NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F004795

Metagenome / Metatranscriptome Family F004795

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F004795
Family Type Metagenome / Metatranscriptome
Number of Sequences 423
Average Sequence Length 39 residues
Representative Sequence MAKPDETNELSWPWWAPWALLAVAATSLLTIGATLYDIL
Number of Associated Samples 194
Number of Associated Scaffolds 423

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 58.37 %
% of genes near scaffold ends (potentially truncated) 16.78 %
% of genes from short scaffolds (< 2000 bps) 73.05 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.726 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere
(17.021 % of family members)
Environment Ontology (ENVO) Unclassified
(50.591 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(64.775 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 34.33%    β-sheet: 0.00%    Coil/Unstructured: 65.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 423 Family Scaffolds
PF07715Plug 49.17
PF08479POTRA_2 20.09
PF03988DUF347 1.18
PF07238PilZ 0.95
PF05860TPS 0.95
PF09678Caa3_CtaG 0.71
PF13474SnoaL_3 0.71
PF00034Cytochrom_C 0.71
PF13485Peptidase_MA_2 0.71
PF06035Peptidase_C93 0.71
PF12770CHAT 0.47
PF00115COX1 0.47
PF00593TonB_dep_Rec 0.47
PF13367PrsW-protease 0.47
PF14026DUF4242 0.47
PF00497SBP_bac_3 0.24
PF05239PRC 0.24
PF00534Glycos_transf_1 0.24
PF13412HTH_24 0.24
PF04542Sigma70_r2 0.24
PF13570PQQ_3 0.24
PF05940NnrS 0.24
PF00664ABC_membrane 0.24
PF01202SKI 0.24
PF14905OMP_b-brl_3 0.24
PF10282Lactonase 0.24
PF08447PAS_3 0.24

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 423 Family Scaffolds
COG4705Uncharacterized membrane-anchored proteinFunction unknown [S] 1.18
COG3210Large exoprotein involved in heme utilization or adhesionIntracellular trafficking, secretion, and vesicular transport [U] 0.95
COG3672Predicted transglutaminase-like proteinPosttranslational modification, protein turnover, chaperones [O] 0.71
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.24
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.24
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.24
COG3213Nitric oxide response protein NnrSSignal transduction mechanisms [T] 0.24
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.24


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.73 %
UnclassifiedrootN/A8.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_188124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales2180Open in IMG/M
2199352024|deeps__Contig_71479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1700Open in IMG/M
3300001979|JGI24740J21852_10048144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.1240Open in IMG/M
3300001979|JGI24740J21852_10182538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis520Open in IMG/M
3300001989|JGI24739J22299_10188801Not Available606Open in IMG/M
3300001991|JGI24743J22301_10050130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis849Open in IMG/M
3300002067|JGI24735J21928_10191688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas592Open in IMG/M
3300002568|C688J35102_118460431Not Available562Open in IMG/M
3300002568|C688J35102_119443938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis696Open in IMG/M
3300002568|C688J35102_120647638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1291Open in IMG/M
3300003319|soilL2_10192229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1451Open in IMG/M
3300003320|rootH2_10209568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2530Open in IMG/M
3300003322|rootL2_10274474All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300003324|soilH2_10040440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00575823Open in IMG/M
3300003324|soilH2_10045056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3250Open in IMG/M
3300003324|soilH2_10058519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00575226Open in IMG/M
3300003324|soilH2_10058525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1174Open in IMG/M
3300003324|soilH2_10124655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1049Open in IMG/M
3300003324|soilH2_10216053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571283Open in IMG/M
3300003848|Ga0058694_1000811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas14085Open in IMG/M
3300004016|Ga0058689_10059459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.728Open in IMG/M
3300004114|Ga0062593_100251621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1460Open in IMG/M
3300004114|Ga0062593_102753346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas560Open in IMG/M
3300004479|Ga0062595_100006031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3554Open in IMG/M
3300004479|Ga0062595_100050995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1893Open in IMG/M
3300004479|Ga0062595_100239544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1165Open in IMG/M
3300004480|Ga0062592_100635322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas915Open in IMG/M
3300005093|Ga0062594_100198436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1395Open in IMG/M
3300005093|Ga0062594_100661200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas932Open in IMG/M
3300005093|Ga0062594_101215260All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057748Open in IMG/M
3300005093|Ga0062594_102042241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057614Open in IMG/M
3300005093|Ga0062594_103242432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057510Open in IMG/M
3300005171|Ga0066677_10205668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1103Open in IMG/M
3300005177|Ga0066690_10193605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1351Open in IMG/M
3300005178|Ga0066688_10010489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00574544Open in IMG/M
3300005184|Ga0066671_10362421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.922Open in IMG/M
3300005184|Ga0066671_10639700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057691Open in IMG/M
3300005184|Ga0066671_10938527Not Available547Open in IMG/M
3300005186|Ga0066676_10439592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas883Open in IMG/M
3300005186|Ga0066676_10538795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.792Open in IMG/M
3300005327|Ga0070658_10003375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas13155Open in IMG/M
3300005327|Ga0070658_10015809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas6034Open in IMG/M
3300005327|Ga0070658_10083334All Organisms → cellular organisms → Bacteria → Proteobacteria2628Open in IMG/M
3300005327|Ga0070658_10114367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2237Open in IMG/M
3300005327|Ga0070658_10143229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1997Open in IMG/M
3300005327|Ga0070658_10157937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1901Open in IMG/M
3300005327|Ga0070658_10293284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1386Open in IMG/M
3300005327|Ga0070658_10336022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1291Open in IMG/M
3300005327|Ga0070658_10376660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1217Open in IMG/M
3300005327|Ga0070658_10657592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria909Open in IMG/M
3300005327|Ga0070658_10908641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057765Open in IMG/M
3300005327|Ga0070658_11058090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas706Open in IMG/M
3300005327|Ga0070658_11574237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057569Open in IMG/M
3300005327|Ga0070658_11664542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas552Open in IMG/M
3300005328|Ga0070676_10061417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00572234Open in IMG/M
3300005328|Ga0070676_10228872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1231Open in IMG/M
3300005328|Ga0070676_10272998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1136Open in IMG/M
3300005329|Ga0070683_100217672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1815Open in IMG/M
3300005329|Ga0070683_100510524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1149Open in IMG/M
3300005329|Ga0070683_100689806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas978Open in IMG/M
3300005329|Ga0070683_101268124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli708Open in IMG/M
3300005330|Ga0070690_100054076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2570Open in IMG/M
3300005331|Ga0070670_100036695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas4217Open in IMG/M
3300005331|Ga0070670_100062360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3201Open in IMG/M
3300005334|Ga0068869_100203152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571563Open in IMG/M
3300005335|Ga0070666_10002660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD005710779Open in IMG/M
3300005335|Ga0070666_10062715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2519Open in IMG/M
3300005335|Ga0070666_10343895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1066Open in IMG/M
3300005336|Ga0070680_100000414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas29107Open in IMG/M
3300005336|Ga0070680_100001419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas17329Open in IMG/M
3300005336|Ga0070680_100028798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas4456Open in IMG/M
3300005336|Ga0070680_100143543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2002Open in IMG/M
3300005336|Ga0070680_100254897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1484Open in IMG/M
3300005336|Ga0070680_100380029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571202Open in IMG/M
3300005336|Ga0070680_100796860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas814Open in IMG/M
3300005338|Ga0068868_101041210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057750Open in IMG/M
3300005338|Ga0068868_101509749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057629Open in IMG/M
3300005339|Ga0070660_100041097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3523Open in IMG/M
3300005339|Ga0070660_100050663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00573195Open in IMG/M
3300005339|Ga0070660_100104890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00572243Open in IMG/M
3300005339|Ga0070660_100157536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1828Open in IMG/M
3300005339|Ga0070660_100213147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1568Open in IMG/M
3300005339|Ga0070660_101163256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas654Open in IMG/M
3300005341|Ga0070691_10029150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2582Open in IMG/M
3300005344|Ga0070661_100042976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3300Open in IMG/M
3300005344|Ga0070661_100044190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3255Open in IMG/M
3300005344|Ga0070661_100083914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae2353Open in IMG/M
3300005355|Ga0070671_100081810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00072700Open in IMG/M
3300005356|Ga0070674_100125564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1905Open in IMG/M
3300005356|Ga0070674_100257413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1373Open in IMG/M
3300005366|Ga0070659_100010221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00576903Open in IMG/M
3300005366|Ga0070659_100060035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3003Open in IMG/M
3300005366|Ga0070659_100258355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571445Open in IMG/M
3300005366|Ga0070659_100502983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571033Open in IMG/M
3300005366|Ga0070659_100925018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas763Open in IMG/M
3300005367|Ga0070667_100221541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1684Open in IMG/M
3300005367|Ga0070667_102254471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas513Open in IMG/M
3300005367|Ga0070667_102295850Not Available508Open in IMG/M
3300005434|Ga0070709_10002904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas9240Open in IMG/M
3300005435|Ga0070714_100121849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2320Open in IMG/M
3300005435|Ga0070714_100447542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1226Open in IMG/M
3300005435|Ga0070714_101185602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas745Open in IMG/M
3300005436|Ga0070713_100277296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1537Open in IMG/M
3300005436|Ga0070713_100676074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas985Open in IMG/M
3300005454|Ga0066687_10761624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis576Open in IMG/M
3300005455|Ga0070663_100032397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3602Open in IMG/M
3300005455|Ga0070663_100640296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli898Open in IMG/M
3300005455|Ga0070663_100773310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057821Open in IMG/M
3300005455|Ga0070663_101838916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057543Open in IMG/M
3300005456|Ga0070678_100030762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3694Open in IMG/M
3300005457|Ga0070662_100184822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1645Open in IMG/M
3300005458|Ga0070681_10683553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057942Open in IMG/M
3300005530|Ga0070679_100569937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1076Open in IMG/M
3300005530|Ga0070679_101182343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas710Open in IMG/M
3300005532|Ga0070739_10008391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas10617Open in IMG/M
3300005535|Ga0070684_100045916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3784Open in IMG/M
3300005535|Ga0070684_102113829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057531Open in IMG/M
3300005539|Ga0068853_100587856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1057Open in IMG/M
3300005539|Ga0068853_101209625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas729Open in IMG/M
3300005543|Ga0070672_101702023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas566Open in IMG/M
3300005544|Ga0070686_100142235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571671Open in IMG/M
3300005547|Ga0070693_100420431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas931Open in IMG/M
3300005547|Ga0070693_100950083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057647Open in IMG/M
3300005547|Ga0070693_100959529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis644Open in IMG/M
3300005548|Ga0070665_100364729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1451Open in IMG/M
3300005548|Ga0070665_100562713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1153Open in IMG/M
3300005548|Ga0070665_100905076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas895Open in IMG/M
3300005552|Ga0066701_10702174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales608Open in IMG/M
3300005560|Ga0066670_10012755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3665Open in IMG/M
3300005563|Ga0068855_100346059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1638Open in IMG/M
3300005563|Ga0068855_101793945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057623Open in IMG/M
3300005564|Ga0070664_100192018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1820Open in IMG/M
3300005564|Ga0070664_100206202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1756Open in IMG/M
3300005564|Ga0070664_100208461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571746Open in IMG/M
3300005566|Ga0066693_10287239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057656Open in IMG/M
3300005568|Ga0066703_10161277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.1350Open in IMG/M
3300005568|Ga0066703_10248527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1080Open in IMG/M
3300005568|Ga0066703_10417885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057805Open in IMG/M
3300005568|Ga0066703_10579534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas656Open in IMG/M
3300005575|Ga0066702_10214030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1170Open in IMG/M
3300005575|Ga0066702_10215624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1166Open in IMG/M
3300005578|Ga0068854_100895385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas780Open in IMG/M
3300005578|Ga0068854_101079669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057714Open in IMG/M
3300005578|Ga0068854_101216063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas675Open in IMG/M
3300005614|Ga0068856_100236609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1842Open in IMG/M
3300005614|Ga0068856_100311916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1590Open in IMG/M
3300005614|Ga0068856_100328001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571548Open in IMG/M
3300005616|Ga0068852_100023492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas4964Open in IMG/M
3300005616|Ga0068852_100942818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae881Open in IMG/M
3300005616|Ga0068852_102327442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas557Open in IMG/M
3300005616|Ga0068852_102817244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057504Open in IMG/M
3300005616|Ga0068852_102862079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300005617|Ga0068859_100025180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00575971Open in IMG/M
3300005617|Ga0068859_101565234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057728Open in IMG/M
3300005618|Ga0068864_100314035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571470Open in IMG/M
3300005618|Ga0068864_100773584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas942Open in IMG/M
3300005718|Ga0068866_10095541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571628Open in IMG/M
3300005834|Ga0068851_10019303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00573293Open in IMG/M
3300005834|Ga0068851_10844148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057571Open in IMG/M
3300005843|Ga0068860_101788598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas636Open in IMG/M
3300005985|Ga0081539_10030554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3341Open in IMG/M
3300006028|Ga0070717_11245700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae677Open in IMG/M
3300006034|Ga0066656_10541658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae757Open in IMG/M
3300006237|Ga0097621_100454069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1155Open in IMG/M
3300006237|Ga0097621_100874170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas836Open in IMG/M
3300006237|Ga0097621_101768776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae589Open in IMG/M
3300006358|Ga0068871_100544799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1050Open in IMG/M
3300006606|Ga0074062_12849134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas664Open in IMG/M
3300006755|Ga0079222_10087745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1592Open in IMG/M
3300006755|Ga0079222_11288216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas664Open in IMG/M
3300006755|Ga0079222_11986036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057571Open in IMG/M
3300006804|Ga0079221_10057070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1773Open in IMG/M
3300006806|Ga0079220_10119038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1404Open in IMG/M
3300006852|Ga0075433_11746922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057535Open in IMG/M
3300006954|Ga0079219_10101636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1414Open in IMG/M
3300006954|Ga0079219_10660369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas783Open in IMG/M
3300006954|Ga0079219_10985897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057696Open in IMG/M
3300006954|Ga0079219_11029922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas687Open in IMG/M
3300009098|Ga0105245_10199255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1922Open in IMG/M
3300009148|Ga0105243_10035637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli3859Open in IMG/M
3300009177|Ga0105248_10005172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD005714385Open in IMG/M
3300009177|Ga0105248_12997808Not Available538Open in IMG/M
3300009545|Ga0105237_10443627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1304Open in IMG/M
3300009551|Ga0105238_10818722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis947Open in IMG/M
3300009553|Ga0105249_10645084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1116Open in IMG/M
3300009840|Ga0126313_10055502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2808Open in IMG/M
3300010039|Ga0126309_10013452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis3431Open in IMG/M
3300010039|Ga0126309_10559272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis713Open in IMG/M
3300010042|Ga0126314_10338600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1078Open in IMG/M
3300010152|Ga0126318_10108547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas534Open in IMG/M
3300010364|Ga0134066_10348798All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300010364|Ga0134066_10425908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis512Open in IMG/M
3300010396|Ga0134126_12866285Not Available522Open in IMG/M
3300010401|Ga0134121_12201455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis588Open in IMG/M
3300012212|Ga0150985_104288919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis830Open in IMG/M
3300012212|Ga0150985_105055614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis531Open in IMG/M
3300012951|Ga0164300_10740254All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300012955|Ga0164298_10374323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis911Open in IMG/M
3300012958|Ga0164299_10552329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas777Open in IMG/M
3300012960|Ga0164301_10268428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1131Open in IMG/M
3300012960|Ga0164301_10861490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis699Open in IMG/M
3300012977|Ga0134087_10809088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis508Open in IMG/M
3300012986|Ga0164304_10010616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis4063Open in IMG/M
3300012986|Ga0164304_10470864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis910Open in IMG/M
3300012988|Ga0164306_10190973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1430Open in IMG/M
3300012989|Ga0164305_11359929Not Available623Open in IMG/M
3300013100|Ga0157373_10127453All Organisms → cellular organisms → Bacteria → Proteobacteria1790Open in IMG/M
3300013100|Ga0157373_10323140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1098Open in IMG/M
3300013100|Ga0157373_11170529Not Available579Open in IMG/M
3300013100|Ga0157373_11334574Not Available544Open in IMG/M
3300013102|Ga0157371_10201297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1427Open in IMG/M
3300013102|Ga0157371_11311969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis560Open in IMG/M
3300013104|Ga0157370_10506323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1109Open in IMG/M
3300013104|Ga0157370_11405137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis628Open in IMG/M
3300013105|Ga0157369_10017493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas8056Open in IMG/M
3300013105|Ga0157369_10067559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3842Open in IMG/M
3300013105|Ga0157369_10156615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00072406Open in IMG/M
3300013105|Ga0157369_10164230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2342Open in IMG/M
3300013105|Ga0157369_12099697Not Available573Open in IMG/M
3300013105|Ga0157369_12111690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis571Open in IMG/M
3300013296|Ga0157374_10985545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis862Open in IMG/M
3300013297|Ga0157378_10859557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.936Open in IMG/M
3300013297|Ga0157378_11670107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli684Open in IMG/M
3300013308|Ga0157375_10868374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1048Open in IMG/M
3300013308|Ga0157375_11711878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli745Open in IMG/M
3300013308|Ga0157375_12949450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis568Open in IMG/M
3300014166|Ga0134079_10057615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1385Open in IMG/M
3300014326|Ga0157380_11499525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli727Open in IMG/M
3300014497|Ga0182008_10160911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1130Open in IMG/M
3300015195|Ga0167658_1008997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3160Open in IMG/M
3300015371|Ga0132258_10257072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli4273Open in IMG/M
3300015371|Ga0132258_11480478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1715Open in IMG/M
3300015373|Ga0132257_101988836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli749Open in IMG/M
3300015374|Ga0132255_102358533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales812Open in IMG/M
3300017792|Ga0163161_11405026Not Available610Open in IMG/M
3300018433|Ga0066667_11407944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis612Open in IMG/M
3300018468|Ga0066662_10045599All Organisms → cellular organisms → Bacteria2751Open in IMG/M
3300018468|Ga0066662_10310515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1331Open in IMG/M
3300018468|Ga0066662_10325873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1306Open in IMG/M
3300018468|Ga0066662_10392039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1216Open in IMG/M
3300018468|Ga0066662_10960031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae844Open in IMG/M
3300018468|Ga0066662_10969777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis840Open in IMG/M
3300018468|Ga0066662_12355139Not Available560Open in IMG/M
3300018482|Ga0066669_11691749Not Available580Open in IMG/M
3300020069|Ga0197907_10381689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00572250Open in IMG/M
3300020070|Ga0206356_10782859All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071164Open in IMG/M
3300020078|Ga0206352_11047594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057639Open in IMG/M
3300020081|Ga0206354_10139356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1864Open in IMG/M
3300020081|Ga0206354_10390723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis566Open in IMG/M
3300020082|Ga0206353_10753494Not Available645Open in IMG/M
3300020082|Ga0206353_11281196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1813Open in IMG/M
3300020215|Ga0196963_10502693Not Available549Open in IMG/M
3300021339|Ga0193706_1010021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3295Open in IMG/M
3300021362|Ga0213882_10294751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis676Open in IMG/M
3300021445|Ga0182009_10012840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2966Open in IMG/M
3300021445|Ga0182009_10145079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1123Open in IMG/M
3300021445|Ga0182009_10179301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1021Open in IMG/M
3300021445|Ga0182009_10472481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas658Open in IMG/M
3300025271|Ga0207666_1057367All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025315|Ga0207697_10005369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas5959Open in IMG/M
3300025315|Ga0207697_10008269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4567Open in IMG/M
3300025315|Ga0207697_10058868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1596Open in IMG/M
3300025315|Ga0207697_10470552Not Available556Open in IMG/M
3300025321|Ga0207656_10032597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2165Open in IMG/M
3300025321|Ga0207656_10067003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.1588Open in IMG/M
3300025321|Ga0207656_10092706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1373Open in IMG/M
3300025321|Ga0207656_10287948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis811Open in IMG/M
3300025893|Ga0207682_10066282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1522Open in IMG/M
3300025899|Ga0207642_10025305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2399Open in IMG/M
3300025899|Ga0207642_10031064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli2233Open in IMG/M
3300025901|Ga0207688_10154458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1358Open in IMG/M
3300025903|Ga0207680_10002682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00578317Open in IMG/M
3300025903|Ga0207680_10013081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas4249Open in IMG/M
3300025903|Ga0207680_10041224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2692Open in IMG/M
3300025903|Ga0207680_10319626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1085Open in IMG/M
3300025904|Ga0207647_10010461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas6554Open in IMG/M
3300025904|Ga0207647_10022188All Organisms → cellular organisms → Bacteria4223Open in IMG/M
3300025904|Ga0207647_10209145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1127Open in IMG/M
3300025904|Ga0207647_10246933Not Available1024Open in IMG/M
3300025904|Ga0207647_10311307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas895Open in IMG/M
3300025904|Ga0207647_10428036Not Available743Open in IMG/M
3300025907|Ga0207645_10618635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis735Open in IMG/M
3300025909|Ga0207705_10001794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas16918Open in IMG/M
3300025909|Ga0207705_10014461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas5681Open in IMG/M
3300025909|Ga0207705_10033029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3698Open in IMG/M
3300025909|Ga0207705_10050323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2999Open in IMG/M
3300025909|Ga0207705_10072589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2496Open in IMG/M
3300025909|Ga0207705_10100806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00072124Open in IMG/M
3300025909|Ga0207705_10128547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1884Open in IMG/M
3300025909|Ga0207705_10558957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis889Open in IMG/M
3300025909|Ga0207705_10796746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis733Open in IMG/M
3300025909|Ga0207705_11140394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis600Open in IMG/M
3300025909|Ga0207705_11189069Not Available585Open in IMG/M
3300025909|Ga0207705_11350222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis543Open in IMG/M
3300025912|Ga0207707_10031881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas4614Open in IMG/M
3300025912|Ga0207707_10355981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1261Open in IMG/M
3300025913|Ga0207695_10345534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071375Open in IMG/M
3300025916|Ga0207663_11723219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis504Open in IMG/M
3300025917|Ga0207660_10000159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas42039Open in IMG/M
3300025917|Ga0207660_10000329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD000730623Open in IMG/M
3300025917|Ga0207660_11075572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis656Open in IMG/M
3300025918|Ga0207662_10752307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis685Open in IMG/M
3300025919|Ga0207657_10003595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas16527Open in IMG/M
3300025919|Ga0207657_10010394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00579290Open in IMG/M
3300025919|Ga0207657_10012447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas8402Open in IMG/M
3300025919|Ga0207657_10157379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1847Open in IMG/M
3300025919|Ga0207657_10316052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1235Open in IMG/M
3300025919|Ga0207657_10665726All Organisms → cellular organisms → Bacteria → Proteobacteria810Open in IMG/M
3300025920|Ga0207649_10043590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Allosphingosinicella → Allosphingosinicella indica2744Open in IMG/M
3300025920|Ga0207649_10055554All Organisms → cellular organisms → Bacteria2469Open in IMG/M
3300025920|Ga0207649_11486785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis536Open in IMG/M
3300025921|Ga0207652_10258990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1569Open in IMG/M
3300025921|Ga0207652_11287197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis634Open in IMG/M
3300025921|Ga0207652_11828960Not Available512Open in IMG/M
3300025924|Ga0207694_10419338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1115Open in IMG/M
3300025924|Ga0207694_11262884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis625Open in IMG/M
3300025925|Ga0207650_10081726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2451Open in IMG/M
3300025928|Ga0207700_11181321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis683Open in IMG/M
3300025929|Ga0207664_10642716All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis953Open in IMG/M
3300025929|Ga0207664_11213212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas673Open in IMG/M
3300025931|Ga0207644_11605688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis545Open in IMG/M
3300025932|Ga0207690_10038019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3129Open in IMG/M
3300025932|Ga0207690_10157568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1689Open in IMG/M
3300025932|Ga0207690_10694196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis836Open in IMG/M
3300025932|Ga0207690_10813150Not Available773Open in IMG/M
3300025932|Ga0207690_11073689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis671Open in IMG/M
3300025932|Ga0207690_11147905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis648Open in IMG/M
3300025932|Ga0207690_11203992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis632Open in IMG/M
3300025933|Ga0207706_10014599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales7113Open in IMG/M
3300025933|Ga0207706_10469743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1087Open in IMG/M
3300025933|Ga0207706_11386234All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300025933|Ga0207706_11591757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis530Open in IMG/M
3300025935|Ga0207709_11730858Not Available520Open in IMG/M
3300025936|Ga0207670_10092006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2146Open in IMG/M
3300025937|Ga0207669_10005310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas5767Open in IMG/M
3300025937|Ga0207669_10046265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Allosphingosinicella → Allosphingosinicella indica2570Open in IMG/M
3300025937|Ga0207669_10047527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2543Open in IMG/M
3300025937|Ga0207669_10129970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1728Open in IMG/M
3300025937|Ga0207669_11372262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis601Open in IMG/M
3300025938|Ga0207704_10120916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1792Open in IMG/M
3300025942|Ga0207689_10760949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis817Open in IMG/M
3300025945|Ga0207679_10035051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3547Open in IMG/M
3300025945|Ga0207679_10322994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1337Open in IMG/M
3300025949|Ga0207667_10095231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3074Open in IMG/M
3300025961|Ga0207712_10529570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571011Open in IMG/M
3300025981|Ga0207640_10159979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1665Open in IMG/M
3300025986|Ga0207658_10945926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis785Open in IMG/M
3300026041|Ga0207639_10361731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1299Open in IMG/M
3300026041|Ga0207639_10822725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales866Open in IMG/M
3300026067|Ga0207678_10229559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1589Open in IMG/M
3300026095|Ga0207676_10263345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1558Open in IMG/M
3300026116|Ga0207674_10026970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas6090Open in IMG/M
3300026142|Ga0207698_10322197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00571448Open in IMG/M
3300026142|Ga0207698_10464283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE2201225Open in IMG/M
3300026142|Ga0207698_12278166Not Available554Open in IMG/M
3300026142|Ga0207698_12716767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057504Open in IMG/M
3300026319|Ga0209647_1046600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2371Open in IMG/M
3300026324|Ga0209470_1104920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1266Open in IMG/M
3300026324|Ga0209470_1258748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli692Open in IMG/M
3300026331|Ga0209267_1026214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2848Open in IMG/M
3300026529|Ga0209806_1145668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis911Open in IMG/M
3300027725|Ga0209178_1414251Not Available514Open in IMG/M
3300027750|Ga0209461_10158419All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium555Open in IMG/M
3300027766|Ga0209796_10005601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis4173Open in IMG/M
3300027766|Ga0209796_10014381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2429Open in IMG/M
3300027766|Ga0209796_10014661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2401Open in IMG/M
3300027766|Ga0209796_10035607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1494Open in IMG/M
3300027766|Ga0209796_10045554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1318Open in IMG/M
3300027766|Ga0209796_10067302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1085Open in IMG/M
3300027766|Ga0209796_10082051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli984Open in IMG/M
3300027773|Ga0209810_1020465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli4337Open in IMG/M
3300028041|Ga0247719_1002682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas6488Open in IMG/M
3300028379|Ga0268266_10021287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00075524Open in IMG/M
3300028379|Ga0268266_10893652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas859Open in IMG/M
3300028379|Ga0268266_11038887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis793Open in IMG/M
3300030496|Ga0268240_10110510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis651Open in IMG/M
3300030511|Ga0268241_10030060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1103Open in IMG/M
3300031548|Ga0307408_100885605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas816Open in IMG/M
3300031716|Ga0310813_10998685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli763Open in IMG/M
3300031731|Ga0307405_10079180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2141Open in IMG/M
3300031731|Ga0307405_10083071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2098Open in IMG/M
3300031938|Ga0308175_100011052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas6794Open in IMG/M
3300031938|Ga0308175_100055077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3461Open in IMG/M
3300031938|Ga0308175_100080909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2928Open in IMG/M
3300031938|Ga0308175_100127526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00072400Open in IMG/M
3300031938|Ga0308175_100146816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00072256Open in IMG/M
3300031938|Ga0308175_100236990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1822Open in IMG/M
3300031938|Ga0308175_100338586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1549Open in IMG/M
3300031938|Ga0308175_100382173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1465Open in IMG/M
3300031938|Ga0308175_100405136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1426Open in IMG/M
3300031938|Ga0308175_100653091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD00071137Open in IMG/M
3300031938|Ga0308175_100822197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1018Open in IMG/M
3300031938|Ga0308175_101134086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis868Open in IMG/M
3300031938|Ga0308175_101183481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas849Open in IMG/M
3300031938|Ga0308175_101211011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis840Open in IMG/M
3300031938|Ga0308175_101497200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas754Open in IMG/M
3300031938|Ga0308175_102364343Not Available595Open in IMG/M
3300031938|Ga0308175_102506801Not Available578Open in IMG/M
3300031938|Ga0308175_102813284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis543Open in IMG/M
3300031939|Ga0308174_10195562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1539Open in IMG/M
3300031939|Ga0308174_10254470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis1366Open in IMG/M
3300031939|Ga0308174_10435236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1062Open in IMG/M
3300031939|Ga0308174_11065954Not Available687Open in IMG/M
3300031939|Ga0308174_11584392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis562Open in IMG/M
3300031939|Ga0308174_11780688Not Available529Open in IMG/M
3300031995|Ga0307409_100412531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1293Open in IMG/M
3300031996|Ga0308176_10664326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas1078Open in IMG/M
3300031996|Ga0308176_11633022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis687Open in IMG/M
3300031996|Ga0308176_12823037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis516Open in IMG/M
3300032002|Ga0307416_102189110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas654Open in IMG/M
3300032002|Ga0307416_103364982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis535Open in IMG/M
3300032003|Ga0310897_10067652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli1340Open in IMG/M
3300032074|Ga0308173_10110504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas2157Open in IMG/M
3300032074|Ga0308173_10467849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1123Open in IMG/M
3300032080|Ga0326721_10711549Not Available622Open in IMG/M
3300034135|Ga0334929_046803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis897Open in IMG/M
3300034268|Ga0372943_0044846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis2452Open in IMG/M
3300034268|Ga0372943_0787501Not Available630Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere17.02%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere9.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.09%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere5.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.20%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.20%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.60%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.89%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.89%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.65%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.18%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.47%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.47%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.47%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.47%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.47%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.24%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.24%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.24%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.24%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.24%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.24%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.24%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001979Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6Host-AssociatedOpen in IMG/M
3300001989Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5Host-AssociatedOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300003322Sugarcane root Sample L2Host-AssociatedOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003848Agave microbial communities from Guanajuato, Mexico - Or.Sf.rzHost-AssociatedOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300025271Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027766Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028041Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 4-1-E_DEnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300034135Biocrust microbial communities from Mojave Desert, California, United States - 25HNCEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_035565002199352024SoilMAERDDANELSWPWWAPWALLAVAVTSLLTIGATLYDIL
deeps_011438602199352024SoilMTLRQSAAMAKLDDTYKLSWPWWALLAVVATAALTIAATLYDIL
JGI24740J21852_1004814423300001979Corn RhizosphereMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYXIL*
JGI24740J21852_1018253823300001979Corn RhizospherePEETRELSWPWWSSWALLAVAVTSVLTIAATLYDIL*
JGI24739J22299_1018880123300001989Corn RhizosphereMAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATL*
JGI24743J22301_1005013023300001991Corn, Switchgrass And Miscanthus RhizosphereMQERDDTNRLSWPXWAPWALLAVAITSVLTIGATLYDIL*
JGI24735J21928_1019168813300002067Corn RhizosphereMTERNETEKLSWPWWAPWALLAVAATSVLTVAATLY
C688J35102_11846043123300002568SoilMANPDEANELSWPWWAPWALLAVAATSLLTIGATLYDIL*
C688J35102_11944393813300002568SoilAVAKMDKTHRLSWPGWAPWALLAVAATSVLTVAATLYDIL*
C688J35102_12064763823300002568SoilMAKSDDANRLSWPWWAPWTLIAVAATSLLTIAATLYDIL*
soilL2_1019222923300003319Sugarcane Root And Bulk SoilMPQPHDTNELSWPWWAPWALLAVAATSLLTIAATLYDIL*
rootH2_1020956823300003320Sugarcane Root And Bulk SoilMAKSADPQRLSWPWWAPWALLAVVITSLLTIAATLYDIL*
rootL2_1027447423300003322Sugarcane Root And Bulk SoilMASPQETKKLSWPWWAPWALLAIAATSLLTIAATLYDIL*
soilH2_1004044033300003324Sugarcane Root And Bulk SoilMADQDETTKLSWPWWAPWALLAVAATSVLTVAATFYDIL*
soilH2_1004505623300003324Sugarcane Root And Bulk SoilMAKRDETTRLSWPWWAPWALLAVALTSLLTIAATLYDIR*
soilH2_1005851993300003324Sugarcane Root And Bulk SoilMAKSGDTQKLSWPWWAPWALLAVAATSLLTIAATLYDIL*
soilH2_1005852523300003324Sugarcane Root And Bulk SoilMSQKEKTYELSWPWWAPWALLAVAITSLLTIAATLYDIR*
soilH2_1012465523300003324Sugarcane Root And Bulk SoilMAKKDATHKLSWPWWASWALLAVAATSVLTIAATFYDIL*
soilH2_1021605323300003324Sugarcane Root And Bulk SoilMSKANETTKLSWPWWAPWALLAVAAASLLTVAATLYDIL*
Ga0058694_100081153300003848AgaveMAKRDETNALSWPWWAPWALLAVAATSLLTVWVTLNDIL*
Ga0058689_1005945923300004016AgaveMAERDETHQLSWPWWAPWALLAVALTSVLTVAVTLRDIL*
Ga0062593_10025162123300004114SoilMAQREERTHRLSWPWWASWALLAIAATSLLTIAVTLNDIL*
Ga0062593_10275334623300004114SoilDMANSDEANRLSWPWWAPWALLAVIATSALTIAATLYDIL*
Ga0062595_10000603123300004479SoilMTDRNETHKLSWPWWAPWALLAVAVTSVLTIAATLYDIL*
Ga0062595_10005099523300004479SoilMAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDIL*
Ga0062595_10023954423300004479SoilMAQKDEVKKLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0062592_10063532223300004480SoilMAQREERTHRLSWPWWASWALLAVAATSLLTIAVTLNDIL*
Ga0062594_10019843623300005093SoilMAEFDERKRLSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0062594_10066120023300005093SoilMSQMTDETRKLSWPWWASWVLLTVAATCVLTVAATLYDIL*
Ga0062594_10121526023300005093SoilMAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDVL*
Ga0062594_10204224113300005093SoilMANSEEAKRLSWPWWAPWALLGVAATSLLTVAATLYDIL*
Ga0062594_10324243223300005093SoilMAERDDLDGLSWPWWSPWALLAVAVTSLLTIGAALHDIL*
Ga0066677_1020566823300005171SoilVANVQENKKLSWPWWAPWTLLAVAATSLLTIAATLYDIL*
Ga0066690_1019360523300005177SoilMAKLDETERLSWPWWAPWALLAVAATSLLTIGATLYDIL*
Ga0066688_1001048943300005178SoilMPKHDEAQKLSWPWWAPWALVAVAVTSVLTIAATLDDIL*
Ga0066671_1036242123300005184SoilMTNVRDKANTLAWPWWASWALLAVAATSVLTVAATLYDIL*
Ga0066671_1063970023300005184SoilMAKQTDEIQKLSWPWWASWALLAVAATSVLTVAATLYDIL*
Ga0066671_1093852713300005184SoilMARADETKKLSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0066676_1043959223300005186SoilMTKSDETHELSWPWWAPWALIAVAVTSLLTVGAALYDIL*
Ga0066676_1053879523300005186SoilMAKFDEANELSWPWWAPWALLAVAATSLLTIGATLYDIL*
Ga0070658_1000337563300005327Corn RhizosphereVQDLPMAKMDETDRLSWPGWAPWALLAVAVTSLLTIAATLYDIL*
Ga0070658_1001580923300005327Corn RhizosphereMMAKQDETNRLSWPWWAPWALLAVALSSLLTIAATLYDIR*
Ga0070658_1008333433300005327Corn RhizosphereMANPEETNELSWPSWAPWALFAVAATSLLTIGATLYDIL*
Ga0070658_1011436723300005327Corn RhizosphereMAKRDETDRLSWPWWAPWALLGVAATSLLTIAATLHDIL*
Ga0070658_1014322923300005327Corn RhizosphereMAKMDETHRLSWPWWASWALLAVAVTCALTVAATLYDIL*
Ga0070658_1015793723300005327Corn RhizosphereMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLNDIL*
Ga0070658_1029328423300005327Corn RhizosphereMQERDDTNRLSWPLWAPWALLAVAITSVLTIGATLYDIL*
Ga0070658_1033602223300005327Corn RhizosphereMAKLDETERLSWPWWAPWALLAVVLTSILTIGATLYDIL*
Ga0070658_1037666013300005327Corn RhizosphereMAHSDEAPKIPWPWWSTWALVAVVATSILTIAATLYDIL*
Ga0070658_1065759233300005327Corn RhizosphereLAWLRIVAAMAKWDETTRLAWPWWAPWALLAVAVTSLLTIAATLNDIL*
Ga0070658_1090864113300005327Corn RhizosphereMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0070658_1105809023300005327Corn RhizosphereMAKRDETTRLAWPWWAPWALLGVAVTSLLTIAATLNDIL*
Ga0070658_1157423723300005327Corn RhizosphereGKESAMAKSDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL*
Ga0070658_1166454223300005327Corn RhizosphereMTPNDEVHKLPWPWWATWVLLAVVLTSLLTIGATLFDFL*
Ga0070676_1006141723300005328Miscanthus RhizosphereMAERDDANELSWPWWAPWALIAVAATSLLTIGATLYDIL*
Ga0070676_1022887223300005328Miscanthus RhizosphereMAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0070676_1027299823300005328Miscanthus RhizosphereMSKPIETDALSWTSWAPWTLLVVDATPVLMVGATLYDIL*
Ga0070683_10021767223300005329Corn RhizosphereMAKRDETQRLSWPWWAPWALLAVAATSLLTIAVTLNDIL*
Ga0070683_10051052423300005329Corn RhizosphereMAKSDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL*
Ga0070683_10068980623300005329Corn RhizosphereMAKLDETHRLSWPRWAPWALLAVVLTSILTIGATLYDIL*
Ga0070683_10126812413300005329Corn RhizosphereMAQRDETRRLSWPWWAPWALLGVAATSLLTIAVTLNDIL*
Ga0070690_10005407623300005330Switchgrass RhizosphereMASSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0070670_10003669523300005331Switchgrass RhizosphereMAQQHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIR*
Ga0070670_10006236023300005331Switchgrass RhizosphereVSERFPMADQDKANQLSWPWWAPWALLAVALTSVLTIGATLYDIL*
Ga0068869_10020315223300005334Miscanthus RhizosphereMAQPHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0070666_1000266033300005335Switchgrass RhizosphereMARSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0070666_1006271523300005335Switchgrass RhizosphereMAQQHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0070666_1034389523300005335Switchgrass RhizosphereVAKSDETNRLSWPWWAPWAVLAVAATSVLTVAATLYDIL*
Ga0070680_10000041433300005336Corn RhizosphereMAKHDATHKLAWPWWSPWALLAVVVTSLLTIAATLNDIL*
Ga0070680_10000141943300005336Corn RhizosphereMAKQDETHKLAWPWWAPWALLAVVATSLLTIAATLNDIL*
Ga0070680_10002879823300005336Corn RhizosphereMAKQDATHKLAWPWWSPWALIAVVVTSLLTIAATLNDIL*
Ga0070680_10014354313300005336Corn RhizosphereMSQREKTNELSWPWWAPWALLAVAVTSLLTIAATLYDIR*
Ga0070680_10025489723300005336Corn RhizosphereMAKLDETERLSWPWWASWALLAVVLTSILTIGATLYDIL*
Ga0070680_10038002913300005336Corn RhizosphereCGKESAMAKSDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL*
Ga0070680_10079686023300005336Corn RhizosphereMAKQDATHKLAWPWWAPWALLAVVVTSLLTIAATLNDIL*
Ga0068868_10104121023300005338Miscanthus RhizosphereGQACRYMAQQHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0068868_10150974923300005338Miscanthus RhizosphereMTPNDEVHKLPWPWWATWVLLAVVLTSLLTIGATLFDIL*
Ga0070660_10004109733300005339Corn RhizosphereMAEQDETNKLSWPWWAPWALLAVALSSLLTIAATLYDVR*
Ga0070660_10005066343300005339Corn RhizosphereMAKPNEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0070660_10010489033300005339Corn RhizosphereMPERDDIRELSWPWWAPWALLAVAVTSVLTVAVTLRDIL*
Ga0070660_10015753623300005339Corn RhizosphereMAKLDETHRLSWPWWAPWALLAVVLTSILTIGATLYDIL*
Ga0070660_10021314723300005339Corn RhizosphereMSQREKTNELSWPWWAPWALLAVAITSLLTIAATLYDIR*
Ga0070660_10116325613300005339Corn RhizosphereMAKRDETTRLSWPWWAPWALLAVALASLLTIAATLYDIR*
Ga0070691_1002915023300005341Corn, Switchgrass And Miscanthus RhizosphereMAEQDETNKLSWPWWAPWALLAVALSSLLTIAATLYDIR*
Ga0070661_10004297633300005344Corn RhizosphereMAQQHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0070661_10004419013300005344Corn RhizosphereMPKPIETDALSWPWWAPWALLVVAATPVLMVGATLYDTL*
Ga0070661_10008391423300005344Corn RhizosphereMAERDDLDGLSWPWWSPWALLAVAATSLLTIGAALHDIL*
Ga0070692_1030836413300005345Corn, Switchgrass And Miscanthus RhizospherePSPGGWSAGLKPRGAMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0070671_10008181043300005355Switchgrass RhizosphereFAMAQKDEVKKLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0070674_10012556423300005356Miscanthus RhizosphereMAERDDANELSWPWWASWALLAVALTSVLTIGATLYDIL*
Ga0070674_10025741323300005356Miscanthus RhizosphereVRQANDMASKQDKKLSGPRWAPRALLAVAATSVLTVAATLYD
Ga0070659_10001022123300005366Corn RhizosphereMANSDEANRLSWPWWAPWALLAVIATSALTIAATLYDIL*
Ga0070659_10006003523300005366Corn RhizosphereMPERDDIRELSWPWWAPWALFAVAVTSVLTVAVTLRDIL*
Ga0070659_10025835513300005366Corn RhizosphereCSTRGLKMAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDIL*
Ga0070659_10050298323300005366Corn RhizosphereMAKQDATHKLAWPWWAPWTLLAVVVTSLLTIAATLNDIL*
Ga0070659_10092501823300005366Corn RhizosphereMAEQDKANRLSWPWWAPWALLAVALTSVLTIGATLYDIL*
Ga0070667_10022154123300005367Switchgrass RhizosphereMQERDDTNRLSWPWWAPWALLAVAITSVLTIGATLYDIL*
Ga0070667_10225447123300005367Switchgrass RhizosphereMTPNDEVHKLPWPWWATWVLLAIVLTSLLTIGATLYDIL*
Ga0070667_10229585013300005367Switchgrass RhizosphereMSKPIETDALSWPWWAPWALLVVAATPVLTVGATLYDTL*
Ga0070709_1000290443300005434Corn, Switchgrass And Miscanthus RhizosphereMAKPDEINELSWPRWAPWALLAVAATSALTIGATLYDIL*
Ga0070714_10012184923300005435Agricultural SoilMAERDKTHELSWPWWAPWALLGVALTSLLTVGATLYDII*
Ga0070714_10044754223300005435Agricultural SoilMAKHDEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0070714_10118560223300005435Agricultural SoilMAKQDSTHKLAWPWWSAWALGAVIVTSLLTIAATLNDIL*
Ga0070713_10027729623300005436Corn, Switchgrass And Miscanthus RhizosphereMAKMDETHRLSWPWWAPWALLAVALTSVLTIAATLYDIL*
Ga0070713_10067607423300005436Corn, Switchgrass And Miscanthus RhizosphereMAKPDEIKSLSWPWWGPWALLGVVVTLIATIAATLYDIL*
Ga0066687_1076162413300005454SoilACSAVAKSDETQELSWPWWAPWALLAVAATSLLTIAATLYDIL*
Ga0070663_10003239723300005455Corn RhizosphereMANPEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL*
Ga0070663_10064029613300005455Corn RhizosphereMSKPIETDALSWTSWAPWTLLVVDATPVRMVGATLYDIL*
Ga0070663_10077331023300005455Corn RhizosphereGAMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0070663_10183891613300005455Corn RhizosphereMAKLDETHRLSWPWWAPWALLAVAATCLLTVAATLNDIL*
Ga0070678_10003076223300005456Miscanthus RhizosphereMAKSDEIDALSWPWWVPRSVLAVAATSVLTVAAALYDIL*
Ga0070662_10018482223300005457Corn RhizosphereMAEQDETNKLSWPWWAPWALLAVALSSLLIIAATLYDIR*
Ga0070681_1068355323300005458Corn RhizosphereTAVAKMDETRRLSWPWWSSWALLAVAATSVLTIAATLYDIL*
Ga0070679_10056993723300005530Corn RhizosphereMAQRDETRRLSWPWWAPWALLAVAATCLLTIAVTLNDIL*
Ga0070679_10118234313300005530Corn RhizosphereVAKHEETQRLSWPWWAPWALLAVAATSLLTIAATLNDIL*
Ga0070739_1000839133300005532Surface SoilMAKMDETHRLSWPWWAPWALLGVAVTSALTIAATLYDIL*
Ga0070684_10004591623300005535Corn RhizosphereMANPEETRELSWPWWSSWALLAVAVTSVLTIAATLYDIL*
Ga0070684_10211382913300005535Corn RhizosphereMLLSAMAKSADPQRLSWPWWAPWALLGVAVTSLLTIAATLYDIL*
Ga0068853_10058785623300005539Corn RhizosphereMAKRDETQRLSWPWWAPWALLAVAATSLLTIATTLNDIL*
Ga0068853_10120962523300005539Corn RhizosphereMTDRNETHKLSWPWWAPWALLAVAATSVLTVAATLYDIL*
Ga0070672_10170202323300005543Miscanthus RhizosphereMEDSDLQKLSWPWWAPWALVAVIVGSALTIAATLYDIL*
Ga0070686_10014223513300005544Switchgrass RhizosphereNGMARSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0070693_10042043123300005547Corn, Switchgrass And Miscanthus RhizosphereMSQREKTNELSWPWWALWALLAVAITSLLTIAATLYDIR*
Ga0070693_10095008313300005547Corn, Switchgrass And Miscanthus RhizosphereMANQEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL*
Ga0070693_10095952923300005547Corn, Switchgrass And Miscanthus RhizosphereMEKRQETRRLSWPGWATWALLAVLATSAATIAATLYDIL*
Ga0070665_10036472923300005548Switchgrass RhizosphereMAKMTDETRKLSWPWWAPWTLLAVVATSVLTVAATLYDIL*
Ga0070665_10056271323300005548Switchgrass RhizosphereVTNDDDAHRMSWPWWAPWALLAVVLSCVATVAATLYDIW*
Ga0070665_10090507623300005548Switchgrass RhizosphereMAKSANQRLSWPWWAPWALLAVVATSLLTVAATLYDII*
Ga0066701_1070217413300005552SoilMTNVRDKANTLAWPWWASWALLAVAATSVLTVAATLYDIL
Ga0066670_1001275523300005560SoilMAKPDETNELSWPWWAPWALLAVAATSALTIGATLYDIL*
Ga0068855_10034605913300005563Corn RhizosphereVRALSRAMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLSDIL*
Ga0068855_10179394513300005563Corn RhizosphereMAKMDETHRLSWPWWSAWALLAVAVTSVLTIAATLYDIL*
Ga0070664_10019201823300005564Corn RhizosphereMSQREKTNELSWPWWALLAVAITSLLTIAATLYDIR*
Ga0070664_10020620223300005564Corn RhizosphereMADQDKANQLSWPWWAPWALLAVALTSVLTIGATLYDIL*
Ga0070664_10020846123300005564Corn RhizosphereNEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0066693_1028723923300005566SoilMTKLDESTKLSWPWWSSWALLAVAATSVLTVAATLYDIL*
Ga0066703_1016127723300005568SoilMTKLDETHELSWPWWAPWALLAVALTSLLTVGAALYDIL*
Ga0066703_1024852723300005568SoilMAERDDANELSWPWWAPWGLLAVAVTSLLTIGATLYDIL*
Ga0066703_1041788513300005568SoilMAKPDETNELSWPCWAPWALLAVAATSLLTIGATLYDIL*
Ga0066703_1057953423300005568SoilMAKFDEANELSWPWWATWALLAVAATSLLTIGATLYDIL*
Ga0066702_1021403023300005575SoilMESRDETRRLSWPWWANWALLAVIVTSLVTIAATLYDIL*
Ga0066702_1021562423300005575SoilMAKPDETNELSWPWWAPWALLAVAATSLLTIGATLYDIL*
Ga0068854_10089538523300005578Corn RhizosphereDEVHKLPWPWWATWVLLAIVLTSLLTIGATLYDIL*
Ga0068854_10107966923300005578Corn RhizosphereTMAERDDLDGLSWPWWSPWALLAVAVTSLLTIGAALHDIL*
Ga0068854_10121606313300005578Corn RhizosphereMTEPDATHELSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0068856_10023660923300005614Corn RhizosphereMAKQQDETHKLSWPWWAPWALLAVVVTSLLTVAATLRDIL*
Ga0068856_10031191623300005614Corn RhizosphereMAKLDETHRLSRPWWAPWALLAVAATCLLTVAATLNDIL*
Ga0068856_10032800133300005614Corn RhizosphereMAERDETRALSWPWWAPWALLGVAATSLLTVAATLKDIL*
Ga0068852_10002349233300005616Corn RhizosphereMAQPHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0068852_10094281813300005616Corn RhizosphereVRQASDMASKQETKKLSWPRWAPWALLAVAATSVLTVAAT
Ga0068852_10232744223300005616Corn RhizosphereMAKQDETTRLSWPWWASWALLAVAVTSLLTIAATLYDIR*
Ga0068852_10281724423300005616Corn RhizosphereATHELSWPWWAPWALLAVALTSLLTIAATLYDIL*
Ga0068852_10286207923300005616Corn RhizosphereMPVRDEIRELSWPWWAPWALLAVALTSLLTVAVTLRDIL*
Ga0068859_10002518013300005617Switchgrass RhizosphereMAKQDEVHKLSWPGWAPWALLAVAATSLLTIAATL
Ga0068859_10156523423300005617Switchgrass RhizosphereMTDETRKLSWPWWASWVLLTVAATCVLTVAATLYDIL*
Ga0068864_10031403513300005618Switchgrass RhizosphereGQACRYMAQQHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIR*
Ga0068864_10077358423300005618Switchgrass RhizosphereMPEMTDETRKLSWPWWAPWALLAVAATSVLTVAATLYDIL*
Ga0068866_1009554113300005718Miscanthus RhizosphereMASAQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL*
Ga0068851_1001930343300005834Corn RhizosphereMDETNRLSWPWWAPWALLAVASTSVLTIAATLYDIL*
Ga0068851_1084414813300005834Corn RhizosphereMAQQDETHKLSWPWWAPWALVIVVVTSLLTIAATLNDIL*
Ga0068860_10178859823300005843Switchgrass RhizosphereMATPQETKKLSWPWWAPWALLAVAATSVLTIAATLY
Ga0081539_1003055433300005985Tabebuia Heterophylla RhizosphereMAKQDETTKLSWPWWAPWALLAVAVTSVLTVGAALYDIL*
Ga0070717_1124570013300006028Corn, Switchgrass And Miscanthus RhizosphereMAKPDEIKSLSWPWWGPWALLGVVVTLIATIAATLYDI
Ga0066656_1054165813300006034SoilMAKPDETNDLSWPWWAPWALLAVAATSALTIGATLYDIL
Ga0097621_10045406923300006237Miscanthus RhizosphereMSRTDPKRLSWPWWASWALFGVALTSLLTIAATLNDIL*
Ga0097621_10087417023300006237Miscanthus RhizosphereMANPQETKKLSWPWWAPWALLAVAATSVLTIAATLYDIL*
Ga0097621_10176877623300006237Miscanthus RhizosphereMAKMDETHRLSWPWWAPWALLGVAVTSVLTIAATLY
Ga0068871_10054479923300006358Miscanthus RhizosphereSRTDPKRLSWPWWASWALFGVALTSLLTIAATLNDIL*
Ga0074062_1284913423300006606SoilMAEMDKTHELSWPWWAPWALLAVAATSILTIAATLYDNL*
Ga0079222_1008774523300006755Agricultural SoilMSKEAKTNELSWPWWAPWALLAVALTSLLTIAATLYDIR*
Ga0079222_1128821623300006755Agricultural SoilMTPRDEVEKLPWPWWATWALLAVVVTSLLTIAATLYDIL*
Ga0079222_1198603623300006755Agricultural SoilMPCGKAFGLMAEMDETHRLSWPWWGPWALLAVAVTSVLTIAATLYDIL*
Ga0079221_1005707023300006804Agricultural SoilMMAKQDETSRLSWPWWAPWALLAVALSSLLTIAATLYDIR*
Ga0079220_1011903823300006806Agricultural SoilMAKQDEVHKLSWPAWAPWALLGVAATSLLTIAATLYDIL*
Ga0075433_1174692223300006852Populus RhizosphereMAKQDEVHKLSWPAWAPWALLAVAATSLLTIAATLYDIL*
Ga0079219_1010163623300006954Agricultural SoilMTPRDEVQKLPWPWWATWALLAVVVTSLLTIAATLYDIL*
Ga0079219_1066036923300006954Agricultural SoilMTERNETQKLSWPWWAPWALLAVAVTSVLTVAATL
Ga0079219_1098589723300006954Agricultural SoilMAKANETTKLSWPWWAPWALLAVAATSVLTVAATLYDIL*
Ga0079219_1102992223300006954Agricultural SoilMTEQNETQKLSWPWWAPWALLAVAVTSVLTVAATLYDIL*
Ga0105245_1019925523300009098Miscanthus RhizosphereMAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATLYDIR*
Ga0105243_1003563723300009148Miscanthus RhizosphereMAQPHDTNELSWPWWAPWALLAVAVTSVLTLGATLYDIL*
Ga0105248_1000517273300009177Switchgrass RhizosphereMAKMDETNRLSWPWWAPWALLAVASTSVLTIAATLYDIL*
Ga0105248_1299780813300009177Switchgrass RhizosphereMAKANGTTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0105237_1044362723300009545Corn RhizosphereMAKPDEAKSLSWPWWAPWALPGVAATSLLTIAATLYDIL*
Ga0105238_1081872213300009551Corn RhizosphereMAKANETTKLSWPWWAPWMLLAVAATSLLTLAATLYDIL*
Ga0105249_1064508423300009553Switchgrass RhizosphereSACTGMATPQETKKLSWPWWAPWALLAIAATSVLTVAATLYDIL*
Ga0126313_1005550223300009840Serpentine SoilMPKFDDTNRLSWPWWSPWALLAVVATSLLTIVATLYDVL*
Ga0126309_1001345223300010039Serpentine SoilMAKITDETHRLSWPWWASWALLAVAATCVVTVAATLYDIL*
Ga0126309_1055927223300010039Serpentine SoilMPKPLAETKLSWAWWAPWALLAVVATALLTLAATLYDIL*
Ga0126314_1033860023300010042Serpentine SoilMPKIDDTNRLSWPWWSPWALLAVVATSLLTIVATLYDIL*
Ga0126318_1010854713300010152SoilREETQRLSWPWWAPWALLAVAVTSLLTVAATLNDIL*
Ga0134066_1034879823300010364Grasslands SoilMAKADDTHKLSWPWWAPWALLAVAATSVLTIAVTLYDIL*
Ga0134066_1042590823300010364Grasslands SoilMAERDDADELSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0134126_1286628523300010396Terrestrial SoilMAKQDKTHKLAWPWWAPWALLGVVATSLLTIAATLNDIL*
Ga0134121_1220145523300010401Terrestrial SoilMARSQDTDELSWPWWAPWALLAVAVTSVLTIGATLYDIL*
Ga0150985_10428891923300012212Avena Fatua RhizosphereRDETDKLSWPWWAPWALLAVAATSLLTLAVTLRDIL*
Ga0150985_10505561423300012212Avena Fatua RhizosphereRDKTNDLSWPWWASWALLAVAATSLLTIAATLYDIR*
Ga0164300_1074025423300012951SoilMTERNETEKLSWPWWAPWALLAVAATSVLTVAATLYDIL*
Ga0164298_1037432323300012955SoilMSKEAKTNELSWPWWAPWALLAVAVTSLLTIVTTLYDIR*
Ga0164299_1055232923300012958SoilMAKMDETTKLSWPWWGPWALVAVAATCLLTVAATLYDIL*
Ga0164301_1026842833300012960SoilMSKEAKTNELSWPWWAPWALLAVAVTSLLTIVTTLYDSR*
Ga0164301_1086149013300012960SoilMPKMDEANRLSWPWWAPWALLGVAVTCLLTIAAALYDIL*
Ga0134087_1080908813300012977Grasslands SoilVISTIMTKSDETHELSWPWWAPWALLAVALTSLLTVGAALYDIL*
Ga0164304_1001061623300012986SoilMAKMDETDRLSWPWWAPWALLAVAVTSLLTIAATLYDIL*
Ga0164304_1047086423300012986SoilMATPQETKKLSWPWWAPWALLAVAATSVLTIAATLYDIL*
Ga0164306_1019097323300012988SoilMTERNETEKLSWPWWGPWALLAVAATSVLTVAATLYDIL*
Ga0164305_1135992923300012989SoilMAERDDANELSWPWWAPWALLAVAVTSVLTTGATLYDIL*
Ga0157373_1012745323300013100Corn RhizosphereMTERNETEKLSWPWWAPWALLAVAATSVLTVAATLYDIV*
Ga0157373_1032314013300013100Corn RhizosphereMAKRDEANRLSWPWWAPWALLAVAATSLLTIAATLHDIL*
Ga0157373_1117052923300013100Corn RhizosphereMAHQGEKTHRLSWPWWAPWALLAVAATSLLTIAVTLNDIL
Ga0157373_1133457413300013100Corn RhizosphereMAQQHDTNELSWPWWAPWALLAVAVTSVLTLGATLYDIL*
Ga0157371_1020129723300013102Corn RhizosphereMPKLDETHRLSWPWWAPWALLAVAATSLLPVAATLNDIL*
Ga0157371_1131196923300013102Corn RhizosphereDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL*
Ga0157370_1050632313300013104Corn RhizosphereMAKLDETHRLSRPWWAPWALLAVVLTSILTIGATLYDIL*
Ga0157370_1140513713300013104Corn RhizosphereMAQRDETRRLSWPWWAPWALLAVAATSLLTIAVTLNDIL*
Ga0157369_1001749333300013105Corn RhizosphereMAKLDETHRLSWPWWAPWALLAVAITSLMTVAATLNDIL*
Ga0157369_1006755923300013105Corn RhizosphereMAQRDDAEELSWPGWASWALLAVALTSVLTIGATLYDVL*
Ga0157369_1015661533300013105Corn RhizosphereALSRAMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLNDIL*
Ga0157369_1016423023300013105Corn RhizosphereMAKMQETQKLSWPWWSAWALLAVAATSVLTIAATLYDIL*
Ga0157369_1209969723300013105Corn RhizosphereMAKPDEAKSLSWPWWAPWALLGVAATSLLTIAATLYDIL*
Ga0157369_1211169013300013105Corn RhizosphereMAERDDLDELSWPWWSPWALLAVAVTSLLTIGAALHDIL*
Ga0157374_1098554523300013296Miscanthus RhizosphereMTPNDEVHKLPWPWWATWVLLAVGLTSLLTIGATLFDIL*
Ga0157378_1085955723300013297Miscanthus RhizosphereMAKENETTKFAWPWWAPWMLLAVAATSLLTVAATLYDIL*
Ga0157378_1167010723300013297Miscanthus RhizosphereMATPQETKKLSWPWWASWALLAVAATSVLTIAATLYDIL*
Ga0157375_1086837423300013308Miscanthus RhizosphereMSRTDPKRLSWPWWAAWALFGVALTSLLTIAATLNDIL*
Ga0157375_1171187823300013308Miscanthus RhizosphereMATPQETKKLSWPWWAPWALLAVAATSFLTIAATLYDIL*
Ga0157375_1294945013300013308Miscanthus RhizosphereHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIR*
Ga0134079_1005761523300014166Grasslands SoilMTKMDESTKLSWPWWSSWALLAVAATSVLTVAATLYDIL*
Ga0157380_1149952523300014326Switchgrass RhizosphereMAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATL
Ga0182008_1016091123300014497RhizosphereMARSDETNDLSWPWWAPWALLAVAATSLLTVGVTLYDIL*
Ga0167658_100899733300015195Glacier Forefield SoilMARPNDTAGLSWPWWALVAVALTSLLTIGATVYDIL*
Ga0132258_1025707233300015371Arabidopsis RhizosphereMEDSKLQKLSWPWWAPWTLVAVIVGSALTIAATLYDIL*
Ga0132258_1148047823300015371Arabidopsis RhizosphereMAEGDDAKELSWPGWASWALLAVALTSVLTIGATLYDIL*
Ga0132257_10198883623300015373Arabidopsis RhizosphereMEDSKLQKLSWPWWAPWALVAVIVGSALTIAATLYDIL*
Ga0132255_10235853323300015374Arabidopsis RhizosphereMEDSDLQRLSWPWWAPWALVAVIVGSALTIAATLYDIL*
Ga0163161_1140502613300017792Switchgrass RhizosphereMAEFDERKRLSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0066667_1140794413300018433Grasslands SoilSDEAHELSWPWWAPWALLAVALTSLLTVAATLYDIL
Ga0066662_1004559913300018468Grasslands SoilMAKLDETERLSWPWWAPWALLAVAATSLLTIGATLYDIL
Ga0066662_1031051513300018468Grasslands SoilMAKFDDTHKLSWPWWAPWALLAVAATCLLTVAAALYDIL
Ga0066662_1032587323300018468Grasslands SoilMAKPDETNELSWPWWAPWALLAVAATSLLTIGATLYDIL
Ga0066662_1039203923300018468Grasslands SoilMESRDETRRLSWPWWANWALLAVIVTSLVTIAATLYDIL
Ga0066662_1096003123300018468Grasslands SoilMAKPDEAQVLSWPWWAPWALLAVALTSLLTIGATLYDIL
Ga0066662_1096977723300018468Grasslands SoilMTKLDETHELSWPWWAPWALLAVALTSLLTVGAALYDIL
Ga0066662_1235513913300018468Grasslands SoilMEKRDETNRLSWPWWAPWALLAVVVTSAATIAATLYDIL
Ga0066669_1169174923300018482Grasslands SoilMTKMDESTKLSWPWWSSWALLAVAATSVLTVAATLYDIL
Ga0197907_1038168913300020069Corn, Switchgrass And Miscanthus RhizosphereMAKQDATHKLAWPWWSPWALIAVVVTSLLTIAATLNDIL
Ga0206356_1078285913300020070Corn, Switchgrass And Miscanthus RhizosphereQDETNKLSWPWWAPWALLAVALSSLLTIAATLYDIR
Ga0206352_1104759423300020078Corn, Switchgrass And Miscanthus RhizosphereLAHSRIVEAMAKQDATHKLAWPWWSPWALIAVVVTSLLTIAATLNDIL
Ga0206354_1013935623300020081Corn, Switchgrass And Miscanthus RhizosphereMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLNDIL
Ga0206354_1039072313300020081Corn, Switchgrass And Miscanthus RhizosphereEPDATHELSWPWWAPWAVLAVALTSLLTIAATLYDIL
Ga0206353_1075349423300020082Corn, Switchgrass And Miscanthus RhizosphereMSQREKTNELSWPWWAPWALLAVAITSLLTIAATLYDIR
Ga0206353_1128119623300020082Corn, Switchgrass And Miscanthus RhizosphereMANPEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL
Ga0196963_1050269323300020215SoilVSDQDETQKLSWPWWSPWVLLAVVATSMLTIGATLYDIL
Ga0193706_101002133300021339SoilMHMTKSDETHRLSWPWWASWALLAVAVTCVVTVAATFYDIL
Ga0213882_1029475113300021362Exposed RockMAKLDETHALSWPWWAPWALLAVALTSLLTIAATLYDIL
Ga0182009_1001284023300021445SoilMAQKDEVKKLSWPWWAPWALLAVALTSLLTIAATLYDIL
Ga0182009_1014507923300021445SoilMDETRKLSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0182009_1017930133300021445SoilMAKANETTKLSWPWWAPWALLAVAATSLLTVAATLYDIL
Ga0182009_1047248113300021445SoilAKMDETHRLSWPWWAPWTLLAVAATSVLTIAATLYDIL
Ga0207666_105736713300025271Corn, Switchgrass And Miscanthus RhizosphereMQERDDTNRLSWPLWAPWALLAVAITSVLTIGATLYDIL
Ga0207697_1000536933300025315Corn, Switchgrass And Miscanthus RhizosphereMAQQHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207697_1000826933300025315Corn, Switchgrass And Miscanthus RhizosphereMQERDDTNRLSWPWWAPWALLAVAITSVLTIGATLYDIL
Ga0207697_1005886823300025315Corn, Switchgrass And Miscanthus RhizosphereMAHSDEAPKIPWPWWSTWALVAVVATSILTIAATLYDIL
Ga0207697_1047055213300025315Corn, Switchgrass And Miscanthus RhizosphereMAERDDAEELSWPGWASWALLAVALTSVLTIGAILYDIL
Ga0207656_1003259723300025321Corn RhizosphereMAEQDETNKLSWPWWAPWALLAVALSSLLTIAATLYDIR
Ga0207656_1006700323300025321Corn RhizosphereMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL
Ga0207656_1009270623300025321Corn RhizosphereMTPNDEVHKLPWPWWATWVLLAVVLTSLLTIGATLFDIL
Ga0207656_1028794813300025321Corn RhizosphereMAKSDEARRLSWPWWAPWALLAVILTSILTVGATLYDIL
Ga0207682_1006628213300025893Miscanthus RhizosphereMAQPHDTNELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207642_1002530523300025899Miscanthus RhizosphereMAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207642_1003106413300025899Miscanthus RhizosphereMAERDDAEELSWPGWASWALFAVALTSVLTIGATLYDIL
Ga0207688_1015445823300025901Corn, Switchgrass And Miscanthus RhizosphereMAQPHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207688_1108246023300025901Corn, Switchgrass And Miscanthus RhizosphereDGTAAVRQASDMASKQETKKLSWPRWAPWALLAVAATSVLTVAATLYDIL
Ga0207680_1000268213300025903Switchgrass RhizosphereASNGMASSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207680_1001308123300025903Switchgrass RhizosphereMAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDIL
Ga0207680_1004122423300025903Switchgrass RhizosphereMANPQETKKLSWPWWAPWALLAVAATSVLTIAATLYDIL
Ga0207680_1031962623300025903Switchgrass RhizosphereMAQQHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207647_1001046133300025904Corn RhizosphereMARLQDSDELSWPRWALLAVAATSVLTIGATLYDIL
Ga0207647_1002218823300025904Corn RhizosphereMAQQHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIR
Ga0207647_1020914523300025904Corn RhizosphereMAQREERTHRLSWPWWASWALLAVAATSLLTIAVTLNDIL
Ga0207647_1024693323300025904Corn RhizosphereMPERDDIRELSWPWWAPWALFAVAVTSVLTVAVTLRDIL
Ga0207647_1031130723300025904Corn RhizosphereMAKRDETDRLSWPWWAPWALLGVAATSLLTIAATLHDIL
Ga0207647_1042803623300025904Corn RhizosphereMAERDDLDGLSWPWWSPWALLAVAVTSLLTIGAALHDIL
Ga0207645_1061863513300025907Miscanthus RhizosphereLKPRGAMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL
Ga0207705_1000179463300025909Corn RhizosphereMSQREKTNELSWPWWALWALLAVAITSLLTIAATLYDIR
Ga0207705_1001446123300025909Corn RhizosphereMAKMDETDRLSWPGWAPWALLAVAVTSLLTIAATLYDIL
Ga0207705_1003302943300025909Corn RhizosphereMAKQDETTRLSWPWWAPWALLAVAVTSLLTIAATLYDIR
Ga0207705_1005032323300025909Corn RhizosphereMAKLDETHRLSWPRWAPWALLAVVLTSILTIGATLYDIL
Ga0207705_1007258923300025909Corn RhizosphereMAKLDETERLSWPWWAPWALLAVVLTSILTIGATLYDIL
Ga0207705_1010080623300025909Corn RhizosphereMMAKQDETNRLSWPWWAPWALLAVALSSLLTIAATLYDIR
Ga0207705_1012854723300025909Corn RhizosphereMANPEETRELSWPWWSSWALLAVAVTSVLTIAATLYDIL
Ga0207705_1024458013300025909Corn RhizosphereSTGRKPRGAMAKANETTKLSWPWWAPWMLLAVAATSLLTVAATLYDIL
Ga0207705_1055895723300025909Corn RhizosphereMAKMDETHRLSWPWWASWALLAVAVTCALTVAATLYDIL
Ga0207705_1079674623300025909Corn RhizosphereMAKRDETTRLAWPWWAPWALLGVAVTSLLTIAATLNDIL
Ga0207705_1114039423300025909Corn RhizosphereALVSERFPMADQDKANQLSWPWWAPWALLAVALTSVLTIGATLYDIL
Ga0207705_1118906923300025909Corn RhizosphereMAKPNEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL
Ga0207705_1135022213300025909Corn RhizosphereRALSRAMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLNDIL
Ga0207707_1003188133300025912Corn RhizosphereMAQREERTHRLSWPWWASWALLAIAATSLLTIAVTLNDIL
Ga0207707_1035598123300025912Corn RhizosphereFTAVAKMDETRRLSWPWWSSWALLAVAATSVLTIAATLYDIL
Ga0207695_1034553423300025913Corn RhizosphereMAEQDETNKLSWPWWASWALLAVALSSLLTIAATLYDIR
Ga0207663_1172321923300025916Corn, Switchgrass And Miscanthus RhizosphereKDFRGMAKMDETHRLSWPWWAPWALLAVALTSVLTIAATLYDIL
Ga0207660_10000159233300025917Corn RhizosphereMAKQDETHKLAWPWWAPWALLAVVATSLLTIAATLNDIL
Ga0207660_1000032973300025917Corn RhizosphereMAKHDATHKLAWPWWSPWALLAVVVTSLLTIAATLNDIL
Ga0207660_1107557213300025917Corn RhizosphereKDFIAMANPEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL
Ga0207662_1075230713300025918Switchgrass RhizosphereMASSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207657_1000359563300025919Corn RhizosphereMAERDDLDGLSWPWWSPWALLAVAATSLLTIGAALHDIL
Ga0207657_1001039463300025919Corn RhizosphereMADQDKANQLSWPWWAPWALLAVALTSVLTIGATLYDIL
Ga0207657_1001244723300025919Corn RhizosphereMPERDDIRELSWPWWAPWALLAVAVTSVLTVAVTLRDIL
Ga0207657_1015737923300025919Corn RhizosphereMANQEEIHELSWPWWSSWALLAVAVTSVLTIAATLYDIL
Ga0207657_1031605213300025919Corn RhizosphereMAKRDETTRLSWPWWAPWALLAVALASLLTIAATLYDIR
Ga0207657_1066572623300025919Corn RhizosphereMAKQDATHKLAWPWWAPWALLAVVVTSLLTIAATLNDIL
Ga0207649_1004359033300025920Corn RhizosphereMAKTTDETSKVSWPWWASWALLAVAATSVLTVAATLYDIL
Ga0207649_1005555433300025920Corn RhizosphereMTDRNETHKLSWPWWAPWALLAVAATSVLTVAATLYDIL
Ga0207649_1148678523300025920Corn RhizosphereMDKRDETHRLSWPWWAPWALLAVAATSLLTIAVTLNDIL
Ga0207652_1025899023300025921Corn RhizosphereMDETRRLSWPWWSSWALLAVAATSVLTIAATLYDIP
Ga0207652_1128719723300025921Corn RhizosphereEQSKATKLSWPWWSPWALLAVVATSVLTIAATLYDIL
Ga0207652_1182896013300025921Corn RhizosphereMARRDAPHRLSWPWWAPWTLLAVAATSLLTIAVTLNDIL
Ga0207694_1041933823300025924Corn RhizosphereMAKRDETQRLSWPWWAPWALLAVAATSLLTIAVTLNDIL
Ga0207694_1126288413300025924Corn RhizosphereMSQREKTNELSWPWWAPWALLAVAVTSLLTIAATLYDIR
Ga0207694_1126938113300025924Corn RhizosphereSGGGAFPSPKGWSAGLKPRGAMAKANETTKLSWPWWAPWMLLAVAATSLLTLAATLYDIL
Ga0207650_1008172633300025925Switchgrass RhizosphereMEDSDLQKLSWPWWAPWALVAVIVGSALTIAATLYDIL
Ga0207700_1118132123300025928Corn, Switchgrass And Miscanthus RhizosphereMAERDKTHELSWPWWAPWALLGVALTSLLTVGATLYDII
Ga0207664_1064271613300025929Agricultural SoilMAKHDEAKSLSWPWWAPWALLAVALTSLLTIAATLYDIL
Ga0207664_1121321223300025929Agricultural SoilIVGTMAKQDETHKLAWPWWAPWALLAVVATSLLTIAATLNDIL
Ga0207644_1160568823300025931Switchgrass RhizosphereRRYGRAFTGMANPQETKKLSWPWWAPWALLAVAATSVLTIAATLYDIL
Ga0207690_1003801923300025932Corn RhizosphereMANSDEANRLSWPWWAPWALLAVIATSALTIAATLYDIL
Ga0207690_1015756823300025932Corn RhizosphereMAQPHDTSQLSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207690_1069419613300025932Corn RhizosphereMAKRDETTRLSWPWWAPWALLAVALTSLLTIAATLYDIR
Ga0207690_1081315023300025932Corn RhizosphereMAEQDKANRLSWPWWAPWALLAVALTSVLTIGATLYDIL
Ga0207690_1107368913300025932Corn RhizosphereCSTRGLKMAERDDAEELSWPGWASWALLAVALTSVLTIGATLYDVL
Ga0207690_1114790523300025932Corn RhizosphereMTDETRKLSWPWWASWVLLAVAATSVLTVAATLYDIL
Ga0207690_1120399213300025932Corn RhizosphereMAKLDETHRLSWPWWAPWALLAVAVTCVATVAATLYDIL
Ga0207706_1001459923300025933Corn RhizosphereMSKPIETDALSWTSWAPWTLLVVDATPVRMVGATLYDIL
Ga0207706_1046974323300025933Corn RhizosphereVAKLDETNQLSWPWWAPWVLLAVAATSVLTIAATLYDIL
Ga0207706_1138623423300025933Corn RhizosphereMSSQDETKKLSWPGWAPWALLAVAATSLLTVAATLYDIL
Ga0207706_1159175723300025933Corn RhizosphereAEQDETNKLSWPWWAPWALLAVALSSLLIIAATLYDIR
Ga0207709_1173085823300025935Miscanthus RhizosphereRYMAQPHDTNELSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207670_1009200623300025936Switchgrass RhizosphereMAKQDEVHKLSWPGWAPWALLAVAATSLLTIAATLYDIL
Ga0207669_1000531043300025937Miscanthus RhizosphereMARSQDTDELSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207669_1004626533300025937Miscanthus RhizosphereMASKQDKKLSGPRWAPRALLAVAATSVLTVAATLYD
Ga0207669_1004752723300025937Miscanthus RhizosphereMAKSDEIDALSWPWWVPRSVLAVAATSVLTVAAALYDIL
Ga0207669_1012997013300025937Miscanthus RhizosphereRYMAQPHDTNQLSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0207669_1137226223300025937Miscanthus RhizosphereMAERDDANELSWPWWASWALLAVALTSVLTIGATLYDIL
Ga0207704_1012091623300025938Miscanthus RhizosphereMAQPHDTNELSWPWWAPWALLAVAVTSVLTLGATLYDIL
Ga0207689_1076094923300025942Miscanthus RhizosphereMAERDDANELSWPWWAPWALIAVAATSLLTIGATLYDIL
Ga0207679_1003505133300025945Corn RhizosphereMAKIGETHRLSWPWWAPWALLAVAITSVLTIAATLYDIL
Ga0207679_1032299423300025945Corn RhizosphereMSQREKTNELSWPWWALLAVAITSLLTIAATLYDIR
Ga0207667_1009523123300025949Corn RhizosphereMPKLDETHRLSWPWWAPWALLAVAATSLLTVAATLSDIL
Ga0207712_1052957013300025961Switchgrass RhizosphereMAKSANQRLSWPWWAPWALLAVVATSLLTVAATLYDII
Ga0207640_1015997923300025981Corn RhizosphereMTPNDEVHKLPWPWWATWVLLAVVLTSLLTIGATLFDFL
Ga0207658_1094592623300025986Switchgrass RhizosphereMATPQETKKLSWPWWASWALLAVAATSVLTIAATLYDIL
Ga0207639_1036173123300026041Corn RhizosphereMSLRDETSRLSWPWWAPLAPIAVAATSLLTIAVTLDDIL
Ga0207639_1082272523300026041Corn RhizosphereMAEFDVRKRLSWPWWAPWALLAVAATSVLTIGATLYDIL
Ga0207678_1022955923300026067Corn RhizosphereMAKLDETHRLSWPWWAPWALLAVAATCLLTVAATLNDIL
Ga0207676_1026334523300026095Switchgrass RhizosphereMTDETRKLSWPWWAPWALMAVAATSVLTVAATLYDIL
Ga0207674_1002697023300026116Corn RhizosphereMAKQDATHRLSWPSWAWSALLAVVATSLLTIAVTLNDIL
Ga0207698_1032219723300026142Corn RhizosphereMAKQDATHKLAWPWWAPWTLLAVVVTSLLTIAATLNDIL
Ga0207698_1046428313300026142Corn RhizosphereMAKQDEVRKLSWPGWAPWALLGVAATSLLTIAATLYDIL
Ga0207698_1071973123300026142Corn RhizosphereMARSDEDPKLPWPWWSTWALAAVVATSILTIAATLYDIF
Ga0207698_1227816623300026142Corn RhizosphereMASKQETKKLSWPRWAPWALLAVAATSVLTVAATLYDIL
Ga0207698_1271676723300026142Corn RhizosphereMAKQDATHKLAWPWWAPWALLAVVATSLLTIAATLNDIL
Ga0209647_104660023300026319Grasslands SoilMAKPDEANELSWPWWAPWALLAVAATSLLTIGATLYDIL
Ga0209470_110492013300026324SoilMSRSQQTSKLSWPWWSPWALIAVVVTTLLTIAVTLYDIL
Ga0209470_125874813300026324SoilMAKFDEANELSWPWWAPWALLAVAATSLLTIGATLY
Ga0209267_102621433300026331SoilMPKHDEAQKLSWPWWAPWALVAVAVTSVLTIAATLDDIL
Ga0209806_114566813300026529SoilMAERDDANELSWPWWAPWGLLAVAVTSLLTIGATLYDIL
Ga0209178_141425113300027725Agricultural SoilMMAKQDETSRLSWPWWAPWALLAVALSSLLTIAATLYDIR
Ga0209461_1015841923300027750AgaveMAERDETHKLSWPWWAPWALLAVALTSVLTVAVTLRDIL
Ga0209796_1000560123300027766AgaveMAKRDETNALSWPWWAPWALLAVAATSLLTVWVTLNDIL
Ga0209796_1001438133300027766AgaveMAKRDELQKLSWPWWSPWALIAVVLTSALTIAATLNDIL
Ga0209796_1001466123300027766AgaveLDLATAFAHSSEMAKRDETKELSWPVWAPWVLLAVAATSLLTVWVTLNDIL
Ga0209796_1003560723300027766AgaveMAKWDETNKLAWPWWAPWALLIVAATSLLTVAATLNDIL
Ga0209796_1004555413300027766AgaveMSQREETQRLSWPWWSMWALLAVAVTSVLTIAVTLNDIL
Ga0209796_1006730213300027766AgaveMAKMDETHRLSWPWWAPWALLGVAITSALTIAVTLYDIL
Ga0209796_1008205113300027766AgaveMAKTDETHRLSWPWWAPWALLAVAATSLLTIAATLNDIL
Ga0209810_102046523300027773Surface SoilMAKMDETHRLSWPWWAPWALLGVAVTSALTIAATLYDIL
Ga0247719_100268223300028041SoilMAEQDKAHKLSWPWWAPWALIVVAATSGLTVAVAIYDIL
Ga0268266_1002128723300028379Switchgrass RhizosphereMTPNDEVHKLPWPWWATWVLLAIVLTSLLTIGATLYDIL
Ga0268266_1089365233300028379Switchgrass RhizosphereMAKSANQRLSWPWWAPWALLAVVATSLLTVAATLYDIL
Ga0268266_1103888723300028379Switchgrass RhizosphereFSRMAKMTDETRKLSWPWWAPWTLLAVVATSVLTVAATLYDIL
Ga0268240_1011051013300030496SoilMTKSDETTELSWPWWAPWALLAVALTSLLTVGATLYDIL
Ga0268241_1003006023300030511SoilVADKEEVHKLSWPWWAPWALLAVAATCVLTIAATLYDIL
Ga0307408_10088560523300031548RhizosphereMSKQDETQELSWPWWAPWALLAVAITSLLTVAAALYDIL
Ga0310813_1099868513300031716SoilMAQRDETRRLSWPWWAPWALLGIAATSLLTIAVTLNDIL
Ga0307405_1007918023300031731RhizosphereVAKLDETNRLSWPWWAPWALLAVAATSVLTIAATLYDIL
Ga0307405_1008307123300031731RhizosphereMATWDETNKLSWPWWAPWALLAVALTPLMTVGATLYDIL
Ga0308175_10001105223300031938SoilMAEQDRTRRLSWPWWSPWALVAVVVTCLLTIAATLYDIL
Ga0308175_10005507723300031938SoilMTKSGDAQKLSWPWWAPWALLAVAATSLLTIAATLYDIL
Ga0308175_10008090923300031938SoilMTKSDETTELSWPWWAAWALLAVALTSLLTVGATLYDIL
Ga0308175_10012752633300031938SoilMAKQDETHKLSWPGWAWWALAAVIVTSLLTIAATLRDIL
Ga0308175_10014681633300031938SoilRFAKPFAGMLKSADPQRLSWPWWAPWALLGVAVTSVLTIAATLYDIL
Ga0308175_10023699023300031938SoilMAKFDEPDRLSWPWWAPWALLAVAVTSILTIGATLYDIL
Ga0308175_10033858623300031938SoilMAKMDEAHRLSWPWWAPWALLGVAVTSVLTIAATLYDIL
Ga0308175_10038217313300031938SoilMAKPDETNALAWPRWAPWALLAVAATSLLTIAATLYDIL
Ga0308175_10040513623300031938SoilTLMSQREKTNELSWPWWAPWALLAVAITSLLTIAATLYDIR
Ga0308175_10065309123300031938SoilMTERNETHELAWPWWAPWALLAVAATSVLTVAATLYDIL
Ga0308175_10082219723300031938SoilMAKPDETTELSWPWWAPWALLAVAATSALTIGATLYDIL
Ga0308175_10113408613300031938SoilMAKADETQKLSWPWWSAWALLAVAATSVLTIAATLYDIL
Ga0308175_10118348123300031938SoilMAKREETTKLSWPWWSPWALLAVVVTALLTIAATLYDIR
Ga0308175_10121101123300031938SoilMTKSEETDELSWPWWAPWALIAVALTSLLTIGATLYDIL
Ga0308175_10149720023300031938SoilMAKPDETNELSWPWWAPWALLAVAATSALTIGATLYDIL
Ga0308175_10236434313300031938SoilMAKLDETHRLSWPWWAPWALLAVVLTSILTIGATLYDIL
Ga0308175_10250680123300031938SoilMSKSQEASKLSWPWWAPWALLAVIVTSILTIGVTFYDIL
Ga0308175_10281328423300031938SoilRMAKITDETHQLSWPWWAPWALVAVAATSLLTVAATLYDIL
Ga0308174_1019556223300031939SoilMAKMDETHRLSWPWWAPWALLGVAVTSALTIAVTLYDIL
Ga0308174_1025447023300031939SoilKDNVRRLSWPWWSAWALLAVVLTSVVTIAATLYDIR
Ga0308174_1043523623300031939SoilMAKPDETHALSWPWWAPWALLAVALTSLLTVGATLYDIL
Ga0308174_1106595423300031939SoilMAKMDETHRLSWPWWAPWTLLAVAATSVLTIAATLYDIL
Ga0308174_1158439223300031939SoilMAKMDETHRLSWPWWAPWALLAVAVTSVLTISATLYDIL
Ga0308174_1178068813300031939SoilMAKKDDAHRLSWPWWSPWALVAVVLTSILTIAATLYDIR
Ga0307409_10041253123300031995RhizosphereMANGDDMPKLSWPWWAPWALLAVAVTSVLTIVVTVYTAG
Ga0308176_1066432623300031996SoilMAKMDETHRLSWPRWAPWALLAVVATSLLTIAATLYDIL
Ga0308176_1163302223300031996SoilVTKDDDAHRMSWPWWAPWVLLAVVLSCAATVAATLYDIW
Ga0308176_1282303713300031996SoilDEAHRLSWPRWAPWALLAVAATSLLTIAATLYDIL
Ga0307416_10218911013300032002RhizosphereMAKKEEVDRLSWPWWAPWALLAVAATSLLTVAATLYDIL
Ga0307416_10336498213300032002RhizosphereMAKNEEVDRLSWPWWAPWALLAVAATSLLTVAATLYDIL
Ga0310897_1006765223300032003SoilMEDSNIQKLSWPWWAPWALVAVIVGSALTIAATLYDIL
Ga0308173_1011050423300032074SoilMSNSVDPRRLSWPWWASWALLGVVATSLMTIAATLYDIL
Ga0308173_1046784923300032074SoilMTKSADPQRLSWPWWAPWALLGVAVTSLLTIAATLYDIL
Ga0326721_1071154923300032080SoilMPKINDTNRISWPWWAPWALFAVAATSLLTIVATLYDIL
Ga0334929_046803_518_6373300034135Hypolithic BiocrustMAKWSKTDKLSWPWWAPWALLAVAATCVLTVGATLYDIL
Ga0372943_0044846_1741_18603300034268SoilMAEHDETERLSWPWWAPWALLAVAVTSVLTIGATLYDIL
Ga0372943_0787501_43_1623300034268SoilMANPDEANELSWPWWAPWALLAVAATSLLTIGATLYDIL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.