NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F004874

Metagenome / Metatranscriptome Family F004874

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F004874
Family Type Metagenome / Metatranscriptome
Number of Sequences 420
Average Sequence Length 36 residues
Representative Sequence MGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFG
Number of Associated Samples 299
Number of Associated Scaffolds 420

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 89.17 %
% of genes near scaffold ends (potentially truncated) 9.29 %
% of genes from short scaffolds (< 2000 bps) 74.76 %
Associated GOLD sequencing projects 281
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.381 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.191 % of family members)
Environment Ontology (ENVO) Unclassified
(29.048 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.524 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 35.94%    β-sheet: 0.00%    Coil/Unstructured: 64.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 420 Family Scaffolds
PF04075F420H2_quin_red 40.71
PF02803Thiolase_C 14.29
PF01037AsnC_trans_reg 8.57
PF00230MIP 4.76
PF00266Aminotran_5 2.38
PF02775TPP_enzyme_C 1.19
PF02151UVR 0.95
PF00072Response_reg 0.48
PF02771Acyl-CoA_dh_N 0.48
PF00027cNMP_binding 0.48
PF00196GerE 0.24
PF00108Thiolase_N 0.24
PF02965Met_synt_B12 0.24
PF13580SIS_2 0.24
PF02885Glycos_trans_3N 0.24
PF02566OsmC 0.24
PF00248Aldo_ket_red 0.24
PF09660DUF2397 0.24
PF02595Gly_kinase 0.24
PF06559DCD 0.24
PF13913zf-C2HC_2 0.24
PF01568Molydop_binding 0.24
PF02467Whib 0.24
PF02514CobN-Mg_chel 0.24
PF02770Acyl-CoA_dh_M 0.24

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 420 Family Scaffolds
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 14.52
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 4.76
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.71
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.24
COG1410Methionine synthase I, cobalamin-binding domainAmino acid transport and metabolism [E] 0.24
COG1429Cobalamin biosynthesis protein CobN, Mg-chelataseCoenzyme transport and metabolism [H] 0.24
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.24
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.24
COG1929Glycerate kinaseCarbohydrate transport and metabolism [G] 0.24


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.38 %
UnclassifiedrootN/A7.62 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090008|P3_DRAFT_NODE_282566_len_957_cov_9_531871Not Available1007Open in IMG/M
2124908032|Perma_A_C_ConsensusfromContig201076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria811Open in IMG/M
2124908043|A2_c1_ConsensusfromContig71282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
2124908044|A5_c1_ConsensusfromContig16031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium739Open in IMG/M
2199352025|deepsgr__Contig_111825All Organisms → cellular organisms → Bacteria2247Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101621290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300000550|F24TB_10671984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300000559|F14TC_102556899All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300000891|JGI10214J12806_10908155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300000956|JGI10216J12902_100033220All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300000956|JGI10216J12902_100171249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1002Open in IMG/M
3300000956|JGI10216J12902_100768242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300000956|JGI10216J12902_112690706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium907Open in IMG/M
3300000956|JGI10216J12902_116758473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300001205|C688J13580_1001987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1745Open in IMG/M
3300001213|JGIcombinedJ13530_107413915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1109Open in IMG/M
3300001538|A10PFW1_10288994All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300001686|C688J18823_10341765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium976Open in IMG/M
3300001837|RCM39_1016261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300001851|RCM31_10254362All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300002120|C687J26616_10000765All Organisms → cellular organisms → Bacteria13162Open in IMG/M
3300002149|C687J26657_10071629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium725Open in IMG/M
3300005340|Ga0070689_101187847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300005445|Ga0070708_101115296All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005526|Ga0073909_10004425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4145Open in IMG/M
3300005526|Ga0073909_10301165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300005529|Ga0070741_10002470All Organisms → cellular organisms → Bacteria49463Open in IMG/M
3300005529|Ga0070741_10021071All Organisms → cellular organisms → Bacteria10182Open in IMG/M
3300005529|Ga0070741_10049226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5163Open in IMG/M
3300005540|Ga0066697_10282574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium979Open in IMG/M
3300005543|Ga0070672_101540899All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005548|Ga0070665_100327148All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300005552|Ga0066701_10078413All Organisms → cellular organisms → Bacteria1888Open in IMG/M
3300005553|Ga0066695_10011435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4670Open in IMG/M
3300005553|Ga0066695_10114541All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300005564|Ga0070664_100714290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria934Open in IMG/M
3300005564|Ga0070664_102352461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300005577|Ga0068857_102043971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300005578|Ga0068854_100399136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1137Open in IMG/M
3300005587|Ga0066654_10104742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1373Open in IMG/M
3300005598|Ga0066706_11330818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300005614|Ga0068856_101581321All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005617|Ga0068859_103029507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300005718|Ga0068866_10021481All Organisms → cellular organisms → Bacteria2974Open in IMG/M
3300005718|Ga0068866_10032131All Organisms → cellular organisms → Bacteria2535Open in IMG/M
3300005764|Ga0066903_100206062All Organisms → cellular organisms → Bacteria2953Open in IMG/M
3300005764|Ga0066903_102008966All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300005764|Ga0066903_102300941All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300005764|Ga0066903_102500716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300005764|Ga0066903_103404060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria858Open in IMG/M
3300005764|Ga0066903_104619935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300005834|Ga0068851_10482427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300005836|Ga0074470_10170009All Organisms → cellular organisms → Bacteria2775Open in IMG/M
3300005836|Ga0074470_10955394All Organisms → cellular organisms → Bacteria21207Open in IMG/M
3300005840|Ga0068870_10323918All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300005841|Ga0068863_100673370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1027Open in IMG/M
3300005843|Ga0068860_102190320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300005844|Ga0068862_102402063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300005844|Ga0068862_102674576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300005874|Ga0075288_1002005All Organisms → cellular organisms → Bacteria2599Open in IMG/M
3300005884|Ga0075291_1010440All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300005886|Ga0075286_1008010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1218Open in IMG/M
3300005985|Ga0081539_10018303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4868Open in IMG/M
3300005985|Ga0081539_10065014All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300006031|Ga0066651_10324637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria826Open in IMG/M
3300006031|Ga0066651_10329010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300006046|Ga0066652_100047403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3213Open in IMG/M
3300006046|Ga0066652_100158189All Organisms → cellular organisms → Bacteria1908Open in IMG/M
3300006046|Ga0066652_100671413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria984Open in IMG/M
3300006046|Ga0066652_100768973All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300006047|Ga0075024_100078077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1422Open in IMG/M
3300006173|Ga0070716_100736510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300006173|Ga0070716_101760152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300006175|Ga0070712_100764918All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300006224|Ga0079037_100026953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4179Open in IMG/M
3300006224|Ga0079037_100075346All Organisms → cellular organisms → Bacteria2745Open in IMG/M
3300006358|Ga0068871_101493155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300006572|Ga0074051_11747709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1126Open in IMG/M
3300006573|Ga0074055_11022855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300006573|Ga0074055_11136523All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300006573|Ga0074055_11423964All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300006579|Ga0074054_12088787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1245Open in IMG/M
3300006579|Ga0074054_12138340All Organisms → cellular organisms → Bacteria3700Open in IMG/M
3300006605|Ga0074057_11471983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi623Open in IMG/M
3300006605|Ga0074057_12097452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300006605|Ga0074057_12101528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300006791|Ga0066653_10743918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300006794|Ga0066658_10061539All Organisms → cellular organisms → Bacteria1649Open in IMG/M
3300006796|Ga0066665_10802847All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300006796|Ga0066665_11593163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300006797|Ga0066659_10036709All Organisms → cellular organisms → Bacteria2986Open in IMG/M
3300006806|Ga0079220_11012586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300006852|Ga0075433_10003733All Organisms → cellular organisms → Bacteria11783Open in IMG/M
3300006852|Ga0075433_10855786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300006854|Ga0075425_102258640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300006865|Ga0073934_10003669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria27632Open in IMG/M
3300006865|Ga0073934_10004656All Organisms → cellular organisms → Bacteria22389Open in IMG/M
3300006865|Ga0073934_10071416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2818Open in IMG/M
3300006865|Ga0073934_10176306All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300006876|Ga0079217_10833618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300006881|Ga0068865_101046922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300006894|Ga0079215_10368007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
3300006945|Ga0073933_1013150All Organisms → cellular organisms → Bacteria3404Open in IMG/M
3300006953|Ga0074063_12676412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium512Open in IMG/M
3300007790|Ga0105679_10143062All Organisms → cellular organisms → Bacteria3206Open in IMG/M
3300009012|Ga0066710_100007175All Organisms → cellular organisms → Bacteria10592Open in IMG/M
3300009012|Ga0066710_100148306All Organisms → cellular organisms → Bacteria3256Open in IMG/M
3300009012|Ga0066710_100459059All Organisms → cellular organisms → Bacteria1912Open in IMG/M
3300009012|Ga0066710_100490525All Organisms → cellular organisms → Bacteria1850Open in IMG/M
3300009037|Ga0105093_10375884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300009053|Ga0105095_10083007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1732Open in IMG/M
3300009078|Ga0105106_10613078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium780Open in IMG/M
3300009078|Ga0105106_10645260Not Available757Open in IMG/M
3300009087|Ga0105107_10088846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2176Open in IMG/M
3300009090|Ga0099827_10312660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1331Open in IMG/M
3300009090|Ga0099827_10398384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1176Open in IMG/M
3300009091|Ga0102851_10445826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1316Open in IMG/M
3300009091|Ga0102851_11850261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300009098|Ga0105245_10639541All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300009098|Ga0105245_12843254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium536Open in IMG/M
3300009131|Ga0115027_11705378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300009137|Ga0066709_100008893All Organisms → cellular organisms → Bacteria8935Open in IMG/M
3300009137|Ga0066709_100016471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7172Open in IMG/M
3300009137|Ga0066709_101284623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1074Open in IMG/M
3300009137|Ga0066709_101676749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium904Open in IMG/M
3300009162|Ga0075423_11658523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300009167|Ga0113563_10736036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1109Open in IMG/M
3300009789|Ga0126307_10472537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1012Open in IMG/M
3300009803|Ga0105065_1087754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300009815|Ga0105070_1000665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4269Open in IMG/M
3300009873|Ga0131077_10024452All Organisms → cellular organisms → Bacteria10025Open in IMG/M
3300009943|Ga0117933_1410896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1103Open in IMG/M
3300010038|Ga0126315_10429593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300010040|Ga0126308_11201001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300010041|Ga0126312_10881875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300010044|Ga0126310_10023746All Organisms → cellular organisms → Bacteria3114Open in IMG/M
3300010044|Ga0126310_10337781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1051Open in IMG/M
3300010045|Ga0126311_11593952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium549Open in IMG/M
3300010166|Ga0126306_10937351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300010313|Ga0116211_1081909Not Available854Open in IMG/M
3300010326|Ga0134065_10457799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300010359|Ga0126376_10575133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300010362|Ga0126377_10852655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300010373|Ga0134128_12639747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300010398|Ga0126383_12624979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300010403|Ga0134123_10894119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium893Open in IMG/M
3300011003|Ga0138514_100085237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300011119|Ga0105246_11463757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300011264|Ga0151623_1188412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300011435|Ga0137426_1150801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300012022|Ga0120191_10010406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1142Open in IMG/M
3300012200|Ga0137382_10094888All Organisms → cellular organisms → Bacteria1958Open in IMG/M
3300012201|Ga0137365_11006965All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012204|Ga0137374_10000406All Organisms → cellular organisms → Bacteria42948Open in IMG/M
3300012204|Ga0137374_10098735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2761Open in IMG/M
3300012206|Ga0137380_10144923All Organisms → cellular organisms → Bacteria2166Open in IMG/M
3300012206|Ga0137380_10541503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1022Open in IMG/M
3300012208|Ga0137376_10316135All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300012209|Ga0137379_10748627All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300012212|Ga0150985_103203039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300012212|Ga0150985_107862301All Organisms → cellular organisms → Bacteria → Terrabacteria group614Open in IMG/M
3300012285|Ga0137370_10712767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300012349|Ga0137387_10381114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1022Open in IMG/M
3300012354|Ga0137366_11248886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300012355|Ga0137369_10121895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2108Open in IMG/M
3300012360|Ga0137375_10105652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2855Open in IMG/M
3300012902|Ga0157291_10094738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300012931|Ga0153915_10006043All Organisms → cellular organisms → Bacteria11314Open in IMG/M
3300012931|Ga0153915_11030455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria959Open in IMG/M
3300012944|Ga0137410_10696913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium846Open in IMG/M
3300012951|Ga0164300_10703146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300012957|Ga0164303_10018495All Organisms → cellular organisms → Bacteria2633Open in IMG/M
3300012957|Ga0164303_10370509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium873Open in IMG/M
3300012964|Ga0153916_13003427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300012971|Ga0126369_12284802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300012984|Ga0164309_11307483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300012985|Ga0164308_11474337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300012985|Ga0164308_11595444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300012987|Ga0164307_10397413All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300013308|Ga0157375_11135030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium916Open in IMG/M
3300013503|Ga0120127_10114644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium616Open in IMG/M
3300014166|Ga0134079_10320924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300014259|Ga0075311_1083027Not Available664Open in IMG/M
3300014299|Ga0075303_1017610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1023Open in IMG/M
3300014318|Ga0075351_1006327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1595Open in IMG/M
3300014318|Ga0075351_1048394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300014318|Ga0075351_1157223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300014321|Ga0075353_1191944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300014324|Ga0075352_1229076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300014324|Ga0075352_1243954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300015358|Ga0134089_10079431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1234Open in IMG/M
3300015372|Ga0132256_100334025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1607Open in IMG/M
3300015372|Ga0132256_101112223All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300015372|Ga0132256_102543438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300015372|Ga0132256_103035769All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300015373|Ga0132257_101938651All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300017792|Ga0163161_10943796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium733Open in IMG/M
3300017792|Ga0163161_11020105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300017944|Ga0187786_10483232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria558Open in IMG/M
3300017947|Ga0187785_10000657All Organisms → cellular organisms → Bacteria12615Open in IMG/M
3300017947|Ga0187785_10015193All Organisms → cellular organisms → Bacteria2670Open in IMG/M
3300017966|Ga0187776_10239483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1156Open in IMG/M
3300017966|Ga0187776_10330332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1000Open in IMG/M
3300018027|Ga0184605_10002560All Organisms → cellular organisms → Bacteria6154Open in IMG/M
3300018027|Ga0184605_10022240All Organisms → cellular organisms → Bacteria2557Open in IMG/M
3300018027|Ga0184605_10106328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1242Open in IMG/M
3300018027|Ga0184605_10153316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1038Open in IMG/M
3300018028|Ga0184608_10000343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria12180Open in IMG/M
3300018031|Ga0184634_10003034All Organisms → cellular organisms → Bacteria5319Open in IMG/M
3300018032|Ga0187788_10023546All Organisms → cellular organisms → Bacteria1975Open in IMG/M
3300018055|Ga0184616_10335227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300018060|Ga0187765_11057815Not Available560Open in IMG/M
3300018061|Ga0184619_10006319All Organisms → cellular organisms → Bacteria4486Open in IMG/M
3300018071|Ga0184618_10402215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300018073|Ga0184624_10035857All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300018074|Ga0184640_10000250All Organisms → cellular organisms → Bacteria13365Open in IMG/M
3300018079|Ga0184627_10583551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium565Open in IMG/M
3300018089|Ga0187774_11267747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300018422|Ga0190265_10148545All Organisms → cellular organisms → Bacteria2288Open in IMG/M
3300018431|Ga0066655_10011556All Organisms → cellular organisms → Bacteria3848Open in IMG/M
3300018433|Ga0066667_10425787All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300018433|Ga0066667_10539833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium966Open in IMG/M
3300018465|Ga0190269_11885311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300018466|Ga0190268_10034468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1838Open in IMG/M
3300018466|Ga0190268_10071159All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300018466|Ga0190268_10455401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium849Open in IMG/M
3300018466|Ga0190268_12057238All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300018469|Ga0190270_11349941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300018469|Ga0190270_12149209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300018476|Ga0190274_11332716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300018482|Ga0066669_10205130All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300018482|Ga0066669_10437520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1119Open in IMG/M
3300018482|Ga0066669_10868570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300018482|Ga0066669_11214569All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300019356|Ga0173481_10018837All Organisms → cellular organisms → Bacteria2074Open in IMG/M
3300019356|Ga0173481_10507670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300019356|Ga0173481_10747549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300019362|Ga0173479_10172071All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300019362|Ga0173479_10560788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300021063|Ga0206227_1117734All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300021078|Ga0210381_10282765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300021082|Ga0210380_10178909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria956Open in IMG/M
3300021184|Ga0196959_10024029All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300021184|Ga0196959_10108129All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300021316|Ga0210351_1347061All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300021337|Ga0210341_1716518All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300021415|Ga0193694_1003332All Organisms → cellular organisms → Bacteria2210Open in IMG/M
3300021418|Ga0193695_1026339All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300022213|Ga0224500_10086482All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300022554|Ga0212093_1001375All Organisms → cellular organisms → Bacteria70903Open in IMG/M
3300022756|Ga0222622_10907630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300023266|Ga0247789_1084894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300024187|Ga0247672_1069595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300025159|Ga0209619_10181877All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300025159|Ga0209619_10407653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300025160|Ga0209109_10324142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium730Open in IMG/M
3300025164|Ga0209521_10045935All Organisms → cellular organisms → Bacteria2963Open in IMG/M
3300025167|Ga0209642_10781076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium502Open in IMG/M
3300025310|Ga0209172_10002773All Organisms → cellular organisms → Bacteria29398Open in IMG/M
3300025310|Ga0209172_10008975All Organisms → cellular organisms → Bacteria9515Open in IMG/M
3300025310|Ga0209172_10129941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1404Open in IMG/M
3300025313|Ga0209431_10137570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1932Open in IMG/M
3300025322|Ga0209641_10314239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1149Open in IMG/M
3300025327|Ga0209751_10887114All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300025521|Ga0210083_1004973All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300025537|Ga0210061_1004062All Organisms → cellular organisms → Bacteria2276Open in IMG/M
3300025549|Ga0210094_1013644All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300025885|Ga0207653_10186956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300025899|Ga0207642_10028425All Organisms → cellular organisms → Bacteria2302Open in IMG/M
3300025899|Ga0207642_10033231All Organisms → cellular organisms → Bacteria2180Open in IMG/M
3300025910|Ga0207684_10231642All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300025921|Ga0207652_11761444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300025922|Ga0207646_10855381All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300025922|Ga0207646_10897135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium786Open in IMG/M
3300025932|Ga0207690_10746440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300025934|Ga0207686_10086218All Organisms → cellular organisms → Bacteria2062Open in IMG/M
3300025936|Ga0207670_10240159All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300025937|Ga0207669_11951424Not Available502Open in IMG/M
3300025939|Ga0207665_10087333All Organisms → cellular organisms → Bacteria2156Open in IMG/M
3300025945|Ga0207679_10289940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1407Open in IMG/M
3300025960|Ga0207651_10775487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300025971|Ga0210102_1139241Not Available520Open in IMG/M
3300025993|Ga0208415_1009293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300026023|Ga0207677_11802085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300026075|Ga0207708_10774660All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300026078|Ga0207702_11345479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300026089|Ga0207648_11671340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300026095|Ga0207676_10910655All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300026121|Ga0207683_10330091All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300026452|Ga0256821_1020562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300026536|Ga0209058_1263579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300026542|Ga0209805_1116056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1268Open in IMG/M
3300026746|Ga0207454_102608All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300026747|Ga0207587_102346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300027032|Ga0209877_1016524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300027639|Ga0209387_1098803All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300027647|Ga0214468_1035303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1326Open in IMG/M
3300027713|Ga0209286_1035357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1864Open in IMG/M
(restricted) 3300027799|Ga0233416_10012744All Organisms → cellular organisms → Bacteria2740Open in IMG/M
(restricted) 3300027799|Ga0233416_10022188All Organisms → cellular organisms → Bacteria2100Open in IMG/M
3300027818|Ga0209706_10045522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2215Open in IMG/M
3300027870|Ga0209023_10076402All Organisms → cellular organisms → Bacteria2440Open in IMG/M
3300027882|Ga0209590_10232659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1172Open in IMG/M
3300027882|Ga0209590_10470766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300027915|Ga0209069_10189858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1043Open in IMG/M
3300027979|Ga0209705_10147399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_19FT_COMBO_70_191261Open in IMG/M
3300028380|Ga0268265_12317301All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes544Open in IMG/M
3300028589|Ga0247818_11140900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300028712|Ga0307285_10144993All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300028717|Ga0307298_10066477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1001Open in IMG/M
3300028744|Ga0307318_10077002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1117Open in IMG/M
3300028744|Ga0307318_10242604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300028771|Ga0307320_10211413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium760Open in IMG/M
3300028782|Ga0307306_10029267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1299Open in IMG/M
3300028784|Ga0307282_10079848All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300028784|Ga0307282_10607724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300028793|Ga0307299_10393084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300028802|Ga0307503_10167549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1012Open in IMG/M
3300028802|Ga0307503_10188521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300028802|Ga0307503_10386820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300028802|Ga0307503_10496971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300028802|Ga0307503_10511900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300028802|Ga0307503_10732666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium558Open in IMG/M
3300028803|Ga0307281_10292834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300028807|Ga0307305_10478756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300028814|Ga0307302_10264928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300028819|Ga0307296_10299938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria876Open in IMG/M
3300028824|Ga0307310_10064988All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300028876|Ga0307286_10210856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium706Open in IMG/M
3300028876|Ga0307286_10397550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300028880|Ga0307300_10179388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300028881|Ga0307277_10431136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300029977|Ga0272449_1039790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2327Open in IMG/M
3300030006|Ga0299907_10000016All Organisms → cellular organisms → Bacteria48860Open in IMG/M
3300030006|Ga0299907_10063994All Organisms → cellular organisms → Bacteria2959Open in IMG/M
3300030006|Ga0299907_11041214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300030336|Ga0247826_10156374All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300030336|Ga0247826_10415882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria997Open in IMG/M
3300030613|Ga0299915_10156768All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300030613|Ga0299915_10487143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium812Open in IMG/M
3300030619|Ga0268386_10339992Not Available1073Open in IMG/M
3300030620|Ga0302046_11261247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300031093|Ga0308197_10190450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium690Open in IMG/M
3300031170|Ga0307498_10127007All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300031170|Ga0307498_10480367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300031199|Ga0307495_10170512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300031366|Ga0307506_10041410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1294Open in IMG/M
3300031366|Ga0307506_10118689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium891Open in IMG/M
3300031421|Ga0308194_10116070All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300031455|Ga0307505_10144670All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300031548|Ga0307408_101221887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300031576|Ga0247727_10003705All Organisms → cellular organisms → Bacteria33458Open in IMG/M
3300031576|Ga0247727_10027844All Organisms → cellular organisms → Bacteria7999Open in IMG/M
3300031720|Ga0307469_10911745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium815Open in IMG/M
3300031720|Ga0307469_12059458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300031740|Ga0307468_102153877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300031834|Ga0315290_10178313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1839Open in IMG/M
3300031873|Ga0315297_10358013All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300031908|Ga0310900_10406849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300031949|Ga0214473_10013157All Organisms → cellular organisms → Bacteria9695Open in IMG/M
3300031949|Ga0214473_10089567All Organisms → cellular organisms → Bacteria3595Open in IMG/M
3300031949|Ga0214473_10102476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3342Open in IMG/M
3300031949|Ga0214473_10103492All Organisms → cellular organisms → Bacteria3325Open in IMG/M
3300031949|Ga0214473_10175686All Organisms → cellular organisms → Bacteria2486Open in IMG/M
3300031949|Ga0214473_10176622All Organisms → cellular organisms → Bacteria2479Open in IMG/M
3300031949|Ga0214473_10580615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300031949|Ga0214473_10616248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1195Open in IMG/M
3300031949|Ga0214473_10647739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1159Open in IMG/M
3300031949|Ga0214473_11708818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300031949|Ga0214473_11957458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300031949|Ga0214473_12163709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300031965|Ga0326597_10142460All Organisms → cellular organisms → Bacteria2870Open in IMG/M
3300031965|Ga0326597_10556846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1236Open in IMG/M
3300031965|Ga0326597_10904794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium902Open in IMG/M
3300031965|Ga0326597_12017561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300032126|Ga0307415_100623208All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300032163|Ga0315281_10318913All Organisms → cellular organisms → Bacteria1693Open in IMG/M
3300032174|Ga0307470_11239075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300032177|Ga0315276_10382909All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300032256|Ga0315271_10136810All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300032516|Ga0315273_11655525Not Available778Open in IMG/M
3300032770|Ga0335085_10020709All Organisms → cellular organisms → Bacteria9391Open in IMG/M
3300033004|Ga0335084_10142503All Organisms → cellular organisms → Bacteria2494Open in IMG/M
3300033004|Ga0335084_11769178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300033233|Ga0334722_10087584All Organisms → cellular organisms → Bacteria2380Open in IMG/M
3300033233|Ga0334722_10960733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300033407|Ga0214472_10183657All Organisms → cellular organisms → Bacteria2032Open in IMG/M
3300033416|Ga0316622_100719465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1156Open in IMG/M
3300033433|Ga0326726_10043627All Organisms → cellular organisms → Bacteria3918Open in IMG/M
3300033433|Ga0326726_10224917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1740Open in IMG/M
3300033485|Ga0316626_10632216All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300033489|Ga0299912_10325481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_19FT_COMBO_70_191281Open in IMG/M
3300033521|Ga0316616_102592276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300033551|Ga0247830_11608120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300034099|Ga0373902_083683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300034155|Ga0370498_002791All Organisms → cellular organisms → Bacteria3929Open in IMG/M
3300034176|Ga0364931_0182529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil3.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.33%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment2.14%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.90%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.90%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.90%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.43%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.19%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.19%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.19%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.95%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.71%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.71%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.48%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.48%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.48%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.48%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.48%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.48%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.48%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.48%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.48%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.48%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.48%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.48%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.24%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.24%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.24%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment0.24%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.24%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.24%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring0.24%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.24%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Fe-Si Sediment0.24%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.24%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.24%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.24%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.24%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.24%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.24%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.24%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.24%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.24%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.24%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.24%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001837Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3aEnvironmentalOpen in IMG/M
3300001851Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3bEnvironmentalOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300002149Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005884Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302EnvironmentalOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006945Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC16 2012 metaGEnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300009807Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300009823Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300009943Combined Assembly of Gp0139325, Gp0139347, Gp0139348EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010313Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011264Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014259Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1EnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021184Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20EnvironmentalOpen in IMG/M
3300021316Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021337Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022554Dewar_combined assemblyEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025521Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025549Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025971Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026452Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026746Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026747Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A3-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027013Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027032Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027647Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeqEnvironmentalOpen in IMG/M
3300027713Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300029977Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-024-1EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034099Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3EngineeredOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034177Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
P3_DRAFT_003355902088090008SoilVGFNAMQPGKIKKGDIVMLVAAIVVVFALIFWAVR
Perma_A_C_031979502124908032SoilMGFNAMQPGKTKRGDLLFLAAAVIVVGILLAWAFFG
A2_c1_002710402124908043SoilVGFNAMQPGKIKKGDIVMLGAAVIVVLALIIWAVR
A5_c1_004258502124908044SoilVGFNAMQPGKIKKGDIVMLVAAVIVVLALIIWAVR
KansclcFeb2_073577602124908045SoilVGFNAMRPGKVKAADLVMLVAAIVVIVALVIWAIR
deepsgr_017565002199352025SoilMGFNAMQPGKVKRADLLFLIAAVIVIGALLAWAFFGS
INPhiseqgaiiFebDRAFT_10162129033300000364SoilVGFNAMQPGKVKRSDLLYLVAAVVVIGLLLAWAFFGT*
F24TB_1067198423300000550SoilMGFNAMQPGKVKRGDLLYLVAALIVIGLLLAWAFFGT*
F14TC_10255689923300000559SoilVGFNAMQPGKVKRGDLLYLVAALIVIGLLLAWAFFGT*
JGI10214J12806_1090815523300000891SoilMGFNAMQPGKVKRGDLLFLIAAVIVVGALLAWAFFGS*
JGI10216J12902_10003322033300000956SoilSRNRRTEHMGFNAMQPGKIKRGDLLYLVVALIVIGLLLAWAFFGS*
JGI10216J12902_10017124933300000956SoilMGFNAMQPGKIKRGDVLYLVVALIVIGLLLAWAFFGT*
JGI10216J12902_10076824233300000956SoilMGFNAMQPGKVKRGDLLFLLAAVIVIGALLAWAFFGS
JGI10216J12902_11269070633300000956SoilVGFNAMQPGKVKRGDLLFLLAAIVVVVALVVWALTA*
JGI10216J12902_11675847333300000956SoilMGFNAMQPGKVRRGDLLFLIAAILVVTLLVLWAVRA*
C688J13580_100198713300001205SoilVGFNAMQPGKIKRGDLIFLIAAIVVIGALIAWALFGS*
JGIcombinedJ13530_10741391533300001213WetlandVGFNAMQPGKIKKGDLLYLLAAIVVIGALVIWALR*
A10PFW1_1028899443300001538PermafrostMGFNYQQPGKIKRADWIMLIAAVVVIAGLIVWATR*
C688J18823_1034176533300001686SoilMGFNAMQPGKVKRFDLIMLISAIVVVGALVFWAVH*
RCM39_101626123300001837Marine PlanktonVGFNAMRPGKVKRGDVLYLLAAVVVIAALVLWAVR*
RCM31_1025436223300001851Marine PlanktonVGFNAMRPGKVKRGDLLYLLAAVVVIAALVLWAVR*
C687J26616_1000076523300002120SoilMGFNAMQPGKIKPADLLYLLAAVVVIGGLIWWAVS*
C687J26657_1007162923300002149SoilMGFNAMQPGKIKRGDLLYLLSAIVVVVGLIVWAVR*
Ga0070689_10118784733300005340Switchgrass RhizosphereMGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFRVSAVADL
Ga0070708_10111529633300005445Corn, Switchgrass And Miscanthus RhizosphereGGGMGFNAMQPGKVKRGDLLFLIVALIVIGALVAWAFFGT*
Ga0073909_1000442543300005526Surface SoilMGFNAMQPGKVKRGDLLFLIAAVIVIGALLAWAFFGS*
Ga0073909_1030116533300005526Surface SoilVGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFG*
Ga0070741_10002470513300005529Surface SoilMGFNAMQPGKIKRADLVMLVCAVLVIAGLVAWAVR*
Ga0070741_1002107183300005529Surface SoilMGFNAMQPGKIKRADLVMLVCAVIVIAGLVVWAVR*
Ga0070741_1004922673300005529Surface SoilMGFNAMQPGKVRRADLVMLVCAILVIAGLVAWAVR*
Ga0066697_1028257423300005540SoilMGFNAMQPGKVKRGDLLFLIVALIVIGALLAWAFFGS*
Ga0070672_10154089933300005543Miscanthus RhizosphereVGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVR*
Ga0070665_10032714833300005548Switchgrass RhizosphereMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL*
Ga0066701_1007841343300005552SoilMGFNAMQPGRVKRGDLVFLIVAVIVIGALVAWAFFGS*
Ga0066695_1001143553300005553SoilMGFNAMQPGKVKPGDLLFLIVALIVIGALLAWAFFGS*
Ga0066695_1011454143300005553SoilMGFNTMQPGKVKRGDLLYLVAALIVIGLLLAWAFFGT*
Ga0066700_1015020723300005559SoilMGFNAMRPGRVRRGDLIMLLAAIVIVAALVYWAVH*
Ga0066699_1073627513300005561SoilMGFNAMRPGRVKGGDLLMLLAAIVIVGALVFWAVR*
Ga0070664_10071429033300005564Corn RhizosphereMGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG*
Ga0070664_10235246113300005564Corn RhizosphereMGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGS*
Ga0068857_10204397123300005577Corn RhizosphereVTVGFNAMQPGRIKRGDLWYLVAAIVVIGALVIWAVR*
Ga0068854_10039913633300005578Corn RhizosphereMGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGL*
Ga0066654_1010474223300005587SoilVGFNAMQPGKLKRGDLIFLIAAIVVIGALLAWALFG*
Ga0066706_1055695133300005598SoilLGFNAMRPGRVKGADLLMLLAAIVIVGALVFWAVR*
Ga0066706_1133081813300005598SoilMGFNAMQPGKVKRGDLLFLVVALIVIGALLAWAFFGS*
Ga0068856_10158132113300005614Corn RhizosphereVGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGS*
Ga0068859_10302950723300005617Switchgrass RhizosphereVGFNAMQPGKIKKGDFVMLVAAIVVVLALVIWAVR*
Ga0068866_1002148133300005718Miscanthus RhizosphereMGFNAMQPGKVKRADLLFLIAAMIVVGALLAWAFFGS*
Ga0068866_1003213133300005718Miscanthus RhizosphereVGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWALFGS*
Ga0066903_10020606243300005764Tropical Forest SoilVGFNAMQPGKIKRGDLIFLIAAIVVIAALLAWAFFGL*
Ga0066903_10200896633300005764Tropical Forest SoilMGFNAMQPGKIKKGDLIFFVSGLVVILALVIWAIR*
Ga0066903_10230094113300005764Tropical Forest SoilTMGFNAMQPGKIKKGDIIFFVSGLVVILALVIWAIR*
Ga0066903_10250071623300005764Tropical Forest SoilMGFNAMQPGKVKRGDLLFLIAALIVIGLLLAWAFFGT*
Ga0066903_10340406023300005764Tropical Forest SoilMGFNAMQPGKVKRGDLLYLVAALIVIGLLLAWAFFGH*
Ga0066903_10461993523300005764Tropical Forest SoilMGFNAMQPGKVKRGDLVYLVVALVVIGLLLAWAFFGT*
Ga0068851_1048242743300005834Corn RhizosphereSRRGSAMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL*
Ga0074470_1017000953300005836Sediment (Intertidal)MGFNAMQPGKIKRGDVLFLLAAVIVIGALLAWAFLG*
Ga0074470_10955394113300005836Sediment (Intertidal)MGFNAMQPGKIKRGDLLFLLAAVIVIGALLAWAFLG*
Ga0068870_1032391823300005840Miscanthus RhizosphereVGFNYQQPGKIKRGDWIMLIAAVVVVAALVIWAVR*
Ga0068863_10067337013300005841Switchgrass RhizosphereRRGSAMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL*
Ga0068860_10219032023300005843Switchgrass RhizosphereMGFNAMQPGRVKRGDLLFLIAAVIVIGALLAWAFFGS*
Ga0068862_10240206323300005844Switchgrass RhizosphereVGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVR*
Ga0068862_10267457623300005844Switchgrass RhizosphereMGFNAMQPGRIKRGDVIFLIAAIVVIGALLAWAFFGL*
Ga0075288_100200523300005874Rice Paddy SoilMGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAVR*
Ga0075291_101044013300005884Rice Paddy SoilDDMGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAVR*
Ga0075286_100801043300005886Rice Paddy SoilMGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAAR*
Ga0081539_1001830333300005985Tabebuia Heterophylla RhizosphereMGFNAMQPGRIKRGDLLLLVAAVVIVGALIAWALFGS*
Ga0081539_1006501423300005985Tabebuia Heterophylla RhizosphereMGFNAMQPGKVKPGDIAFLVAAIVVIAALVFWAVR*
Ga0066651_1032463733300006031SoilVGFNAMQPGKIKRGDLIFLIAAIAVIGALLAWAFFGL*
Ga0066651_1032901033300006031SoilMGFNAMQPGKIKRGDLLFLLAAIVVIAALVAWALWS*
Ga0066652_10004740343300006046SoilMGFNAMQPGKVKRADLIMLICAVIVVGALVFWAVH*
Ga0066652_10015818923300006046SoilMGFNAMQPGKVKRGDLLFLIAAVIVIGLLVAWAFFGS*
Ga0066652_10067141343300006046SoilMGFNAMQPGKIKRGDIIMLVSGIVVIVALIVWAVR*
Ga0066652_10076897323300006046SoilVGFNAMQPGKIKRGDLLFLLAAVVVVAALVIWATWS*
Ga0075024_10007807723300006047WatershedsVGFNAMQPGKIKKGDVIMLVAAVVVFAALIVWAVR*
Ga0070716_10073651023300006173Corn, Switchgrass And Miscanthus RhizosphereMGFNAMQPGKVKRGDLLFLIVALIVIGALVAWAFFGT*
Ga0070716_10176015223300006173Corn, Switchgrass And Miscanthus RhizosphereVGFNAMQPGKVKRADLIMLLCAVVVVGALIFWAVH*
Ga0070712_10076491823300006175Corn, Switchgrass And Miscanthus RhizosphereMGFNAMQPGKVKRGDLLFLIAAVIVIGVLVAWALFGS*
Ga0079037_10002695313300006224Freshwater WetlandsVGFNAMQPGKIKKGDLVFLVAAIVVTGALLAWALF
Ga0079037_10007534653300006224Freshwater WetlandsVGFNAMQPGKIKRGDLLYLLAAVVIIVALVLWAIS*
Ga0068871_10149315523300006358Miscanthus RhizosphereVGFNYQQPGKIKRGDWIMLIAAVVVVAGLVIWAVR*
Ga0074051_1174770933300006572SoilMGFNAMQPGRIKRGDLLFLVAAIVVVGVLLAWAFFGT*
Ga0074055_1102285523300006573SoilVGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVH*
Ga0074055_1113652343300006573SoilMGFNAMQPGKVKRADLLFLIAAVIVIGALLAWAFFGS*
Ga0074055_1142396443300006573SoilMGFNAMQPGRIKRADLLYLVAAIVVIGALLAWAFLGR*
Ga0074054_1208878743300006579SoilMQPGKIKRGDLVFLIAAIVVIGALLAWAFFGSCRRSTRPR
Ga0074054_1213834053300006579SoilMGFNAMQPGKVKRADLLFLIAAVIVIGALLVWAFFGS*
Ga0074057_1147198333300006605SoilMGFNAMQPGKVKRGDLVFLVAAVIVIGLLVAWAFFGS*
Ga0074057_1209745213300006605SoilMGFNAMQPGRIKRGDLLFLVAAIVVVGVLLAWAFF
Ga0074057_1210152843300006605SoilVGFNAMQPGKIKRGDIIMLVAAIVVVLALVIWAVR*
Ga0066653_1074391813300006791SoilMGFNAMQPGKVKRGDLLYLLVALIVIGLLLAWAFFGT*
Ga0066658_1006153923300006794SoilMGFNAMQPGKVKRADLIMLICAVVVVGALIFWAVH*
Ga0066665_1080284733300006796SoilMGFNAMQPGKVKRGDLLFLIVALIVIGALVAWAFFGS*
Ga0066665_1159316323300006796SoilMGFNAKQPGKVKRGDLVFLSAAVIVIGVLVAWAFFGS*
Ga0066659_1003670923300006797SoilMGFNAMQPGKVKRGDLLFLIVAVIVIGALVAWAFFGS*
Ga0066660_1051967323300006800SoilLGFNAMRPGRVRKGDVIMLVSAIAVIAALVIWAVR*
Ga0079220_1101258623300006806Agricultural SoilVGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGS*
Ga0075433_1000373383300006852Populus RhizosphereMGFNAMQPGKIKRGDLLYLVVALIVIGLLLAWAFFGS*
Ga0075433_1085578623300006852Populus RhizosphereMGFNAMQPGKVKRGDLVYLVVALVVIGLLLAWAFFGS*
Ga0075425_10225864023300006854Populus RhizosphereMGFNAMQPGKIKKGDIIFFVSGLVVILALVIWAIR*
Ga0073934_1000366953300006865Hot Spring SedimentMGFNAMQPGKVKRGDLLYLLAALIVIVGLVVWAVR*
Ga0073934_1000465643300006865Hot Spring SedimentVGFNAMQPGKIKRGDLLYLAAGILVIVALVLWAIL*
Ga0073934_1007141643300006865Hot Spring SedimentMGFNAMQPGKVKRADLIMLLSALAVLVALVVWALR*
Ga0073934_1017630633300006865Hot Spring SedimentMGFNAMQPGKVKRGDLLYLLAAVIVIVGMIVWAVR*
Ga0079217_1083361823300006876Agricultural SoilVGFNAMQPGKTKRGDIIMLVAAIVLFGGALVWALR*
Ga0068865_10104692223300006881Miscanthus RhizosphereVGFNAMQPGRIKRGDLWYLVAAIVVIGALVIWAVR*
Ga0079215_1036800713300006894Agricultural SoilVGFNTMRPGKVKRGDLLYLIAAIVVIAALVIWAVR*
Ga0073933_101315033300006945Hot Spring SedimentMGFNAMRPGKVKRGDLLYLAAALIVMAALVIWAVR*
Ga0074063_1267641223300006953SoilVGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVH*
Ga0105679_1014306223300007790SoilMGFNAMRPGKVKRGDLIMFVAAVVVIVALVVWALL*
Ga0066710_10000717553300009012Grasslands SoilMGFNAMQPGKVKRGDLVFLIAAVIVIGVLVAWAFFGS
Ga0066710_10014830673300009012Grasslands SoilVGFNAMQPGKIKRADLIMLISAIVVIVALVVWAAH
Ga0066710_10045905943300009012Grasslands SoilMGFNAMQPGKVKRGDLLFLIAAVIVIGLLIAWAFFGS
Ga0066710_10049052523300009012Grasslands SoilMGFNAMQPGKVKRGDLVFLVAAVIVIGVLVAWAFFGS
Ga0066710_10467430323300009012Grasslands SoilMGFNAMRPGRVKGGDLLMLLAAIVIVGALVFWAVR
Ga0105093_1037588423300009037Freshwater SedimentVGFNAMQPGKVKRGDLVYLIAAIVVIGALVAWALS*
Ga0105095_1008300723300009053Freshwater SedimentMGFNAMQPGKIKRGDLLYLAAGIAVIVALVLWAIL*
Ga0105106_1061307833300009078Freshwater SedimentVTVGFNAMQPGKVKRGDLLYLLAAIVVIAGLVVWAVR*
Ga0105106_1064526013300009078Freshwater SedimentMGFNAMRPGKVRKGDLLYLLAAVVVIGVLIVWAMS*
Ga0105107_1008884633300009087Freshwater SedimentVTVGFNAMQPGKVKRDDLLYLLAAIVVIVGLVVWAVR*
Ga0099827_1031266033300009090Vadose Zone SoilMGFNSMQPGKVKRGDLIMLAAALAVLVALVVWAVR*
Ga0099827_1039838443300009090Vadose Zone SoilMGFNAMQPGKVKRGDLLLLIVALIVIGALVAWAFFGS*
Ga0102851_1044582633300009091Freshwater WetlandsVTVGFNAMQPGKIKRGDLLYLLAAVVIIVALVLWAIS*
Ga0102851_1185026123300009091Freshwater WetlandsVTVGFNAMRPGKVRRGDLLYLLAAVVVIGGLIVWAVR*
Ga0105245_1063954113300009098Miscanthus RhizosphereMGFNAMQPGKVKRADLIMLICAIVVVGALIFWAVH*
Ga0105245_1284325413300009098Miscanthus RhizosphereMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGS*
Ga0115027_1170537833300009131WetlandVGFNAMQPGKIKKGDLLFLVAAIVVTAALLAWAFFG*
Ga0066709_10000889393300009137Grasslands SoilMGFNAMQPGKVKRGDLLFLIAAVIVIGLLIAWAFFGS*
Ga0066709_10001647193300009137Grasslands SoilMGFNAMQPGKVKRGDLVFLIAAVIVIGVLVAWAFFGS*
Ga0066709_10128462333300009137Grasslands SoilMGFNAMQPGKVKRGDLVFLVAAVIVIGVLVAWAFFGS*
Ga0066709_10167674913300009137Grasslands SoilMGFNAMQPGRVKRGDLVFLIVALIVIGALVAWAFFGS*
Ga0075423_1165852323300009162Populus RhizosphereMGFNAKQPGRVKRGDLLFLIAAVIVIGALLAWAFFGS*
Ga0113563_1073603643300009167Freshwater WetlandsVTVGFNAMRPGKVRRGDLLYLLAAAVVIGGLIIWAAR*
Ga0126307_1047253733300009789Serpentine SoilMGFNAMQPGKVNRGDILFLVTAIVVIAALVFWAVH*
Ga0105065_108775423300009803Groundwater SandEMGFNAMQPGKVKRADILMLVSAIVVIVALVVWAVR*
Ga0105061_105198033300009807Groundwater SandGFNAMRPGKVKAADLVMLVAAIVVIVALVIWAIR*
Ga0105070_100066543300009815Groundwater SandMGFNAMQPGKVKRADILMLVSAIVVIVALVVWAVR*
Ga0105078_100719333300009823Groundwater SandVGFNAMRPGKVRTADLVMLVAAIVVIVALVIWAVR*
Ga0105068_107368423300009836Groundwater SandVGFNAMRPGKIKKGDLIMLAAGILVLVGLVIWAIA*
Ga0105058_100674953300009837Groundwater SandVGFNAMRPGKVKAADLVMLVAAIVVIVALVIWAVR*
Ga0131077_1002445263300009873WastewaterMGFNAMQPGKIKKGDLLMLGAAVVVFVLLILWVAL*
Ga0117933_141089623300009943Hot Spring Fe-Si SedimentMGFNAMRPGKVKRGDLLYLAAALVVMAALVIWAVR*
Ga0126315_1042959343300010038Serpentine SoilMGFNAMQPGKVNRGDILFLVSAIVVIAALVFWAVH*
Ga0126308_1120100113300010040Serpentine SoilMGFNAMQPGKVNRGDILFLVTAIVVMAVLELIVKR
Ga0126312_1088187523300010041Serpentine SoilMGFNAMQPGRIKRGDILYLVAAIVVIVGLIVWAVR*
Ga0126310_1002374643300010044Serpentine SoilVGFNYQQPGKIKRGDWIMLIAAVVIVAALVVWVVR*
Ga0126310_1033778143300010044Serpentine SoilVGFNAMQPGKIKRGDIIMLVAAIVIVVALVVWAIS*
Ga0126311_1159395213300010045Serpentine SoilRLSAVGFNAMQPGRIKRGDLLFLIAAIVVIGALIAWALFG*
Ga0126306_1093735113300010166Serpentine SoilMGFNYQQPGKIKRGDWIMLIAAVVVVVALTIWATR*
Ga0116211_108190923300010313Hot SpringMGFNAMRPGRVKRGDLLYLLAAVVVVAALVFWAVR*
Ga0134065_1045779923300010326Grasslands SoilMGFNAMQPGKVKRGDLLFLIAAVIVIGLLVAWAFLGS*
Ga0126376_1057513313300010359Tropical Forest SoilVGFNAMQPGKIKRGDLIFLIAAIVVIGALLPWAFSG*
Ga0126377_1085265523300010362Tropical Forest SoilVGFNAMQPGRVKRGDLLYLIVAVIVIGLLLAWAFFGT*
Ga0134128_1263974713300010373Terrestrial SoilMGFNAMQPGKVKRADLIMLICAIVVVGVLIFWAVH*
Ga0126383_1262497923300010398Tropical Forest SoilVGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL*
Ga0134123_1089411933300010403Terrestrial SoilVGVNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVR*
Ga0138514_10008523723300011003SoilMGFNAMQPGKVKRGDLLFLIAAVIVIGALVAWAFFGS*
Ga0105246_1146375723300011119Miscanthus RhizosphereVGFNAMQPGKIKKGDIIMLVAAIVVVLALVIWAVR*
Ga0151623_118841223300011264SedimentMGFNAMQPGKIKRSDLVMLLAAVVVVVALVVWATL*
Ga0137426_115080123300011435SoilVGFNAMRPGKTKGADLLYLIAAFVVISALIWWAAS*
Ga0120191_1001040613300012022TerrestrialVGFNAMQPGKVKRADLLYLVAAIVVIVALIVWATR*
Ga0137382_1009488843300012200Vadose Zone SoilMGFNAMQPGKVKRGDLLLLIAAVIVIGALLAWAFFGS*
Ga0137365_1100696533300012201Vadose Zone SoilFNAMQPGKVKRGDLLLLIAAVIVIGLLLAWAFLGT*
Ga0137374_10000406163300012204Vadose Zone SoilMGFNAMQPGKVRKGDIIMLVSAIAVVVGLVIWAIR*
Ga0137374_1009873563300012204Vadose Zone SoilMGFNAMRPGKVKRGDIIMLVSAIVVVAALIVWAVR*
Ga0137374_1091401113300012204Vadose Zone SoilVGFNAMRPGKVKAADLVMLLAAIVVIVALVIWAIR*
Ga0137380_1014492343300012206Vadose Zone SoilMGFNAMQPGKVKRGDLLFLIVALIVIGALIAWAFFGS*
Ga0137380_1054150323300012206Vadose Zone SoilMGFNAMQPGKVKRGDVIMLVAFVVIVGALIAWAVR*
Ga0137376_1031613523300012208Vadose Zone SoilMGFNAMQPGKVKRGDLLFLVAAVIVIGALVAWAFFGS*
Ga0137379_1074862713300012209Vadose Zone SoilVGFNAMQPGKVKKGDLVMLAAAIGVVIALIVWVVR*
Ga0150985_10320303923300012212Avena Fatua RhizosphereMGFNAMQPGKVKRSDLIMLVCAVVVVGALIFWAVH*
Ga0150985_10786230123300012212Avena Fatua RhizosphereMGFNAMQPGKIRKGDIIFFVSGLAVILALVIWAIR*
Ga0137370_1071276733300012285Vadose Zone SoilVGFNAMQPGRIKKGDVVMLVAALVVIVALIVWATR*
Ga0137387_1038111423300012349Vadose Zone SoilMGFNAMQPGEVKRGDLLFLIAAVIVIGLLIAWAFFGS*
Ga0137367_1074396523300012353Vadose Zone SoilVGFNAMGPGKVRAADLVMLVAAIVVIVALVIWAIR*
Ga0137366_1124888623300012354Vadose Zone SoilMGFNAMQPGKVKRGDLLYLLGALIVIGLLLAWAFFGT*
Ga0137369_1012189553300012355Vadose Zone SoilMGFNAMQPGKLKRGDLIMLIAAVVSVAALLIWALR*
Ga0137375_1010565253300012360Vadose Zone SoilVGFNAMQPGKVKRADLVMLIAAIVLIVGALVWALR*
Ga0137375_1073410713300012360Vadose Zone SoilREAEVGFNAMRPGKVKAADLVMLLAAIVVIVALVIWAIR*
Ga0157291_1009473813300012902SoilVGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWAFFG
Ga0153915_1000604383300012931Freshwater WetlandsMGFNAMRPGKIGRGDLLMLVAAIAVVAVLVIWAVR*
Ga0153915_1103045543300012931Freshwater WetlandsMGFNAMQPGKVKKGDLLYLLAAIVIIGSLIVWAVR*
Ga0137410_1069691323300012944Vadose Zone SoilMGFNAMQPGKIKKGDIVMLVAAIAIVLALIVWAVR*
Ga0164300_1070314613300012951SoilVGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFG*
Ga0164303_1001849553300012957SoilMGFNAMQPGKVKRGDLLVLIAAVIVIGALLAWAFFGS*
Ga0164303_1037050913300012957SoilMGFNAMQPGKVKRADLLFLIAAVIVVGALLAWAFFGS*
Ga0153916_1300342723300012964Freshwater WetlandsMGFNAMQPGKVKKGDLLYLLAAIVVIGGLIVWAVR*
Ga0126369_1228480223300012971Tropical Forest SoilMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWALFG*
Ga0164309_1130748323300012984SoilMGFNAMQPGKIKKGDIVMLVAAHVIVIALIVWAVR*
Ga0164308_1147433723300012985SoilMGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFG*
Ga0164308_1159544413300012985SoilMGFNAMQPGKVKRADLLFLIAAVIVVGALLAWAFFGS
Ga0164307_1039741313300012987SoilDVGFNAMQPGKIKRGDLVLLIAAIVVIGALLAWAFFGS*
Ga0157375_1113503033300013308Miscanthus RhizosphereVTVGFNATQPGRIKRGDLWYLVAAIVVIGALVIWAVR*
Ga0120127_1011464423300013503PermafrostVGFNAMQPGKIKKGDIVMLVAAIVVVLALIVWAVR*
Ga0134079_1032092423300014166Grasslands SoilMGFNAMQPGKVKRGDLLFLLAAVIVIGALLAWAFFGS*
Ga0075311_108302723300014259Natural And Restored WetlandsLGFNAMQPGKIKRGDLWFLIAAIVVVAALLAWAFFG*
Ga0075303_101761033300014299Natural And Restored WetlandsVGFNAMQPGRIKRSDLLFLVAAVVVIVALLIWVLAG*
Ga0075351_100632753300014318Natural And Restored WetlandsVGFNAMQPGRIKRADLLYLLAAIAVIGALVWWAVS*
Ga0075351_104839433300014318Natural And Restored WetlandsLGFNAMQPGRIKRADLLYLLGAIVVIGALIWWAVS*
Ga0075351_115722323300014318Natural And Restored WetlandsVGFNAMQPGKIKKADLLYLLAAVVVIGALIAWAVR*
Ga0075353_119194433300014321Natural And Restored WetlandsVGFNAMQPGKIKKADIVMLVAAAVVLVGLIVWAVR*
Ga0075352_122907613300014324Natural And Restored WetlandsVGFNAMQPGKIKKADLLYLLAAIVVIGALIAWAVR*
Ga0075352_124395413300014324Natural And Restored WetlandsVGFNAMQPGRIKRADLLYLLAAIVVIGVLIWWAVS*
Ga0134089_1007943123300015358Grasslands SoilMGFNAMQPGRVKRGDLVYLIVALIVIGLLLAWAFFGT*
Ga0132256_10033402533300015372Arabidopsis RhizosphereMGFNALQPGKIKKGDIVMLVAAIVIVIALIVWAVR*
Ga0132256_10111222313300015372Arabidopsis RhizosphereRRDSAMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFG*
Ga0132256_10254343823300015372Arabidopsis RhizosphereMGFNAMQPGRVKRGDLLFLIAAVLVIGALLAWAFFGS*
Ga0132256_10303576923300015372Arabidopsis RhizosphereMGFNAMQPGKVKKGDLLMLGAAVVVIVLLILWVAL*
Ga0132257_10193865133300015373Arabidopsis RhizosphereGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFG*
Ga0134069_100994433300017654Grasslands SoilVGFNAMRPGKVKAADIAMLVAAILVIVALVIWVIR
Ga0163161_1094379623300017792Switchgrass RhizosphereVGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVR
Ga0163161_1102010513300017792Switchgrass RhizosphereMGFNAMQPGKIKRGDVVFLIAAIVVIGALLAWAFFGS
Ga0187786_1048323223300017944Tropical PeatlandVGFNAMQPGKIKRADLIMLVAAAVVIVALVVWAIH
Ga0187785_10000657123300017947Tropical PeatlandMGFNAMQPGRIKRGDLLFLVAAIVVVGVLLAWAFFGT
Ga0187785_1001519363300017947Tropical PeatlandMGFNAMQPGKIKRGDLIMLVAAAVVIVALIAWAIR
Ga0187776_1023948323300017966Tropical PeatlandVGFNAMQPGKIKRADLIMLVAAAVVIVALVVWAIR
Ga0187776_1033033233300017966Tropical PeatlandMGFNAMQPGRVKRADLLFLVAAVVVIGLLLAWAFFGS
Ga0184605_1000256063300018027Groundwater SedimentVGFNAMQPGKIKRGDLLYLLAAIVVVAGLLVWVVR
Ga0184605_1002224053300018027Groundwater SedimentMGFNAMQPGKVKRGDLLFLIAAVIVIGVLLAWAFFGS
Ga0184605_1010632843300018027Groundwater SedimentVGFNAMQPGKIKKGDIVMLVAALVVIVALIVWATR
Ga0184605_1015331633300018027Groundwater SedimentVGFNAMQPGKIKKGDIVMLVAAIVVVLALIVWAIR
Ga0184608_1000034323300018028Groundwater SedimentMGFNAMQPGKVKRGDLLFLIAAVIVIGALLAWAFFGS
Ga0184634_1000303493300018031Groundwater SedimentMGFNAMQPGKVKRGDILMLVSAIVVIVALVVWAVR
Ga0187788_1002354653300018032Tropical PeatlandVGFNAMQPGKIKRADLIMLVAAAVVILALVVWAIR
Ga0184626_1005831243300018053Groundwater SedimentMGFNAMRPGKVKTADLVMLVAAIVVVVALVIWAVR
Ga0184616_1033522723300018055Groundwater SedimentMGFNAMQPGKVKRGDLLYLLAAVVVIAALIIWALA
Ga0187765_1105781523300018060Tropical PeatlandMGFNAVQPGKIRKGDIIFFVLGLVVILALVIWAIR
Ga0184619_1000631953300018061Groundwater SedimentVGFNAMQPGKIKRGDLLYLLAAIVVVAGLLVWVAR
Ga0184618_1040221523300018071Groundwater SedimentVGFNAMQPGKIKKGDIAMLVAALVVIVALIVWATR
Ga0184624_1003585743300018073Groundwater SedimentVGFNAMQPGRIKRGDLWYLAAAIVAIGLLLAWAFFG
Ga0184640_10000250113300018074Groundwater SedimentMGFNAMQPGKVKRGDILILVSAIVVIVALVVWAVR
Ga0184609_1048748423300018076Groundwater SedimentVGFNAMRPGKVKTADLVMFVAAIVVIVALVIWAIR
Ga0184627_1058355123300018079Groundwater SedimentVGFNAMRPGKTKGADLLYLLAAFVVISALIWWAVS
Ga0187774_1126774713300018089Tropical PeatlandVGFNAMQPGKIKRWDLLYLLAAIVVIGGLILWAVR
Ga0190265_1014854543300018422SoilVGFNTMRPGKVKRADLLYLLAAIVVMVALVVWAVR
Ga0066655_1001155623300018431Grasslands SoilMGFNAMQPGKVKPGDLLFLIVALIVIGALLAWAFFGS
Ga0066667_1042578713300018433Grasslands SoilMGFNAMQPGRVKRGDLVFLIVAVIVIGALVAWAFFGS
Ga0066667_1053983323300018433Grasslands SoilMGFNAMQPGKVKRGDLLFLIVALIVIGALLAWAFFGS
Ga0190269_1188531113300018465SoilVGFNYQQPGKIKRGDWIMLIAAVVVVAALVIWAVR
Ga0190268_1003446823300018466SoilMGFNYQQPGKIKRGDWIMLVAAIVIVAGLVIWAVR
Ga0190268_1007115923300018466SoilMGFNAMQPGKIKRGDLLFLLAAIVIVGALVAWALFGS
Ga0190268_1045540133300018466SoilMGFNYQQPGKIKRGDWIMLVAAILVVGALVIWAVR
Ga0190268_1205723813300018466SoilMGFNAMQPGKIRRDDWIMLGAAVVIILALVIWAIR
Ga0190270_1134994123300018469SoilVGFNAMQPGKIKRGDLLFLLAAIVIVVALVVWALSA
Ga0190270_1214920923300018469SoilVGFNAMQPGKVKRGDLLFLLAAIVVVVALVVWALTA
Ga0190274_1133271613300018476SoilMGFNAMQPGKTKRADYIMLGAAFVVVLALVIWAIR
Ga0066669_1020513023300018482Grasslands SoilMGFNAMQPGKVKRGDLLFLIAAVIVIGLLVAWALFGS
Ga0066669_1043752013300018482Grasslands SoilMGFNAMRPGKVKRGDLLMLLAAVVIVAGLVFWAVH
Ga0066669_1086857033300018482Grasslands SoilMGFNAMQPGKVKRGDLLFLIVALIVIGALVAWAFFGS
Ga0066669_1121456923300018482Grasslands SoilMGFNAMQPGKIRKGDIIFFVSGLAVILALVIWAIR
Ga0173481_1001883733300019356SoilMGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGL
Ga0173481_1050767023300019356SoilVGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWAFFGS
Ga0173481_1074754923300019356SoilVGFNAMQPGRIKRGDILYLVAAIVVIVALVVWAIR
Ga0173479_1017207133300019362SoilGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG
Ga0173479_1056078833300019362SoilVGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFG
Ga0206227_111773423300021063Deep Subsurface SedimentVGFNAMRPGKIKGADLVYLLAALVVIAGLIWWAVS
Ga0210381_1028276533300021078Groundwater SedimentMGFNAMQPGKIKKGDIIMLVAAIAVVLALIVWAVR
Ga0210380_1017890923300021082Groundwater SedimentMGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG
Ga0196959_1002402933300021184SoilMGFNAMQPGRIKRGDLVYLAAAIVVIVALVVWAVG
Ga0196959_1010812923300021184SoilVGFNAMQPGRIKRGDLLYLAAAIVVIVALVVWAVG
Ga0210351_134706113300021316EstuarineMGFNAKQPGKIKRADIIMLGAFIVVTVALLLWALKG
Ga0210341_171651823300021337EstuarineMGFNAKQPGKIKRADLIMLGAFIVVTVALLLWALKG
Ga0193694_100333223300021415SoilVGFNAMQPGKVKRGDLLFLIAAVIVIGALLAWAFFGS
Ga0193695_102633913300021418SoilMGFNAMQPGKVKRGDLLFLIAAVIVIGVLVAWAFFGS
Ga0224500_1008648223300022213SedimentMGFNAKQPGKIKRADLIMLGAFVVVAAALLLWALRG
Ga0212093_1001375453300022554Hot Spring SedimentMGFNAMRPGKVKRGDLLYLAAALIVMAALVIWAVR
Ga0222622_1090763033300022756Groundwater SedimentVGFNYQQPGKIKRGDWIMLIVAAVVVAGLVIWAVR
Ga0247789_108489413300023266SoilMGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFG
Ga0247672_106959533300024187SoilMGFNAMQPGKIKKGDLIFFISGLVVILGLVIWAIR
Ga0209619_1018187733300025159SoilVGFNAMQPGKVKRGDLLYLLAAVIVIGVLIAWALS
Ga0209619_1040765333300025159SoilMGFNAMQPGKIKRGDLLYLLSAIVVVVGLIVWAVR
Ga0209109_1032414223300025160SoilVGFNAMRPGKIKRADLLYLLAALLVIVGLVVWAVW
Ga0209521_1004593533300025164SoilVGFNAMQPGKVKRGDLVYLLAAVIVIGVLIAWALS
Ga0209642_1078107623300025167SoilMGFNAMQPGRIKPADLLYLLAAVVVIGGLIWWAVS
Ga0209172_10002773303300025310Hot Spring SedimentMGFNAMQPGKVKRGDLLYLLAALIVIVGLVVWAVR
Ga0209172_1000897543300025310Hot Spring SedimentVGFNAMQPGKIKRGDLLYLAAGILVIVALVLWAIL
Ga0209172_1012994143300025310Hot Spring SedimentMGFNAMQPGKVKRGDLLYLLAAVIVIVGMIVWAVR
Ga0209431_1013757023300025313SoilMGFNAMQPGKIKRGDVLFLVAAALVIGALLAWAFFGS
Ga0209641_1031423933300025322SoilMGFNAMQPGKIKPADLLYLLAAIVVIGGLIWWAVS
Ga0209641_1082762913300025322SoilMGFNAMQPGKLKPADLLYLTAAIVVIAALIWWAVS
Ga0209751_1088711433300025327SoilMGFNAMQPGKIKKSDLLYLAAAVVIILGLVIWAVA
Ga0210083_100497353300025521Natural And Restored WetlandsSEGDTVGFNAMQPGKIKKGDVVMLIAAVVVVLALVIWAVR
Ga0210061_100406243300025537Natural And Restored WetlandsMGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAVR
Ga0210094_101364443300025549Natural And Restored WetlandsMGFNAMQPGKIKPADLLYLLAAVVVIAGLIWWAAS
Ga0207653_1018695623300025885Corn, Switchgrass And Miscanthus RhizosphereMGFNAMQPGKIKRGDVIFLIAAIVVIGALLAWAFFGS
Ga0207642_1002842533300025899Miscanthus RhizosphereVGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWALFGS
Ga0207642_1003323143300025899Miscanthus RhizosphereMGFNAMQPGKVKRADLLFLIAAMIVVGALLAWAFFGS
Ga0207684_1023164243300025910Corn, Switchgrass And Miscanthus RhizosphereMGFNAMQPGKVKRGDLLYLVVALIVIGLLVAWAFFGT
Ga0207652_1176144433300025921Corn RhizosphereVGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG
Ga0207646_1085538113300025922Corn, Switchgrass And Miscanthus RhizosphereMGFNAMQPGKVKRGDLLYLVVALIVIGLLLAWAFFGT
Ga0207646_1089713533300025922Corn, Switchgrass And Miscanthus RhizosphereMGFNYQQPGKIKRADWIMLIVAAVAIAGLIVWAAR
Ga0207690_1074644033300025932Corn RhizosphereVTVGFNAMQPGRIKRGDLWYLVAAIVVIGALVIWAVR
Ga0207686_1008621833300025934Miscanthus RhizosphereMGFNAMQPGKVKRADLIMLICAIVVVGALIFWAVH
Ga0207670_1024015923300025936Switchgrass RhizosphereVGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVH
Ga0207669_1195142423300025937Miscanthus RhizosphereSPSSGRTSSRRGNDVGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFG
Ga0207665_1008733353300025939Corn, Switchgrass And Miscanthus RhizosphereVGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGL
Ga0207679_1028994033300025945Corn RhizosphereVGFNAMQPGRIKRGDLWYLVAAIVVIGALVIWAVR
Ga0207651_1077548733300025960Switchgrass RhizosphereVGFNYQQPGKIKRGDWIMLIAAVVVVVGLVIWAVR
Ga0210102_113924123300025971Natural And Restored WetlandsVGFNAMQPGKIKGADLLYLLAAVVVIAGLIWWAVS
Ga0208415_100929333300025993Rice Paddy SoilMGFNAMQPGKIKRGDIVMLVAAIVVVLALIVWAAR
Ga0207677_1180208523300026023Miscanthus RhizosphereMGFNAMRPGKIKRGDVIFLIAAIVVIGALLAWAFFGS
Ga0207708_1077466033300026075Corn, Switchgrass And Miscanthus RhizosphereHVGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWALFGS
Ga0207702_1134547933300026078Corn RhizosphereMGFNAMQPGKIKRGDLIFLIAAIVVIGALLAWAFFGS
Ga0207648_1167134023300026089Miscanthus RhizosphereVGFNAMQPGKIKRGDLVLLIAAIVVIGALLAWAFFG
Ga0207676_1091065533300026095Switchgrass RhizosphereIVGFNAMQPGKIKKGDIVMLVAAIVVVLALVIWAVR
Ga0207683_1033009113300026121Miscanthus RhizosphereGSEGDGVGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVR
Ga0256821_102056233300026452SedimentVGFNAMQPGRIKRGDLLFLIAGIVVIGALLAWALFG
Ga0209058_126357923300026536SoilMGFNAMQPGRVKRGDLVYLIVALIVIGLLLAWAFFGT
Ga0209805_111605633300026542SoilMGFNAMQPGRVKRGDLVFLIVAVVVIGALVAWAFFGS
Ga0209474_1030333423300026550SoilLGFNAMRPGRVKGADLLMLLAAIVIVGALVFWAVR
Ga0209577_1047679633300026552SoilMGFNAMRPGRVKGADLLMLLAAIVIVGALVFWAVR
Ga0207454_10260823300026746SoilVGFNAMQPGKIKRGDLLFLLAAIVIVGALLAWAFLGS
Ga0207587_10234623300026747SoilMGFNAMQPGKVKRGDLLFLIAAVIVVGALLAWAFFGS
Ga0209884_102801013300027013Groundwater SandEAEVGFNAMRPGKVKAADLVMLVAAIVVIVALVIWAIR
Ga0209877_101652433300027032Groundwater SandMGFNAMQPGKVKRADILMLVSAIVVIVALVVWAVR
Ga0209387_109880343300027639Agricultural SoilVGFNTMRPGKVKRGDLLYLIAAIVVIAALVIWAVR
Ga0214468_103530343300027647SoilVGFNTMRPGKVKRGDLLYLVAAIVVMVALVVWAVR
Ga0209286_103535753300027713Freshwater SedimentVGFNAMQPGKVKRGDLVYLIAAIVVIGALVAWALS
Ga0209689_137596133300027748SoilMGFNAMRPGRVRRGDLIMLLAAIVIVAALVYWAVH
(restricted) Ga0233416_1001274453300027799SedimentVGFNAMQPGKIKRADLLYLLAAIVVIGGLIVWAIR
(restricted) Ga0233416_1002218823300027799SedimentVGFNAMQPGKIKRGDLLYLLAAVIVIVALVVWAVS
Ga0209706_1004552213300027818Freshwater SedimentVGFNAMQPGKVKRGDLLYLLAAIVVIVGLVVWAVR
Ga0209023_1007640253300027870Freshwater And SedimentVGFNAMQPGKIKRGDLIMLVVAVVVVVALILWAIG
Ga0209590_1023265913300027882Vadose Zone SoilMGFNAMQPGKVKRGDLLLLIVALIVIGALVAWAFFGS
Ga0209590_1047076623300027882Vadose Zone SoilMGFNSMQPGKVKRGDLIMLAAALAVLVALVVWAVR
Ga0209069_1018985823300027915WatershedsVGFNAMQPGKIKKGDVIMLVAAVVVFAALIVWAVR
Ga0209705_1014739933300027979Freshwater SedimentVGFNAMQPGKVKRGDLVFLIAAIVVIGALVAWALS
Ga0268265_1231730123300028380Switchgrass RhizosphereMGFNAMQPGRIKRGDVIFLIAAIVVIGALLAWAFFGL
Ga0247818_1114090023300028589SoilMGFNAMQPGKVKRGDLLVLIAAVIVIGALLAWAFFGS
Ga0307285_1014499313300028712SoilRAMGFNAMQPGKIKRGDLLFLLAAVIVIGALLLWAFFG
Ga0307298_1006647743300028717SoilVGFNYQQPGKIKRGDWIMLIVAVVVVAGLVIWAVR
Ga0307318_1007700243300028744SoilMGFNAMQPGKIKRGDLLFLAGAIVIVGALVAWALFGS
Ga0307318_1024260433300028744SoilMGFNYRQPGSIKRGDWIMLIAAAVILAALVIWAVR
Ga0307320_1021141333300028771SoilVGFNAMQPGKIKRGDLLLLLAAIVVVGALLAWAFFGS
Ga0307306_1002926723300028782SoilVGFNAMQPGKVKRGDLIFLIAAVVVIGALLAWAFFG
Ga0307282_1007984843300028784SoilVGFNAMQPGKIKKGDIVMLVAALVVIVALLVWATR
Ga0307282_1060772413300028784SoilMGFNAMQPGKVKRGDLLFLFAAVIVIGVLVAWAFFGS
Ga0307299_1039308423300028793SoilVGFNAMQPGKIKRGDVIMLAAAVVVIVGLVVWAIR
Ga0307503_1016754923300028802SoilMGFNAMQPGKIKRGDLLYLLAAVIVIGALLLWAFLG
Ga0307503_1018852123300028802SoilMGFNAMQPGKIKRGDLWFLLAAVIVIGALLLWAFFG
Ga0307503_1038682033300028802SoilMGFNAMQPGKIKKGDIVMLVAAIVIVLALVVWAVR
Ga0307503_1049697113300028802SoilPARSAATTGSEGDGVGFNAMQPGKIKRGDIIMLVAAIIIVLALVIWAVR
Ga0307503_1051190033300028802SoilVGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVR
Ga0307503_1073266623300028802SoilMGFNYQQPGKIKRGDWIMLIAAIVVLAALVIWAVR
Ga0307281_1029283433300028803SoilVGFNAMQPGKIKKGDIVMLVAAVVVVLALIVWAAH
Ga0307305_1047875623300028807SoilMGFNAMQPGKVKKGDLVMLGAAIIVAIALVVWIIR
Ga0307302_1026492833300028814SoilVGFNAMQPGRIKKGDIVMLVAAIVVIVALIVWATR
Ga0307296_1029993823300028819SoilVGFNAMQPGKIKRGDVIMLVAAVVVIVGLVVWAIR
Ga0307310_1006498823300028824SoilMGFNYQQPGKIKRADWIMLIAAAVVIAGLIVWATR
Ga0307286_1021085633300028876SoilMGFNAMQPGKIKKGDIVMLIAAVVVVLALVIWAVR
Ga0307286_1039755013300028876SoilVGFNAMQPGRIKRGDLWYLLAAIVAIGLLLAWAFFG
Ga0307300_1017938823300028880SoilMGFNAMQPGKIKRGDLIFLIAAIVVVGALLAWACFGL
Ga0307277_1043113623300028881SoilMGFNAMQPGKVKRGDLVYLIAAVIVIGALLAWAFFGS
Ga0272449_103979043300029977SedimentMGFNAMRPGKVKRGDLLYLAAALVVMAALVIWAVR
Ga0299907_10000016503300030006SoilVGFNAMQPGKVKRADLLYLVAAIVVIVVLIVWATR
Ga0299907_1006399423300030006SoilVGFNAMQPGKIKRGDIVMLVSALALIAGALVWALR
Ga0299907_1104121423300030006SoilVGFNAMQPGKIKRGDILMLLAAIVVIVALVAWALQ
Ga0247826_1015637443300030336SoilMGFNAMQPGKVKRGDLLLLIAAVIVIGALLVWAFFGS
Ga0247826_1041588233300030336SoilMGFNAMQPGRIKRGDLWYLVAAIVAIGLLLAWAFFG
Ga0299915_1015676823300030613SoilMGFNAMRPGKVRKGDLLYLLAAVVVIGALIVWAMS
Ga0299915_1048714323300030613SoilMGFNAMQPGKVKKGDLLYLLAAIIVIGALIVWALS
Ga0268386_1033999233300030619SoilVGFNAMQPGKMKRADLLYLLAAVVVIVGLVVWAVS
Ga0302046_1126124733300030620SoilMGFNAMQPGKIKKSDLLYLAAAVVVIVGLVIWAVA
Ga0308197_1019045033300031093SoilVGFNAMQPGKVKRGDLLFLIAAVIVIGVLLAWAFFGS
Ga0307498_1012700733300031170SoilPRLRVRMGFNAMQPGKFKKGDIVMLVAAIVIVIALIVWAVR
Ga0307498_1048036713300031170SoilVGFNYQQPGKIKRGDWIMLIAAAVVVAGLVIWAVR
Ga0307495_1017051213300031199SoilMGFNAMQPGKIKRGDLLYLLAAVIVIGALLLWAFFG
Ga0307506_1004141033300031366SoilVGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFGS
Ga0307506_1011868923300031366SoilMGFNAMQPGKIKRGDVLFLLAAVIVIGALLAWAFLG
Ga0308194_1011607033300031421SoilMGFNAMQPGKVKRGDMLFLIAAVIVIGVLLAWAFFGS
Ga0307505_1014467023300031455SoilVGFNAMQPGKIKRGDIIMLVAAIVVVLALVIWAVR
Ga0307408_10122188723300031548RhizosphereVGFNAMQPGRIKRGDLLMLVAAIVIVGALVAWALFGS
Ga0247727_10003705253300031576BiofilmMGFNAMQPGKVKKGDLVFLVVAIVVIGALLAWAVFG
Ga0247727_1002784483300031576BiofilmVGFNAKRPGRVKRADLLYLGAAIVVIGALLIWALAG
Ga0307469_1091174533300031720Hardwood Forest SoilMGFNAMQPGKVKRGDLLYLVVALIVIGLLLAWAFFGS
Ga0307469_1205945813300031720Hardwood Forest SoilMGFNAMQPGRIKRGDLLFLLAAIVVVGALLAWAFFGT
Ga0307468_10215387723300031740Hardwood Forest SoilGLLPRLRVRMGFNAMQPGKIKKGDIVMLVAAIAIVVALIVWAVR
Ga0315290_1017831333300031834SedimentMGFNAMQPGKIKRGDLLFLLAALVVIGGLLAWAFFG
Ga0315297_1035801333300031873SedimentMGFNAMQPGKIKRGDLLFLLAAIVVIGGLLAWAFFG
Ga0310900_1040684943300031908SoilVGFNAMQPGKIKRGDIVMLVAAIVVVLALVIWAVH
Ga0214473_1001315763300031949SoilVGFNAMQPGKIKRGDLLMLIAALVVIGALVAWAMFAS
Ga0214473_1008956753300031949SoilVGFNAMQPGRIKRGDMLFLIAAIVVIGALLAWALFG
Ga0214473_1010247633300031949SoilMGFNARQPGKVKRGDLLYLAAGLIVITALLIWALTG
Ga0214473_1010349253300031949SoilMGFNAMQPGKIKPADLLYLLAAIVVIGGLIWWAAS
Ga0214473_1017568633300031949SoilMGFNAMQPGKIKRADVLYLLAAVVVIGALIWWAVS
Ga0214473_1017662253300031949SoilVGFNAMRPGKIKGADLLYLLAALVVIAALIWWAVS
Ga0214473_1058061533300031949SoilMGFNAMRPGKVKKGDLLYLLAAVIVIGALIVWALS
Ga0214473_1061624843300031949SoilVGFNAMRPGKVRKGDLVFLGAAAVAIAALLLWAFWG
Ga0214473_1064773943300031949SoilVGFNAMQPGKVKRGDLLYLLAAVIVIGALIAWALS
Ga0214473_1170881833300031949SoilVGFNAMQPGKIKRADLLYLLAAVVVIGALIWWAVSL
Ga0214473_1195745833300031949SoilMGFNAMQPGKLKPADLLYLAAAIVVVAALIWWAVS
Ga0214473_1216370913300031949SoilMGFNAMQPGKVKRADILMLVSAIVVIVALVVWAIR
Ga0326597_1014246023300031965SoilMGFNAMQPGKIKKSDLLYLAAAVVVIVGLVIWAIA
Ga0326597_1055684633300031965SoilMGFNAMQPGKIKRADLLYLLAAVVVIGGLIWWAVS
Ga0326597_1090479433300031965SoilVGFNAMQPGKIKRGDLIMLVIAVAVVVALILWAVG
Ga0326597_1154532123300031965SoilVGFNAMRPGKVKTADLVMLVAAIVVIVALVIWATR
Ga0326597_1201756113300031965SoilDGLTMGFNAMQPGKIKRADVLYLLAAVVVIGALIWWAVS
Ga0307415_10062320813300032126RhizosphereGVGFNAMQPGRIKRGDLLMLVAAIVIVGALVAWALFGS
Ga0315281_1031891333300032163SedimentMGFNAMQPGKIKRGDLLFLVAALLVIAALVIWALAG
Ga0307470_1123907523300032174Hardwood Forest SoilMGFNAMQPGKIKRGDLVFLIAAIVVIGALLAWAFFGS
Ga0315276_1038290953300032177SedimentVGFNAMQPGKVRKGDLLYLVAAIVVIGALIAWAVH
Ga0315271_1013681023300032256SedimentVGFNYQQPGKIKKADWVMLISALVIVVALVVWAMS
Ga0315273_1165552523300032516SedimentVGFNAMQPGKTKRGDMLFLAAAVIVVGLLLAWAFFG
Ga0335085_10020709103300032770SoilMGFNAMQPGRIKRSDLLFLVAAIVVVGVLLAWAFFGT
Ga0335084_1014250363300033004SoilVGFNAMQPGKIKRADLIMLAAAAVVIVALIVWAVR
Ga0335084_1176917823300033004SoilVGFNAMQPGRIKRGDLLYLLAAIVVIVGLLAWALR
Ga0334722_1008758423300033233SedimentMGFNAMQPGKIKKADIAMLVAAVVVIVALIAWAAH
Ga0334722_1096073333300033233SedimentVGFNAMQPGRIKGADLLYLLAAVVVIGALLWWATS
Ga0214472_1018365743300033407SoilVGFNTMRPGKVKRGDLLYLAAAIVVLAALVIWAVR
Ga0316622_10071946543300033416SoilVTVGFNAMRPGKVRRGDLLYLLAAAVVIGGLIIWAAR
Ga0326726_1004362733300033433Peat SoilMGFNAMQPGRIKRADLLYLVAAVVVIGALLAWAFFGR
Ga0326726_1022491743300033433Peat SoilMGFNAMQPGKIKKGDIVMLVAAIVIVAALIVWAVR
Ga0316626_1063221643300033485SoilWSGSPDRRRRPVGFNAMQPGKIKKGDLVFLVAAIVVTGALLAWALFG
Ga0299912_1032548123300033489SoilMGFNAMRPGKVRKGDLLYLLAAVVVIGVLIVWALS
Ga0316616_10259227623300033521SoilMTMGFNAMQPGKIKKGDLLYLLAAVVVIGGLIVWAVR
Ga0247830_1160812033300033551SoilVGFNAMQPGKIKKGDIVMLVAAVVVVLALVIWAVR
Ga0373902_083683_329_4363300034099Sediment SlurryVGFNAMQPGKIKRGDLLYLIAAIVVIGALLVWAIR
Ga0370498_002791_2857_29643300034155Untreated Peat SoilVGFNAMQPGKVKKGDLIMLGAAVVVIVLLILWVAL
Ga0364931_0182529_242_3493300034176SedimentVGFNAMRPGKTKGADLLYLLAAFVVISALIWWAAS
Ga0364932_0374826_70_1773300034177SedimentMGFNAMRPGKVKTADLVMLMAAIVVVVALVIWAIR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.