1639 | Open in IMG/M |
| 3300032261|Ga0306920_100618858 | Not Available | 1601 | Open in IMG/M |
| 3300032261|Ga0306920_102799110 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300032261|Ga0306920_103259509 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032261|Ga0306920_103485420 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032261|Ga0306920_103715367 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300032261|Ga0306920_103821939 | Not Available | 550 | Open in IMG/M |
| 3300032805|Ga0335078_10139537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3444 | Open in IMG/M |
| 3300032892|Ga0335081_10329680 | Not Available | 2002 | Open in IMG/M |
| 3300033158|Ga0335077_11421567 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300033158|Ga0335077_11521761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 640 | Open in IMG/M |
| 3300033289|Ga0310914_11029768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1417 | 724 | Open in IMG/M |
| 3300033289|Ga0310914_11068435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 708 | Open in IMG/M |
| 3300033289|Ga0310914_11877800 | Not Available | 504 | Open in IMG/M |
| 3300033290|Ga0318519_10128834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1393 | Open in IMG/M |
| 3300033433|Ga0326726_10966858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300034113|Ga0364937_009685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1444 | Open in IMG/M |
| 3300034148|Ga0364927_0058060 | Not Available | 1022 | Open in IMG/M |
| 3300034148|Ga0364927_0065878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 968 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.35% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.35% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.65% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.65% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.41% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.41% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.18% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.18% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.18% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.71% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.71% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.47% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.47% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.47% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.47% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.24% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.24% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.24% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.24% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.24% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.24% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.24% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.24% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.24% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.24% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.24% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.24% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.24% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.24% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.24% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.24% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001383 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028060 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T25 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03649730 | 2088090014 | Soil | TMNDVYAKLEEAVLYIEYNPNVIKSITSFPYIARSL |
| 4PV_01019530 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | KNYALKSMDAVRAKLKQAILYIERNPKLVRSITSFPYIVNSL |
| FA2_08416030 | 2170459022 | Grass Soil | LKSMDAVRAKLKQAILYIERNPGLVRSITSFPYIINSL |
| INPgaii200_11441842 | 2228664022 | Soil | MNDVYAKLEEAVLYIEYNPNVIKSITSFPYIARSL |
| JGI20194J14741_10182412 | 3300001383 | Arctic Peat Soil | SINAVRNKLKQAILYIERNPETVKSITSFPYIVKSL* |
| JGI20195J14853_10454691 | 3300001402 | Arctic Peat Soil | SIDAVRAKLKQAILYIERNPKAVKSITSFPYIVRSL* |
| JGIcombinedJ26739_1004907471 | 3300002245 | Forest Soil | MDAVCAKLKQAVLYIERNPKLVRSITAFPYIINSL* |
| Ga0066395_102034082 | 3300004633 | Tropical Forest Soil | NYALKSMEGVYAKLEEAALYIERNPAIVKSITSFPYIVRSL* |
| Ga0070738_100281845 | 3300005531 | Surface Soil | MEDVYAKLEEAALYIERNPAIVKSITSFPYIVRSI* |
| Ga0066703_107425781 | 3300005568 | Soil | NYALKSMHEVCAKLRQAVLYIERNPNLVRSITSFPYIVNSL* |
| Ga0070761_102863542 | 3300005591 | Soil | MDDVNAKLDEAAFYIERNPTLVRSITSFPYIAKSL* |
| Ga0066903_1013985283 | 3300005764 | Tropical Forest Soil | DEVYSKLEEATLYIERNPALVKSITAFPYIAKSI* |
| Ga0066903_1018519495 | 3300005764 | Tropical Forest Soil | SDVNAKLDEASFYIERSRTLVKSIASFPYIAKSY* |
| Ga0066903_1023084251 | 3300005764 | Tropical Forest Soil | DAVYDKLEEAALYIERNRKVVKSIASFPYIVKSS* |
| Ga0066903_1024274712 | 3300005764 | Tropical Forest Soil | EAVRAKLKQAILHIERNPKLVRSITSFPYIVNSL* |
| Ga0066903_1026540402 | 3300005764 | Tropical Forest Soil | DEVCEMLVEGSLYIERNPELVKSMTLFPYIASSI* |
| Ga0066903_1027687603 | 3300005764 | Tropical Forest Soil | NYALKSMDEVYGKLEEAALYIQRNPKIVKSITSFPYIAKSL* |
| Ga0066903_1029154821 | 3300005764 | Tropical Forest Soil | SIDDVYAKLEEAALYIERNPALVKSITSFPYVAKSI* |
| Ga0066903_1029998592 | 3300005764 | Tropical Forest Soil | MDAVRAKLKQVILYIERNPKLVRSIASFPYIVNSL* |
| Ga0066903_1030551213 | 3300005764 | Tropical Forest Soil | MHAVRAKLKQAILYIERNPKLVRSITSFPYIVNSL* |
| Ga0066903_1032890613 | 3300005764 | Tropical Forest Soil | EDVYDKLEEAALYIERNPAIVKSITSFPYIVRSI* |
| Ga0066903_1040294221 | 3300005764 | Tropical Forest Soil | ISDVNAKLDEAALYTERNATLVKSITSFPYIAKSL* |
| Ga0066903_1043320562 | 3300005764 | Tropical Forest Soil | MDDVYDKLVEAALYIERNPAIVESITSFPYIVRSI* |
| Ga0066903_1046449901 | 3300005764 | Tropical Forest Soil | YALKSMDEVYAKLEDAALYIERNPALVKSITSFPYIARSI* |
| Ga0066903_1061408351 | 3300005764 | Tropical Forest Soil | EAVYDKLEEAALYIERNRNIVKSIASFPYIVRSS* |
| Ga0066903_1073928051 | 3300005764 | Tropical Forest Soil | SIDDVYAKLEEAAAYIERNPAIVKSITSFPYIVRSL* |
| Ga0066903_1075834671 | 3300005764 | Tropical Forest Soil | NDVYDKLEEAALYIERNPALVKSITSFPYIVSSL* |
| Ga0081455_101144915 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDAVRAKLRQAILYIERNPKLVRSVTSFPYIVNSL* |
| Ga0070717_104668452 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAVRAKLRQAIIYMERNPKLVRSITSFPYIVNSL |
| Ga0075028_1000775181 | 3300006050 | Watersheds | NYALKSMDAVRAKLRRAILYMERNPKLIRSITSFPYIVNSL* |
| Ga0075029_1003908751 | 3300006052 | Watersheds | MNQVYDKLEEAALYMERNPKLVKSITSFPYIVKSS* |
| Ga0075015_1005038972 | 3300006102 | Watersheds | DAVRAKLRQAILYIERNPKLVRSITSFPYIVNSL* |
| Ga0075015_1008403592 | 3300006102 | Watersheds | DEVYAKLEEAALYIERNPAIVKSITSFPYIAKSI* |
| Ga0075030_1001271536 | 3300006162 | Watersheds | EEVYSKLEEAALYIERNPAIVKSITSFPYIAKSI* |
| Ga0075018_103575031 | 3300006172 | Watersheds | SMNHVYAKLDEAALYIEQNPKLVKSITSFPYIVKST* |
| Ga0070765_1006475232 | 3300006176 | Soil | YALKSMDAVRAKLKQAILYIERNPKLVRSISSFPYIVNSL* |
| Ga0070765_1017600711 | 3300006176 | Soil | ALKSMDDVNAKLDEAAFYIERNPTLVKSITSFPYIAKSL* |
| Ga0075021_104092782 | 3300006354 | Watersheds | INAVRAKLQEAVLYIERNPELVKSITAFPYIAKSI* |
| Ga0075521_102836983 | 3300006642 | Arctic Peat Soil | DAVRAKLKQAVLYIKRNPTMVKSITSFPYIRKSF* |
| Ga0079220_120358491 | 3300006806 | Agricultural Soil | MDAVRAKLRQAILYIERNPKLVCSITSFPYIVNSL* |
| Ga0075436_1006196953 | 3300006914 | Populus Rhizosphere | MDEVCGKLVQATLYVERNPKMVKSMTLFPYINNAL* |
| Ga0099791_100159431 | 3300007255 | Vadose Zone Soil | IDAVYRKLDEAILYIERNPETVKSITSFPYIAKSL* |
| Ga0099795_105876082 | 3300007788 | Vadose Zone Soil | EEVYAKLEDAALYIERNPDLVKSITSFPYIARSI* |
| Ga0102924_10306225 | 3300007982 | Iron-Sulfur Acid Spring | MDAVRAKLRRAILYMERNPKLIRSITSFPYIVNSL* |
| Ga0102924_10405621 | 3300007982 | Iron-Sulfur Acid Spring | NYALKSMDAVRAKLRRAILYMERNPKLIRSITSFPYIVNSP* |
| Ga0102924_10642803 | 3300007982 | Iron-Sulfur Acid Spring | DAVRAKLRRAILYMERNPKLIRSITSFPYIVNSL* |
| Ga0066710_1024924391 | 3300009012 | Grasslands Soil | MDEVRAKLRQAVLYIERNPNLVRSITSFPYIVNSL |
| Ga0099830_107067601 | 3300009088 | Vadose Zone Soil | LKSMDDVYAKLEEAALYIERNPALVKSITSFPYIAKSI* |
| Ga0099830_109087341 | 3300009088 | Vadose Zone Soil | NEVNGKLDEAALYIEHNPTLVKSITSFPYIEKSL* |
| Ga0066709_1042711551 | 3300009137 | Grasslands Soil | LKSMDEVYAKLEEAALYVQRSPRVFKSIASFPYIIKSL* |
| Ga0116214_10594021 | 3300009520 | Peatlands Soil | KSIDAVRAKLKQAILYIERNLKIVKSITSFPYIRKSF* |
| Ga0116218_12439801 | 3300009522 | Peatlands Soil | DEVYDKLVEAALYIERNPRMVKSMTSFPYIMNSL* |
| Ga0116221_13430551 | 3300009523 | Peatlands Soil | KSMDAVRAKLRRAILYMERNSKLIRSITSFPYIVNSL* |
| Ga0116221_15004721 | 3300009523 | Peatlands Soil | MDEVYDKLVEAALYIERNPRMVKSMTSFPYIMNSL* |
| Ga0116220_102085971 | 3300009525 | Peatlands Soil | MKDVRHKLEQAILYIDRNPKLVKSITSFPYIAKSF* |
| Ga0116220_102954361 | 3300009525 | Peatlands Soil | ALKSMVAVRAKLRRAILYMERNPKLIRSITSFPYIVNSL* |
| Ga0116220_105667621 | 3300009525 | Peatlands Soil | SIDAVHQKLEEAILYIERNPKVVKSITSFPYIARSF* |
| Ga0116129_10098411 | 3300009633 | Peatland | IDHVRQKLREAILYVEHNPDMVKSIASFPYIAKSF* |
| Ga0116118_12363442 | 3300009637 | Peatland | IDAVRAKLKQAILYVERNPKTVKSITSFPYIVKSF* |
| Ga0116106_10739112 | 3300009645 | Peatland | KSMDAVRTKLEEAILYIERNPKTVKSITSFPYIVKSL* |
| Ga0116215_11804821 | 3300009672 | Peatlands Soil | NYALKSIDAVRAKLEEAILYIERNPETVKSITSFPYIRKSS* |
| Ga0116216_103987941 | 3300009698 | Peatlands Soil | IDAVRAKLEEAILYIERNPETVKSITSFPYIRKSF* |
| Ga0116217_109797881 | 3300009700 | Peatlands Soil | YALKSMDAVRAKLRRAILYMERNPKLIRSITSFPYIDNSL* |
| Ga0116101_10882431 | 3300009759 | Peatland | NAVRAKLREAVLYIERNPELVKSITAFPYIAKSI* |
| Ga0116101_11931321 | 3300009759 | Peatland | MNAVRAKLKEAVLYIERNPELVKSITAFPYIAKSI* |
| Ga0126374_101457153 | 3300009792 | Tropical Forest Soil | EGVYAKLEEAALYIERNPAIVKSITSFPYIVRSL* |
| Ga0126374_102513601 | 3300009792 | Tropical Forest Soil | MEGVYAKLEEAALYIERNPAIVKSITSFPYIVRSL* |
| Ga0116223_101214431 | 3300009839 | Peatlands Soil | IDAVYAKLNEAISYINRNPELVKSITSFPYIVRSF* |
| Ga0126380_100498383 | 3300010043 | Tropical Forest Soil | MEGVYAKLEEAALYTERNPAIVKSITSFPYIVRSI* |
| Ga0126380_102653761 | 3300010043 | Tropical Forest Soil | LKSMDSVYDKLQEAALYLERNPKIVQSITAFPYIAKSFYELTAR* |
| Ga0126384_107969451 | 3300010046 | Tropical Forest Soil | DAVCAKLKQAILYLERNPKLVRSITCFPYIVNSL* |
| Ga0126373_100716492 | 3300010048 | Tropical Forest Soil | MENIYDKLQEAALYLERNPKIVQSITAFPYIAKSF* |
| Ga0126373_117700602 | 3300010048 | Tropical Forest Soil | MDAVRAKLRQAIFYIERSPKLVRSITSFPYIANSL* |
| Ga0126373_124271891 | 3300010048 | Tropical Forest Soil | MDEVCDKLEEAAIYIERNPKMVKSMTSFPYIMNSL* |
| Ga0074046_106930232 | 3300010339 | Bog Forest Soil | MDAVRAKLKQAILYIERNPKLVRSITSFPYIVNSL* |
| Ga0074046_107025771 | 3300010339 | Bog Forest Soil | MKDVRAKLKEAILYIERNPRIVKSITSFPYIAKSV* |
| Ga0074045_108076401 | 3300010341 | Bog Forest Soil | KSIDAVRAKLEEAILYIERNPETVKSITSFPYIRKSS* |
| Ga0074044_105150202 | 3300010343 | Bog Forest Soil | MEEVYAKLEEAALYIERNPALVKSITLFPHIANSI* |
| Ga0074044_108740071 | 3300010343 | Bog Forest Soil | DAVRAKLKQAILYIERNPKLVQSITSFPYIVNSL* |
| Ga0074044_109803502 | 3300010343 | Bog Forest Soil | IDAVRAKLKQAILYIERNPKLVQSITSFPYIVNSL* |
| Ga0126370_100405292 | 3300010358 | Tropical Forest Soil | MEGVYAKLEEAALYIERNPAVVKSITSFPYIVRSI* |
| Ga0126370_102809491 | 3300010358 | Tropical Forest Soil | MAEVHEKLEEAILYVGRNPKLVKSITSFPYIVRSF* |
| Ga0126370_110070561 | 3300010358 | Tropical Forest Soil | MDEVYDKLEEAALYLERNPELVKSVTPFPYIAKSF* |
| Ga0126376_100833331 | 3300010359 | Tropical Forest Soil | IDEVYSKLEEATLYIERNPALVKSITAFPYIAKSI* |
| Ga0126376_106746261 | 3300010359 | Tropical Forest Soil | MDEVYAKLEQAALYIERNPALVKSITAFPYIAKSI* |
| Ga0126376_116575572 | 3300010359 | Tropical Forest Soil | MDEVCDKLEEAALYIERNPKMAKSITSFPYIVGSM* |
| Ga0126372_105609063 | 3300010360 | Tropical Forest Soil | MDEVYDKLEDAALYLERNPELVKSITSFPYIAKSF* |
| Ga0126377_134819731 | 3300010362 | Tropical Forest Soil | MDDVSEKLVDAALYVEDNPEMVKFMISFPYIMNALCAL* |
| Ga0126379_120782842 | 3300010366 | Tropical Forest Soil | NYALKSIDAVRRKLEQAILYIERNPETFKSITSFPYIVRSL* |
| Ga0126381_1001776191 | 3300010376 | Tropical Forest Soil | NGVRVKLKQAILYIERNPNLVRSITSFPYIVNSI* |
| Ga0126381_1009485003 | 3300010376 | Tropical Forest Soil | MDAARAKLKQDILYIERNPKLVRSISSFPHIVNSL* |
| Ga0126381_1018135061 | 3300010376 | Tropical Forest Soil | MENVYDKLQEAALYLERNPKIVQSITAFPYIAKSF* |
| Ga0126381_1020017252 | 3300010376 | Tropical Forest Soil | MEGVYAKLEEAALYIERNPAIVKSITSFPYIVRSI* |
| Ga0126381_1027313311 | 3300010376 | Tropical Forest Soil | NYALKSMDDVYDKLEEAALYIERNPAIVKSITSFPYIVRSI* |
| Ga0126381_1037848161 | 3300010376 | Tropical Forest Soil | MDAVRAKLKQAILYIERNPKLVRSIASFPYIVNSL* |
| Ga0126381_1044186842 | 3300010376 | Tropical Forest Soil | ALKSMDAVYDKLEEAALYIERNPAIVKSITSFPYIVRSL* |
| Ga0136449_1000668911 | 3300010379 | Peatlands Soil | NYALKSIDAVQSKLEEAILYIERNPQTVKSITSFPYIAKSL* |
| Ga0136449_1002912807 | 3300010379 | Peatlands Soil | DAVRAKLKQAILYIERNPKIVKSITSFPYIRKSF* |
| Ga0136449_1008906291 | 3300010379 | Peatlands Soil | YALNSIDAVHQKLEDAILYIERNPKVVKSITSFPYIARLF* |
| Ga0136449_1010581481 | 3300010379 | Peatlands Soil | IDAVRAKLKQAILYIERNPKIVKSITSFPYIRKSF* |
| Ga0136449_1011295484 | 3300010379 | Peatlands Soil | LKSIDAVRAKLEEAILYIERNPETVKSITSFPYIRKSS* |
| Ga0136449_1011711131 | 3300010379 | Peatlands Soil | DAVHQKLEDAILYIERNPKVVKSITSFPYIARSF* |
| Ga0136449_1017187652 | 3300010379 | Peatlands Soil | DAVYAKLNEAISYINRNPELVKSITSFPYIVRSF* |
| Ga0136449_1018713011 | 3300010379 | Peatlands Soil | RAVRAKLKQAILYIERNPKLVQSITSFPYIVKSL* |
| Ga0136449_1019344333 | 3300010379 | Peatlands Soil | DAVRAKLEEAILYIERNPETVKSITSFPYIRKSY* |
| Ga0136449_1021930232 | 3300010379 | Peatlands Soil | MDAVHAKLEQAILYVKSNPMTVKSITSFPYITRSF* |
| Ga0136449_1023186401 | 3300010379 | Peatlands Soil | IDAVHQKLEDAILYIERNPKVVKSITSFPYIARSF* |
| Ga0136449_1033284583 | 3300010379 | Peatlands Soil | ALKSIDAVRTKLKQAILYIERNPKIVKSLTSFPDIRKSF* |
| Ga0136449_1038940581 | 3300010379 | Peatlands Soil | NYALKSIDAVQSKLEEAILYIERNPQTVKSITSFPYIAKSP* |
| Ga0136449_1043786431 | 3300010379 | Peatlands Soil | MDDVNAKLDEAAFYIERNPTLVKSITSFPYIAKSL* |
| Ga0136449_1043793541 | 3300010379 | Peatlands Soil | IDAVHQKLEEAILYIERNPKVVKSITSFPYIARSF* |
| Ga0136449_1044161901 | 3300010379 | Peatlands Soil | YALKSIDAVRAKLKQAILYIEHNPKTVRSIASFPYIAKSL* |
| Ga0136449_1046509901 | 3300010379 | Peatlands Soil | IRAVRAKLKQAILYIERNPKLVQSITSFPYIVKSL* |
| Ga0126383_104522894 | 3300010398 | Tropical Forest Soil | IDAVRRKLEQAILYIERNPETVKSITSFPYIVRSL* |
| Ga0126383_105460651 | 3300010398 | Tropical Forest Soil | ALKSMEDVYDKLEEAALYIERNPAIVKSITSFPYIVRSI* |
| Ga0126383_121462622 | 3300010398 | Tropical Forest Soil | LDGVYAKLEEAALYIERNPALVKSITSFPYIERSI* |
| Ga0126383_122912462 | 3300010398 | Tropical Forest Soil | MDEVYGKLEEAALYIQRNPTIVKSITSFPYIVKSL* |
| Ga0126383_123952812 | 3300010398 | Tropical Forest Soil | DEVYAKLEQAALYIERNPALVKSITAFPYIAKSI* |
| Ga0126350_117053922 | 3300010880 | Boreal Forest Soil | RALKSMSDVDAKLDEAALYIERNATLVKSITSFPYIAKSY* |
| Ga0137776_12114711 | 3300010937 | Sediment | NYAAKSMDEVCEMLVEGSLYIERNPKLVKSMTSFPYIASSI* |
| Ga0137391_101098227 | 3300011270 | Vadose Zone Soil | MDEVGDKLVEAALYIERNPKMVKSITSFPYIMKSL* |
| Ga0137391_102149342 | 3300011270 | Vadose Zone Soil | MDAVYDKLEEAALYIERNRKVVKSIASFPYIVKSS* |
| Ga0137393_117180741 | 3300011271 | Vadose Zone Soil | YALKSIAAVRNKLRQAIIYIERNPQTVKSITSFPYIVRSF* |
| Ga0137464_12750852 | 3300011434 | Soil | DEVNDKLDEAALYIERNPKLVKSITSFPYIAKSS* |
| Ga0120139_10056065 | 3300012019 | Permafrost | LKSIDAVRAKLEQAILYVERNPKTVKSITSFPYILKSL* |
| Ga0137431_10321854 | 3300012038 | Soil | MNEVNDKLDEAALYIERNPKLVKSITSFPYIAKSF* |
| Ga0153924_10099921 | 3300012089 | Attine Ant Fungus Gardens | MDAVRAKLRRAILYMERNPTLIRSITSFPYIVNSL* |
| Ga0137389_101920271 | 3300012096 | Vadose Zone Soil | MDEVCDKLVEAALYIERNPEIVKSLTSFPYIVKSL* |
| Ga0137389_109980051 | 3300012096 | Vadose Zone Soil | MDDVYAKLEEAALYIERNPAIVKSITSFPYIIRSF* |
| Ga0137389_116594711 | 3300012096 | Vadose Zone Soil | DAVYRKLDEAILYIERNPETVKSITSFPYIAKSL* |
| Ga0153990_10285363 | 3300012169 | Attine Ant Fungus Gardens | LDHNGWDDAVHAKLKQAILYIERNTKLVQSITSFPYIVNSL* |
| Ga0137388_110294901 | 3300012189 | Vadose Zone Soil | MDEVCDKLVEAALYIERNPELVKSITSFPYIVKSS* |
| Ga0137388_118797641 | 3300012189 | Vadose Zone Soil | IDDVYAKLEEAALYIERNPTIVKSITSFPYIVRSL* |
| Ga0137364_109975471 | 3300012198 | Vadose Zone Soil | KSIDAVRRKLKEAILYIERNPKTVKSITSFPYIARSL* |
| Ga0137365_106520871 | 3300012201 | Vadose Zone Soil | IDAVRRKLEQAILYIEHNPETVQSITSFPYIVKSL* |
| Ga0137399_105502141 | 3300012203 | Vadose Zone Soil | NYALKSMEEVYAKLEDAALYIERNPDLVKSITSFPYIARSI* |
| Ga0137362_102937832 | 3300012205 | Vadose Zone Soil | MDEVYDKLEEAALYLERNPELVKSITSFPYIAKSL* |
| Ga0137381_112169902 | 3300012207 | Vadose Zone Soil | MEEVNDKLDEAALYIENNPKIVKSIASFPYIANSF* |
| Ga0137379_107418441 | 3300012209 | Vadose Zone Soil | NYALKSIDAVRRKLEQAILYIKHNPETVQSITSFPYIVKSL* |
| Ga0137370_108737562 | 3300012285 | Vadose Zone Soil | MEAVYDKLVDAALYIERNRTLVKSIASFPYIVKSS* |
| Ga0137366_110189681 | 3300012354 | Vadose Zone Soil | IDAVRRKLEQAILYIEHNPETVQSITSFTYIVKSL* |
| Ga0137360_100255758 | 3300012361 | Vadose Zone Soil | ALKSIDDVYAKLEEAALYIERNPTIVKSITSFPYFVRSL* |
| Ga0137360_101563773 | 3300012361 | Vadose Zone Soil | MDEVCDKLVEAALYIERNPEIVKSITSFPYIVKSL* |
| Ga0137361_113245941 | 3300012362 | Vadose Zone Soil | DEVCDKLVEAALYIERNPEIVKSITSFPYIVKSL* |
| Ga0150984_1232024542 | 3300012469 | Avena Fatua Rhizosphere | MDAVYDKLVEGALYIERNRKLVKSIASFPYIVKSS* |
| Ga0157285_100099901 | 3300012897 | Soil | KSIDAVRAKLKQAILYIERNPKIVQSITSFPYIATSL* |
| Ga0137396_108953912 | 3300012918 | Vadose Zone Soil | EDVYAKLEEAALYIERNPSIVKSITSFPYIAKSI* |
| Ga0137410_120492022 | 3300012944 | Vadose Zone Soil | DEVNDKLDEAALYIKRNPACVKSIASFPYIAKSF* |
| Ga0126375_120064142 | 3300012948 | Tropical Forest Soil | ALKSMDAVRAKLRQAILYIERNPKLVRSITSFPYIANSL* |
| Ga0164302_112416852 | 3300012961 | Soil | MDAVRAKLKQAILYIERNPKLVRSISSFPYIVNSL* |
| Ga0126369_100112411 | 3300012971 | Tropical Forest Soil | MEDVYAKLEEAALYIERNPALVKSITSFPYIARSI* |
| Ga0126369_100868572 | 3300012971 | Tropical Forest Soil | MFAESMDDVYAKLEQAALYIERNPALVKSITSFPYIARSI* |
| Ga0126369_105117973 | 3300012971 | Tropical Forest Soil | MNDVYDKLEEAALYIERNPALVKSITSFPYIVSSL* |
| Ga0126369_117833941 | 3300012971 | Tropical Forest Soil | IDDVYAKLEEAALYIERNPALVKSITSFPYIAKSI* |
| Ga0126369_124044402 | 3300012971 | Tropical Forest Soil | LKSMDEVYGKLEEAALYIQRNPKIVKSITSFPYIAKSL* |
| Ga0126369_126385082 | 3300012971 | Tropical Forest Soil | MDEVYDKLDEAALYIEGNRELVKSITSFPYIVRSS* |
| Ga0126369_136300441 | 3300012971 | Tropical Forest Soil | LDGVYAKLEETALYIERNPALVKSITSFPYIARSI* |
| Ga0164308_110631041 | 3300012985 | Soil | MDAVRAKLKQAILYIERNPKLVRSITSFPYVVSSL* |
| Ga0181518_102425251 | 3300014156 | Bog | KSIDAVRTKLKQAILYIERNPKMVSSITSFPYIRRSF* |
| Ga0181532_1000199919 | 3300014164 | Bog | DAVRTKLEEAILYIERNPKTVKSITSFPYIVKSL* |
| Ga0181523_105524441 | 3300014165 | Bog | SIDAVRAKLKQAILYIERNPKTVKSITPFPYIIRSL* |
| Ga0181523_105712581 | 3300014165 | Bog | IDAVRAKLKQAILYIERNPKTVKSITSFPYIVRSL* |
| Ga0181535_102512141 | 3300014199 | Bog | DDVNAKLDEAAFYIERNPALVKSITSFPYIAKSL* |
| Ga0163163_114283492 | 3300014325 | Switchgrass Rhizosphere | MDEVKDKLDETALYIERNPKIAKSIASFSYIAKSF* |
| Ga0182018_101562422 | 3300014489 | Palsa | DDVNAKLDEAAFYIERNPTLVKSITSFPYIAKSL* |
| Ga0182019_109769852 | 3300014498 | Fen | MNAVRAKLREAVLYIERNPELVKSITAFPYIAKSI* |
| Ga0182024_106718502 | 3300014501 | Permafrost | SIDAVHAKLKQAILYVERNPKAVKSITSFPYIVRSL* |
| Ga0182024_114418152 | 3300014501 | Permafrost | VAVRAKLEEAILYIERNPETVKSITSFPYIRKSS* |
| Ga0182024_118401241 | 3300014501 | Permafrost | SMDDVNAKLDEAAFYIERNPTLVKSITSFPYIAKSL* |
| Ga0182024_123598031 | 3300014501 | Permafrost | ALKSMDDVNAKLDEAAFYIERNPTLVKSISSFPYIAKSL* |
| Ga0182024_124194562 | 3300014501 | Permafrost | DAVRTKLKHAILYIERNSKTVQSITSFPYILKSL* |
| Ga0181536_100277451 | 3300014638 | Bog | MNAVRTKLEEAILYIERNPKTVKSITSFPYIVKSL* |
| Ga0181536_100482121 | 3300014638 | Bog | KSMNAVRTKLEEAILYIERNPKTVKSITSFPYIVKSL* |
| Ga0181536_101533742 | 3300014638 | Bog | IDAVRAKLKQAIHYVERNPKTVKSITSFPYIVKSF* |
| Ga0181536_102489901 | 3300014638 | Bog | NAVRTKLEEAILYIERNPKTVKSITSFPYIVKSL* |
| Ga0180085_12347911 | 3300015259 | Soil | KSIDAVCAKLDEAILYLERNPDIVKSITGFPYIINSL* |
| Ga0132255_1006297783 | 3300015374 | Arabidopsis Rhizosphere | HEVYAKLRQAVLYIERNPNLVRSITSFPYIVNSL* |
| Ga0132255_1024253031 | 3300015374 | Arabidopsis Rhizosphere | MDAVRAKLKQAILYIERNPDLVRSIASFPYIVNSI* |
| Ga0182036_102638301 | 3300016270 | Soil | MNEVYGKLEEAALYIQRNPQIVKSITSFLYIAKSL |
| Ga0182036_103829712 | 3300016270 | Soil | MDDVYAKLEEAALYIERNPALVKSITSFPYIAKST |
| Ga0182036_109955581 | 3300016270 | Soil | ALKSMDAVRAKLKQAILYIERNPGLVRSMTSFPYIINSL |
| Ga0182036_116062822 | 3300016270 | Soil | MENVYDKLQEAALYLERNPKIVQSITAFPYIAKSF |
| Ga0182041_101344991 | 3300016294 | Soil | MDAVQAKLRQAILYIERNRALVRSITSFPYIVNSL |
| Ga0182041_108473882 | 3300016294 | Soil | KSMDAVRAKLQRAILYIERNPNLVRSITSFPYILYRQLTLM |
| Ga0182041_115780731 | 3300016294 | Soil | ALKSMSDVNAKLDEASLYIERSRTLVKSIASFPYIAKSY |
| Ga0182041_119247991 | 3300016294 | Soil | ALKSMSDVNAKLDEASLYIERSRTLVKSIASFPYIAKSC |
| Ga0182041_120570311 | 3300016294 | Soil | YALKSMSDVNAKLDEASLYIERSRTLVKSIASFPYIAKSY |
| Ga0182041_122785301 | 3300016294 | Soil | MDAVRAKLQRAILYIERNPNLVRSITSFPYIVNSL |
| Ga0182033_102818852 | 3300016319 | Soil | MDAVRAKLKQAILYIERNPKIVRSITSFPYIVNSI |
| Ga0182033_105645251 | 3300016319 | Soil | MDEVCDMLVEGSLYIERNPELVKSMTSFPYIASSI |
| Ga0182033_106228341 | 3300016319 | Soil | KNYALKSIDEVRAKLRQAILYIERNPKLVRSIASFPYIANSL |
| Ga0182033_109694261 | 3300016319 | Soil | KNYALKSMSDVNAKLDEASLYIERSRTLVKSIASFFYIAKSY |
| Ga0182033_111364191 | 3300016319 | Soil | ALKSMDAVQAKLRQAILYIERNRALVRSITCFPYIVNSL |
| Ga0182033_112833951 | 3300016319 | Soil | IFKNYALKSMSDVNTKLDEASLYIERSRTLVKSIASFPYIAKSY |
| Ga0182032_102389461 | 3300016357 | Soil | KSMDKVCDKLEEAALYIERNPKMVKSITSFPYIVRSM |
| Ga0182034_105075861 | 3300016371 | Soil | KNYALKSMSDVNVKLDEASLYIERSRTLVKPIASFPYIAKSC |
| Ga0182034_111616212 | 3300016371 | Soil | YALKSMDAVRRKLREAILYIERNPSVVRSITSFPYIAKSL |
| Ga0182040_100503675 | 3300016387 | Soil | LKSIDAVRRKLEQAILYIERNPETVKSITSFPYIVRSL |
| Ga0182040_105434311 | 3300016387 | Soil | YALKSMDAVRAKLQRAILYIERNSNLVRSITSFPYIVNSL |
| Ga0182040_119467421 | 3300016387 | Soil | MSDVNAKLDEASLYIERSRTLVKSIASFPYIAKSC |
| Ga0182037_101465741 | 3300016404 | Soil | MDAVRAKLKQAILYIERNPEIVRSITSFPYIANSI |
| Ga0182037_110120011 | 3300016404 | Soil | NYALKSMSDVNAKLDKASFYIERSRTLVKSIASFPYIAKSY |
| Ga0182039_110597732 | 3300016422 | Soil | FKNYALKSMDAVRAKLQRAILYIERNPNLVRSITSFPYIVNSL |
| Ga0182039_110923852 | 3300016422 | Soil | MDAVRRKLREAILYIERNPSVVRSITSFPYIAKSL |
| Ga0182039_119448191 | 3300016422 | Soil | KSMSDVNAKLDEASLYIERSRTLFKSIASFPYIAKSY |
| Ga0182039_120669611 | 3300016422 | Soil | KSMSDVNAKLDEASFYIERSRTLVKSIASFPYIAKSY |
| Ga0182038_117040541 | 3300016445 | Soil | SMNAVRVKLKQGILYIERNPKLVRSLTPFPYIVNSL |
| Ga0187812_12706231 | 3300017821 | Freshwater Sediment | MAAVRAKLNQAILYLERNPKLVRSITSFPYIVNSL |
| Ga0187802_103274701 | 3300017822 | Freshwater Sediment | ALKSMDEVYDKLEEAALYLERNPELVKSITSFPYIAKSF |
| Ga0187856_100682010 | 3300017925 | Peatland | IDAVRAKLKQAILYVERNPKTVKSITSFPYIVKSF |
| Ga0187806_10960632 | 3300017928 | Freshwater Sediment | MEDVYAKLEQAALYIERNPAIVKSITSFPYIVRSI |
| Ga0187814_103773172 | 3300017932 | Freshwater Sediment | MDKVYDKLQEAALYLERNPKIVQSITAFPYIAKSF |
| Ga0187819_100613471 | 3300017943 | Freshwater Sediment | MDAVRTKLEEAILYIERNPKIVKSITSFPYIVKSL |
| Ga0187819_108746512 | 3300017943 | Freshwater Sediment | LRRRDGVKSIDAVRTKLEEAILYIERNSKTVKSITSFPYIVKSP |
| Ga0187879_101040751 | 3300017946 | Peatland | MDAVRTKLEEAILYIERNPKTVKSITSFPYIVKSL |
| Ga0187817_103361061 | 3300017955 | Freshwater Sediment | LKSMDAVHAKLEQAILYVKSNPMTVKSITSFPYITSSF |
| Ga0187780_109623341 | 3300017973 | Tropical Peatland | KNYALKSMDEVYAKLEEAALYIERNPAIVKSITSFPYIANSI |
| Ga0187782_107482832 | 3300017975 | Tropical Peatland | YALKSMAEVHEKLEGAILYVDRNPKLVKSITSFPYIVKSF |
| Ga0187823_100079451 | 3300017993 | Freshwater Sediment | MDAVRAKLNQAILYLERNPKLVRSITSFPYIVNSL |
| Ga0187822_103146021 | 3300017994 | Freshwater Sediment | MDKVCDKLEEAALYIKRNPKTVKSITSFPYIVGST |
| Ga0187822_103474681 | 3300017994 | Freshwater Sediment | AAKSMDEVCKMLVEGSLYIERNPELVKAMTSFPYIASSI |
| Ga0187816_101753761 | 3300017995 | Freshwater Sediment | KSMDAVRAKLRQAILYIERNPKLVRSITSFPYIVNSL |
| Ga0187891_11364773 | 3300017996 | Peatland | YALKSMNDVYAKLEEAALYIERNPTLVKSITSFPYIVKSL |
| Ga0187767_100097862 | 3300017999 | Tropical Peatland | MEEVCDKLVESSLYIERYPNTVKSMTSSPYIMNLTVIRQWL |
| Ga0187815_100338411 | 3300018001 | Freshwater Sediment | SMDAVHAKLEQAILYVKSNPMTVKSITSFPYITRSF |
| Ga0187888_12693941 | 3300018008 | Peatland | MNAVRTKLEEAILYIERNPKTVKSITSFPYIVKSL |
| Ga0187860_13332402 | 3300018014 | Peatland | SIDAVRAKLKQAILYVERNPKTVKSITSFPYIVKSF |
| Ga0184605_104927601 | 3300018027 | Groundwater Sediment | IDAVRAKLKEAILYMERKPEIVKSITSFPYILKSP |
| Ga0187859_100708911 | 3300018047 | Peatland | ALKSIDAVRAKLKQAILYIERNPKTVKSITPFPYIIRSL |
| Ga0187859_103468371 | 3300018047 | Peatland | IDAVRAKLKQAILYIERNPKTVKSITSFPYIVRSL |
| Ga0187766_102500431 | 3300018058 | Tropical Peatland | MDEVCEMLVEGSLYIERNPELVKFMTSFPYIASSI |
| Ga0187766_102724142 | 3300018058 | Tropical Peatland | ACKSMDEVCDKLEDGALRLGNNRKLVKSITSFPYIINSL |
| Ga0187766_109326221 | 3300018058 | Tropical Peatland | IFKNYACKSMDEVCDKLEDGALRLENNRKLVKSITWFPYIISSL |
| Ga0187784_104002373 | 3300018062 | Tropical Peatland | MDEVYDKLEEAALYIERSRELVKSISSFPYIVRSS |
| Ga0187773_112284381 | 3300018064 | Tropical Peatland | LKSIAAVYAKLEQAILYIERNPKLVRSITSFPYIANSL |
| Ga0184624_100703473 | 3300018073 | Groundwater Sediment | MDVVQAKLKEAILYMERNPKLVRSITSFPYIVKSL |
| Ga0187772_103090332 | 3300018085 | Tropical Peatland | MEEVCDKLVESSLYIERYPNTVKSITSSPYIMNLTVIRQWL |
| Ga0187772_103564351 | 3300018085 | Tropical Peatland | LRENHAAKSMDEVCEKLVKGSLYIERNPELVKSMTSFPYIASSI |
| Ga0187772_106016403 | 3300018085 | Tropical Peatland | MREVSNKLVKAALYIERNLKMVKSMTSFPYIMNAL |
| Ga0187769_104388391 | 3300018086 | Tropical Peatland | IAAVYAKLEQAILYIERNPKLVRSITSFPYIANSL |
| Ga0187769_105274061 | 3300018086 | Tropical Peatland | NYALKSIAAVYAKLEQAILYIERNPKLVRSITSFH |
| Ga0187769_113931251 | 3300018086 | Tropical Peatland | IDAVRAKLEQAILYLEHNPDIVKSITGFPYITKSP |
| Ga0187774_108162042 | 3300018089 | Tropical Peatland | FKNYALKSIAAVYAKLEQAILYIERNPKLIRSITSFP |
| Ga0066667_114180892 | 3300018433 | Grasslands Soil | MDEVYDKLEEAALYIECNPRVVKSIASFPYIVKSL |
| Ga0193727_11558482 | 3300019886 | Soil | INAVRTKLRQAILYIERNPEIVKSITSFPYIAKSL |
| Ga0193751_12126312 | 3300019888 | Soil | SMSEVNAKLDEAALYIKRNPTLVKSITSFPYIAKSL |
| Ga0193728_11318692 | 3300019890 | Soil | SMDAVRAKLKQAILYIERNPKLVRSISSFPYIVNSL |
| Ga0193731_10996782 | 3300020001 | Soil | SMDAVRAKLKQAILYIERNPGLVRSITSFPYIINSL |
| Ga0193721_10553692 | 3300020018 | Soil | SMDEVNDKLDEAALYIKRNQKLVKSITSFPYIAKSF |
| Ga0179594_102504572 | 3300020170 | Vadose Zone Soil | SIDAVRAKLKQAILYIERNPKLVQSITSFPYIVKSS |
| Ga0179592_104290862 | 3300020199 | Vadose Zone Soil | SMEEVYAKLEDAALYIERNPDLVKSITSFPYIARSI |
| Ga0179592_104643562 | 3300020199 | Vadose Zone Soil | MDAVRAKLKQAILYIERNPKLVRSITSFPYIVNSL |
| Ga0210407_101640303 | 3300020579 | Soil | SMDAVRAKLRRAILYMERNPKLIRSITSFPYIVNSL |
| Ga0210407_103014023 | 3300020579 | Soil | MDAVCAKLKQAVLYIERNPKLVRSITAFPYIINSL |
| Ga0210407_107174492 | 3300020579 | Soil | SMDDVNAKLDEAAFYIERNPTLVRSITSFPYIAKSL |
| Ga0210403_103385973 | 3300020580 | Soil | MDAVRAKLRQAILYIERSPKLVRSITSFPYIVNSL |
| Ga0210401_110210331 | 3300020583 | Soil | IDAVHAKLKQAMLYIERNAKLVQSITSFPYIVNSL |
| Ga0179596_103651243 | 3300021086 | Vadose Zone Soil | MDAVCQKLQEAILYIERNPQMVKSITSFPYIAKSF |
| Ga0210406_102346643 | 3300021168 | Soil | MSDVNVKLDEASLYIERSRTLVKSIASFPYIAKSY |
| Ga0210405_100689235 | 3300021171 | Soil | KSMDSVRAKLRRAILYMERNPKLIRSITSFPYIVNSL |
| Ga0210408_102126932 | 3300021178 | Soil | SMEEVYVKLEDAALYIEHNPALVKSITLFPYIANSI |
| Ga0213882_104896042 | 3300021362 | Exposed Rock | MDEVYAKLEEAALYIERNPAIVKSITSFPYIAKSL |
| Ga0213874_101614503 | 3300021377 | Plant Roots | MDKVYGKLEEAALYIQQNPNVVKSITSFPYIVKSL |
| Ga0210393_100933031 | 3300021401 | Soil | MDAVRAKLRRAILYMERNPKLIRSITSFPYIVNSL |
| Ga0210385_108415343 | 3300021402 | Soil | MDDVNAKLDEAAFYIERNPALVKSITSFPYIAKSL |
| Ga0210389_103221051 | 3300021404 | Soil | MDAVRAKLRQAILYIERNPKLVRSITSFPYIVNSL |
| Ga0210387_109746061 | 3300021405 | Soil | MDAVRAKLKQAILYIERNPGLVRSITSFPYIINSL |
| Ga0210386_112390811 | 3300021406 | Soil | MDAVCAKLKQAVLYIERNPKLVRSITAFPYIVNSL |
| Ga0210394_106858921 | 3300021420 | Soil | SMNAVRTKLREAVLYIERNPELVKSITTFPYIAKSI |
| Ga0210394_112068212 | 3300021420 | Soil | IDHVRQKLHEAILYIEHNADVVKSIASFPYISKSF |
| Ga0210394_114764221 | 3300021420 | Soil | SIDHVRQKLHEAILYIERNPKVVKSITSFPYIAKSF |
| Ga0210391_100987261 | 3300021433 | Soil | SMDDVNAKLDEAAFYIERNPALVKSITSFPYIAKSL |
| Ga0210391_112221141 | 3300021433 | Soil | LKSMDAVRAKLRQAILYIERNPKLVRSITSFPYIVNSL |
| Ga0187846_100762024 | 3300021476 | Biofilm | MDDVYAKLEEAALYIERNPALVKSITSFPYIARSI |
| Ga0210398_102405551 | 3300021477 | Soil | IDHVRQKLHEAILYIERNPKVVKSITSFPYIAKSF |
| Ga0210402_105369991 | 3300021478 | Soil | SIDAVRTKLKQAILYIQRNPKLVSSITSFPYIVNSF |
| Ga0210402_106707201 | 3300021478 | Soil | MNDVYAKLEEAVFYIDCNPKLVKSITSFPYIIRSL |
| Ga0210402_112631371 | 3300021478 | Soil | MNHVYAKLDEAALYIEQNPKLVKSITSFPYIVKST |
| Ga0210409_107970001 | 3300021559 | Soil | SMDEVCAKLRQAVLYIERNPKLVRAITSFPYIVNSL |
| Ga0126371_101339963 | 3300021560 | Tropical Forest Soil | MDKVCDKLEEAALYIERNPKMVKSITSFPYIVRSM |
| Ga0126371_109934853 | 3300021560 | Tropical Forest Soil | ALKSMNGVRAKLKQAILYIERNPDLVRSITSFPYIVNSI |
| Ga0126371_113577971 | 3300021560 | Tropical Forest Soil | MDDVYDKLEEAALYIERNPAIVKSITSFPYIVRSI |
| Ga0126371_120557891 | 3300021560 | Tropical Forest Soil | MDEVCEKLVKGSLYIERNPELVKSMTSFPYIESSL |
| Ga0126371_123143312 | 3300021560 | Tropical Forest Soil | MDEIYDKLDEAALYIEGNRELVKSITSFPYIVRSS |
| Ga0126371_132641202 | 3300021560 | Tropical Forest Soil | MDAVRAKLKQVILYIERNPKLVRSIASFPYIVNSL |
| Ga0126371_136908843 | 3300021560 | Tropical Forest Soil | ALKSMDAVRAKLRQAILYIERNPKLVRSITSFPYIANSL |
| Ga0212123_1000498225 | 3300022557 | Iron-Sulfur Acid Spring | SMDAVRAKLRQAILYIERSPKLVRSITSFPYIVNSV |
| Ga0212123_100706254 | 3300022557 | Iron-Sulfur Acid Spring | LKSMDAVRAKLRRAILYMERNPKLIRSITSFPYIVNSP |
| Ga0247747_10233301 | 3300022737 | Soil | SIDAVRAKLKQAILYIERNPKIVQSITSFPYIATSL |
| Ga0179589_103632181 | 3300024288 | Vadose Zone Soil | MEEVYAKLEDAALYIERNPDLVKSITSFPYIARSI |
| Ga0208193_10708762 | 3300025463 | Peatland | IDHVQRKLREAILYVEHNPDMVKSIASFPYIAKSF |
| Ga0208691_10250892 | 3300025612 | Peatland | SMNAVRAKLKEAVLYIERNPELVKSITAFPYIAKSI |
| Ga0208220_10613963 | 3300025627 | Arctic Peat Soil | SIDAVRTKLKQAILYIERNPKLVQSITSFPYIVNSL |
| Ga0207699_102050653 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SIDAVRTKLKAAILYMERKPEIVKSITSFPYIIKSL |
| Ga0207699_108198192 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YALKSIDAVRAKLKQAILYIERNPKIVQSITSFPYIATSL |
| Ga0207699_109481811 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SMDAVRAKLKQAILYIERNPKLVRSITSFPYIVSSL |
| Ga0207663_107656541 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAVRAKLKQAILYIERNPKLVRSITSFPYIVSSL |
| Ga0207664_102965594 | 3300025929 | Agricultural Soil | MDAVRAKLKQAILYIERNPKHVRSITSFPYIVKSL |
| Ga0207640_105679912 | 3300025981 | Corn Rhizosphere | VRWKSIDAVRRKLEQAILYIERNPKTVKSITSFPYIV |
| Ga0209840_10765422 | 3300026223 | Soil | IDAVRAKLKQAILYIERNPKLVQSITSFPYIVKSS |
| Ga0257154_10158071 | 3300026467 | Soil | SMDAVYDKLEEAALYIERNRKVVKSIASFPYIVKSS |
| Ga0257164_10544281 | 3300026497 | Soil | SMDAVRAKLKQAILYIERNPKLVRSITSFPYIVNSL |
| Ga0209056_105088062 | 3300026538 | Soil | KNYALKSMDEVCDKLVEAALYIERNPELVKSITSFPYIVKSL |
| Ga0179587_1000367011 | 3300026557 | Vadose Zone Soil | MDEVGDKLVEAALYIERNPKMVKSITSFPYIMKSL |
| Ga0207746_10023601 | 3300026865 | Tropical Forest Soil | NYALKSIDAVRAKLKKAILYIERNPRTVKSITSFPYILKSL |
| Ga0207824_10092753 | 3300026990 | Tropical Forest Soil | KNYALKSIDAVRAKLKKAILYIERNPRTVKSITSFPYILKSL |
| Ga0207762_10364682 | 3300027063 | Tropical Forest Soil | NYALKSMDAVQAKLRQAILYIERNRALVRSITSFPYIVNSL |
| Ga0208525_10386163 | 3300027288 | Soil | ALKSMNDVYDKLEEAVFYIDRNPKLVKSITSFPYIVRSL |
| Ga0209854_10766982 | 3300027384 | Groundwater Sand | SMNAVRAKLNEAVLYIERNPAIVKSITSFPYIAKSF |
| Ga0209179_10923402 | 3300027512 | Vadose Zone Soil | SMDEVNDKLDEAALYIKRNPACVKSIASFPYIAKSF |
| Ga0209524_10188371 | 3300027521 | Forest Soil | MNEVRAKLRQAILYIERNPKLVRSITSFLYIVNSL |
| Ga0208043_10496203 | 3300027570 | Peatlands Soil | IDAVRAKLEEAILYIERNPETVKSIASFPYIRKSL |
| Ga0208043_10900593 | 3300027570 | Peatlands Soil | IDAVRAKLKQAILYIERNPKIVKSITSFPYIRKSF |
| Ga0208043_11885002 | 3300027570 | Peatlands Soil | SMDEVCDKLVEAALYIERNPKMVKSMTSFPYIMNSL |
| Ga0208324_11321932 | 3300027604 | Peatlands Soil | SIDAVRAKLRRAILYMERNPKLIRSITSFPYIVNSL |
| Ga0209060_100015981 | 3300027826 | Surface Soil | MEDVYAKLEEAALYIERNPAIVKSITSFPYIVRSI |
| Ga0209580_101023511 | 3300027842 | Surface Soil | YALKSMAEVHEKLEEAILYVDRNPKLVKSITSFPYIARSF |
| Ga0209580_104268112 | 3300027842 | Surface Soil | MAEVHEKLEEAILYVDRNPKLVKSITSFPYIVRSF |
| Ga0209517_104908172 | 3300027854 | Peatlands Soil | IDAVYAKLNEAISYINRNPELVKSITSFPYIVRSF |
| Ga0209167_103027122 | 3300027867 | Surface Soil | MDAVRVKLQHAILYLERNPKLVRSITSFPYIVNSL |
| Ga0209590_106113632 | 3300027882 | Vadose Zone Soil | SMNEVNAKLDEAALYIERHPTLVKSITSFPYITKSL |
| Ga0209590_109714381 | 3300027882 | Vadose Zone Soil | SMDEVCDKLVEAALYIERNPEIVKSITSFPYIVKSL |
| Ga0209275_100595974 | 3300027884 | Soil | KSMDAVRAKLKQAILYIERNPGLVRSITSFPYIINSL |
| Ga0209624_110950082 | 3300027895 | Forest Soil | SIDAVYAKLNEAIGYINRNPELVKSITSFPYIVRSF |
| Ga0209415_106990161 | 3300027905 | Peatlands Soil | AAKSMDEVCDKLVEAALYIERNPKMIKSMTSFPYIMNSL |
| Ga0209583_100429741 | 3300027910 | Watersheds | KNFALKSINAVRAKLQEAVLYIERNPELVKSITAFPYIAKSI |
| Ga0255359_1251031 | 3300028060 | Soil | SMNAVRAKLREAVLYIERNPELVKSITAFPYIAKSI |
| Ga0268265_101240083 | 3300028380 | Switchgrass Rhizosphere | SIDEVCDKLVHASLYIERNRKMVKSMTSFPYITNSL |
| Ga0302233_102653051 | 3300028746 | Palsa | SMDAVRAKLKQAILYIERNPRLVRSITSFPYIINSL |
| Ga0302156_101743961 | 3300028748 | Bog | MNAVRAKLREAVLYIERNPELVKSITSFPYIAKSI |
| Ga0302234_100245801 | 3300028773 | Palsa | MNAVRAKLKEAVLYIERNPELVKSITAFPYIAKSI |
| Ga0308309_116437841 | 3300028906 | Soil | MDAVRAKLKQAILYIERNPKLVRSISSFPYIVNSL |
| Ga0308309_118089401 | 3300028906 | Soil | SIDAVHAKLKHAMLYIERNAKLVQSITSFPYIVNSL |
| Ga0311332_117945872 | 3300029984 | Fen | MNAVRAKLREAVLYIGRNPELVKSITAFPYIAKSI |
| Ga0311339_100700899 | 3300029999 | Palsa | NYALKSMDEVYSKLEDAALYIERNPALVRSITSFPYIAKSI |
| Ga0311350_118587612 | 3300030002 | Fen | LALKSMNAVRAKLWEAVLYIGRNPELVKSITAFPYIAKSI |
| Ga0311338_100744069 | 3300030007 | Palsa | SMDEVCSKLEDAALYIERNPALVRSITSFPYIAKSI |
| Ga0311338_106011831 | 3300030007 | Palsa | NGLRIHAVDQSKLEDAALYIERNPALVRSITSFPYIAKSI |
| Ga0311353_102696003 | 3300030399 | Palsa | MDAVRAKLKQAILYIERNPRLVRSITSFPYIINSL |
| Ga0310039_100104447 | 3300030706 | Peatlands Soil | SMDEVYDKLVEAALYIERNPRMVKSMTSFPYIMNSL |
| Ga0170823_152538751 | 3300031128 | Forest Soil | ALKSMDDVNAKLDEAAFYIERNPTLVRITSFPYIAKSL |
| Ga0170824_1222992581 | 3300031231 | Forest Soil | IDAVHAKLKQAVLYIERNAKLVQSITSFPYIVNSL |
| Ga0265320_103000203 | 3300031240 | Rhizosphere | MNQVYDKLEEATFYMERNPKLVKSITSFPYIVKSL |
| Ga0265331_104182091 | 3300031250 | Rhizosphere | SINAVRAKLREAVLYIERNPELVKSITAFPYIAKSI |
| Ga0318516_100480504 | 3300031543 | Soil | MDAVRAKLKQAILYIERNPGLVRSMTSFPYIINSL |
| Ga0307373_106374382 | 3300031672 | Soil | SINAVRAKLEQAILYIDRNPKIVKSITSFPYIRKSS |
| Ga0318574_106152841 | 3300031680 | Soil | NYALKSMDAVYDKLEEAAIYMERNRKIVKSIASFPYIVKSS |
| Ga0310686_1021796651 | 3300031708 | Soil | SMDDVNAKLDEAAFYIERNPTLVKSITSFPYIAKSL |
| Ga0310686_1131459531 | 3300031708 | Soil | IDAVHQKLEEAILYIERNPEVVKSITSFPYIAKSF |
| Ga0306917_104097152 | 3300031719 | Soil | SMDEVRAKLRQAVLYIERNPNLVRSITSFPYIVSSL |
| Ga0318493_106223931 | 3300031723 | Soil | SMDAVRAKLQRAILYIERNPNLVRSITSFPYIVNSL |
| Ga0302321_1023944611 | 3300031726 | Fen | MDEVNDKIDEAALYIERNPKLIKSLTSFPYIAKSF |
| Ga0306918_105363643 | 3300031744 | Soil | SMSDVNAKLDEASLYIERSRTLVKSITSFPYIAKSY |
| Ga0306918_107950161 | 3300031744 | Soil | MDAVRAKLKQAILYIERNPGLVRSITSFPYIIKSL |
| Ga0306918_112620971 | 3300031744 | Soil | MEDVYAKLAEAALYIERNPAIAKSITSFPYIAKSI |
| Ga0306918_115436371 | 3300031744 | Soil | SMDEVYAKLEEAALYIERNPAIVKSITSFPYIAKSI |
| Ga0318546_105166391 | 3300031771 | Soil | YALKSMDAVQAKFRQAILYIERNRALVRSITSFPYMVNSL |
| Ga0318547_100674963 | 3300031781 | Soil | MDAVRAKLKQAILYIERNPKIVRSITSFPYIANSI |
| Ga0318523_105425072 | 3300031798 | Soil | LKSMDAVRAKLKQAILYIERNPKLVRSITSFPYIVNSL |
| Ga0318497_103352022 | 3300031805 | Soil | LKSMDDVYAKLEEAALYIERNPALVKSITSFPYIAKST |
| Ga0307478_105045332 | 3300031823 | Hardwood Forest Soil | SMDAVRAKLRQAILYIERNPKLVRSITSFPYIVNSL |
| Ga0315290_105852871 | 3300031834 | Sediment | KNFALKSMDAVHAKLREGILYIERNPELVKSITTFPYIAKSI |
| Ga0315290_110008351 | 3300031834 | Sediment | FALKSMDAVHAKLREGILYIERNPELVKSITTFPYIAKSI |
| Ga0318517_104032601 | 3300031835 | Soil | SMDEVYAKLEDAALYIERNPALVKSITSFPYIARSI |
| Ga0310907_101668252 | 3300031847 | Soil | KSIDAVRAKLKQAILYIERNPKIVQSITSFPYIATSL |
| Ga0306925_101090216 | 3300031890 | Soil | MDAVYDKLEEAALYIERNPKVVKSIASFPYIVKSS |
| Ga0306925_101798733 | 3300031890 | Soil | MDAVRVKLKQAILYIERNPELIRSITSFPYIANSL |
| Ga0306925_119704771 | 3300031890 | Soil | MDEVYAKLEDAALYIERNPALVKSITSFPYIARSI |
| Ga0306925_121960691 | 3300031890 | Soil | SINAVHRKLEEAILYIERNPKLVRSITSFPYIVKSF |
| Ga0318520_102000941 | 3300031897 | Soil | SMDAVQAKLRQAILYIERNRALVRSITSFPYIVNSL |
| Ga0306923_106040481 | 3300031910 | Soil | MDAVRAKLQQAILYIERNPNLVRSITSFPYIVNSL |
| Ga0306923_106249543 | 3300031910 | Soil | IDAVRRKLEQAILYIERNPETVKSITSFPYIVRSL |
| Ga0306921_103754091 | 3300031912 | Soil | SMDNVYAKLEEATFYIERNPALVRSITSFPYITKSI |
| Ga0306921_105236731 | 3300031912 | Soil | SMAEVHEKLEEAILYVDRNPKLVKSMTSFPYIVRSF |
| Ga0306921_110455842 | 3300031912 | Soil | IDEVCEMLVEGSLYIERNPELVKSMTSFPYIASSI |
| Ga0306921_111173641 | 3300031912 | Soil | LKSMDAVRAKLKQAILYIERNPKIVRSITSFPYIANSI |
| Ga0306921_111279273 | 3300031912 | Soil | SIDAVRRKLEQAILYIERNPETVKSITSFPYIIRSL |
| Ga0310912_101471051 | 3300031941 | Soil | SMSEVNAKLDEASLYIERSRTLVKSIASFPYIAKSC |
| Ga0310912_111676701 | 3300031941 | Soil | YALKSMDEVYGKLEEAALYIQRNPKIVKSITSFPYIAKSL |
| Ga0310916_104144011 | 3300031942 | Soil | NYALKSMDAVRAKLKQAILYIERNPKIVRSITSFPYIANSI |
| Ga0310916_105576823 | 3300031942 | Soil | NYALKSMDAVRAKLQRAILYIERNSNLVRSITSFPYIVNSL |
| Ga0310916_107784071 | 3300031942 | Soil | MDEVYGKLEDAALYIRRNPKTVKSITSFPYIVKSL |
| Ga0310910_104137692 | 3300031946 | Soil | SMDAVRAKLKQAILYIERNPKIVRSITSFPYIVNSI |
| Ga0310909_105783783 | 3300031947 | Soil | SRIKSMDKVCDKLMEAALYIERNPKIVKSITSFPYIVGST |
| Ga0310909_109115263 | 3300031947 | Soil | LKSMDEVYAKLEDAALYIERNPALVKSITSFPYIARSIFPYIARSI |
| Ga0306926_103212281 | 3300031954 | Soil | SMSDVNTKLDEASLYIERSRTFVKSIASFPYIAKSY |
| Ga0306926_107494242 | 3300031954 | Soil | ALKSMDAVYDKLEEAAIYIERNRKIVKSIASFPYIVKSS |
| Ga0306926_129660871 | 3300031954 | Soil | KNYALKSMDKVCDKLEEAALYIERNPKMVKSITSFPYIVRSM |
| Ga0306922_102640961 | 3300032001 | Soil | SMNEVNAKLDEAALYIQRNPKMVKSITSFPYIAKSF |
| Ga0306922_104877561 | 3300032001 | Soil | KSMDEVHAKLDEAALYIEHNPKLVKSITSFPYIAKSL |
| Ga0306922_105460001 | 3300032001 | Soil | LKSMDAVRAKLKQAILYIERNPKIVRSITSFPYIVNSI |
| Ga0306922_112913911 | 3300032001 | Soil | SMNAVRAKLKQAILYIERNPKLVCSLTSFPYIVNSL |
| Ga0318532_103628842 | 3300032051 | Soil | KNYALKSMDAVQAKFRQAILYIERNRALVRSITSFPYMVNSL |
| Ga0318533_100969412 | 3300032059 | Soil | FKNYAAKSIDEVREMLVEGSLYIERNPELVKSMTSFPYIASSI |
| Ga0318533_113413101 | 3300032059 | Soil | MSEVNAKLDEASLYIERSRTLVKAIASFPYIAKSC |
| Ga0318510_102245271 | 3300032064 | Soil | YAAKSIDEVCEMLVEGSLYIERNPELVKSMTSFPYIASSI |
| Ga0306924_115030923 | 3300032076 | Soil | ALKSMDEVYGKLEEAALYIQRNPKIVKSITSVPYIAKSL |
| Ga0311301_106448361 | 3300032160 | Peatlands Soil | SIDAVYAKLNEAISYINRNPELVKSITSFPYIVRSF |
| Ga0311301_106567012 | 3300032160 | Peatlands Soil | SIDAVHQKLEEAILYIERNPKVVKSITSFPYIARSF |
| Ga0311301_108946592 | 3300032160 | Peatlands Soil | SIRAVRAKLKQAILYIERNPKLVQSITSFPYIVKSL |
| Ga0311301_109307441 | 3300032160 | Peatlands Soil | LKSIDAVRAKLEEAILYIERNPETVKSITSFPYIRKSS |
| Ga0311301_113303743 | 3300032160 | Peatlands Soil | SIDAVRAKLKQAILYIERNPKIVKSITSFPYIRKSF |
| Ga0311301_117842101 | 3300032160 | Peatlands Soil | MNDVYAKLEEAALYIERNPTLVKSITSFPYIVRSL |
| Ga0311301_118665911 | 3300032160 | Peatlands Soil | MDAVHAKLEQAILYVKSNPMTVKSITSFPYITRSF |
| Ga0311301_121634961 | 3300032160 | Peatlands Soil | NYAAKSMDEVCDKLVEAALYIERNPKMVKSMTSIPYIMNSL |
| Ga0306920_10000248824 | 3300032261 | Soil | KSMDAVQAKLRQAILYIERNRALVRSITSFPYIVNSL |
| Ga0306920_1005933291 | 3300032261 | Soil | SIDAVRRKLEQAILYIERNPETVKSITSFPYIVRSL |
| Ga0306920_1006188583 | 3300032261 | Soil | KNYALKSMDAVRDKLKQAILLYIERNRKLVRSITSFPYIVKSL |
| Ga0306920_1027991102 | 3300032261 | Soil | SMDEVHAKLDEAALYIERNPKLVKSITSFPYIAKSL |
| Ga0306920_1032595091 | 3300032261 | Soil | SMDKVCDKLEEAALYIERNPKMVKSITSFPYIVRSM |
| Ga0306920_1034854201 | 3300032261 | Soil | SMDAVRAKLKQAILYIERNPGLVRSVTSFPYIINSL |
| Ga0306920_1037153671 | 3300032261 | Soil | SMDAVYDKLEEAALYIERNRKIVKSIASFPYIVRSS |
| Ga0306920_1038219392 | 3300032261 | Soil | MDGVCHKLEEAALYIERNPKMVKSITSFPYVVGSM |
| Ga0335078_101395371 | 3300032805 | Soil | IDAVRAKLEQAILYIDRNPRIVKSITSFPYIRKSF |
| Ga0335081_103296801 | 3300032892 | Soil | SIDHVRQKLHEAILYVEHNPQLVKSITSFPYIAKSF |
| Ga0335077_114215671 | 3300033158 | Soil | YALKSIDAVRAKLEQAILYIDRNPRIVKSITSFPYIRKSF |
| Ga0335077_115217611 | 3300033158 | Soil | SMDEVYAKLEDAALYIERNPAVVKSITSFPYIVKSI |
| Ga0310914_110297681 | 3300033289 | Soil | SMDAVRAKLKQAILYIERNPGLVRSITSFPYIIKSL |
| Ga0310914_110684351 | 3300033289 | Soil | SMDAVRAKLKQAILYIERNPSLVRSIASFPYIVNSL |
| Ga0310914_118778001 | 3300033289 | Soil | FKNNAIKSMHKVCDKLEEAALYIERNPKMAKSITSFPYIVRSM |
| Ga0318519_101288344 | 3300033290 | Soil | SIDEVRAKLRQAILYIERNPKLVRSITSFPYIANSL |
| Ga0326726_109668581 | 3300033433 | Peat Soil | IDAVRAKLKQAILYIERNPETVKSITSFPYIVRSL |
| Ga0364937_009685_1308_1415 | 3300034113 | Sediment | MDEVNDKLDEAALYIERNPTLVKSITSFPYIAKSF |
| Ga0364927_0058060_912_1019 | 3300034148 | Sediment | MDEVNDKLDEAALYIERNPKLVKSITSFPYIAKSF |
| Ga0364927_0065878_24_131 | 3300034148 | Sediment | MDEVNDKLDEAALYIERNPKLVKSITSFPYIAKSS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |