Metagenome Family F005049

Basic Information
Family ID	F005049
Family Type	Metagenome
Number of Sequences	413
Average Sequence Length	40 residues
Representative Sequence	VPSAQKSFWTHSMVPLGDEAQVEARFGPFGDSANLDAR
Number of Associated Samples	90
Number of Associated Scaffolds	412

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	17.45 %
% of genes near scaffold ends (potentially truncated)	79.90 %
% of genes from short scaffolds (< 2000 bps)	86.68 %
Associated GOLD sequencing projects	86
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.20

Most Common Taxonomy
Group	Unclassified (99.516 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (85.472 % of family members)
Environment Ontology (ENVO)	Unclassified (90.557 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (86.925 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.55% β-sheet: 0.00% Coil/Unstructured: 95.45%
Feature Viewer

Powered by Feature Viewer

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
All Organisms	root	All Organisms	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
cellular organisms	root	All Organisms → cellular organisms	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	0.24 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.24 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.24 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.24 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.24 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.52 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.24 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.24 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_101454910	Not Available	607	Open in IMG/M
3300005334\|Ga0068869_101548156	Not Available	589	Open in IMG/M
3300005334\|Ga0068869_101626326	Not Available	575	Open in IMG/M
3300005334\|Ga0068869_101722692	Not Available	560	Open in IMG/M
3300005338\|Ga0068868_100578747	Not Available	992	Open in IMG/M
3300005338\|Ga0068868_101009359	Not Available	762	Open in IMG/M
3300005459\|Ga0068867_101004768	Not Available	756	Open in IMG/M
3300005459\|Ga0068867_101168347	Not Available	705	Open in IMG/M
3300005459\|Ga0068867_102048508	Not Available	541	Open in IMG/M
3300005718\|Ga0068866_10753581	Not Available	673	Open in IMG/M
3300005718\|Ga0068866_11181105	Not Available	551	Open in IMG/M
3300005718\|Ga0068866_11434553	Not Available	506	Open in IMG/M
3300005840\|Ga0068870_10753216	Not Available	676	Open in IMG/M
3300005840\|Ga0068870_10987870	Not Available	599	Open in IMG/M
3300005840\|Ga0068870_11129304	Not Available	565	Open in IMG/M
3300005840\|Ga0068870_11198998	Not Available	549	Open in IMG/M
3300006881\|Ga0068865_100279548	Not Available	1328	Open in IMG/M
3300006881\|Ga0068865_100606782	Not Available	925	Open in IMG/M
3300006881\|Ga0068865_101149303	Not Available	686	Open in IMG/M
3300006881\|Ga0068865_101933571	Not Available	535	Open in IMG/M
3300009148\|Ga0105243_12565887	Not Available	549	Open in IMG/M
3300011119\|Ga0105246_12438055	Not Available	514	Open in IMG/M
3300013296\|Ga0157374_10922550	Not Available	891	Open in IMG/M
3300013296\|Ga0157374_12915489	Not Available	505	Open in IMG/M
3300013297\|Ga0157378_10994731	Not Available	873	Open in IMG/M
3300013297\|Ga0157378_12297601	Not Available	591	Open in IMG/M
3300013297\|Ga0157378_12951598	Not Available	527	Open in IMG/M
3300013308\|Ga0157375_12587144	Not Available	606	Open in IMG/M
3300014486\|Ga0182004_10021538	Not Available	4809	Open in IMG/M
3300014486\|Ga0182004_10021538	Not Available	4809	Open in IMG/M
3300014486\|Ga0182004_10145660	Not Available	902	Open in IMG/M
3300014486\|Ga0182004_10260689	Not Available	557	Open in IMG/M
3300014486\|Ga0182004_10302265	Not Available	500	Open in IMG/M
3300015267\|Ga0182122_1007369	Not Available	931	Open in IMG/M
3300015267\|Ga0182122_1009731	Not Available	864	Open in IMG/M
3300015267\|Ga0182122_1039809	Not Available	595	Open in IMG/M
3300015267\|Ga0182122_1046617	Not Available	570	Open in IMG/M
3300015267\|Ga0182122_1056991	Not Available	538	Open in IMG/M
3300015267\|Ga0182122_1064395	Not Available	520	Open in IMG/M
3300015268\|Ga0182154_1003906	Not Available	1106	Open in IMG/M
3300015268\|Ga0182154_1006207	Not Available	976	Open in IMG/M
3300015268\|Ga0182154_1046239	Not Available	575	Open in IMG/M
3300015268\|Ga0182154_1051462	Not Available	558	Open in IMG/M
3300015269\|Ga0182113_1019232	Not Available	808	Open in IMG/M
3300015269\|Ga0182113_1051281	Not Available	612	Open in IMG/M
3300015269\|Ga0182113_1060641	Not Available	582	Open in IMG/M
3300015269\|Ga0182113_1060760	Not Available	582	Open in IMG/M
3300015269\|Ga0182113_1079150	Not Available	536	Open in IMG/M
3300015269\|Ga0182113_1087279	Not Available	520	Open in IMG/M
3300015269\|Ga0182113_1087695	Not Available	519	Open in IMG/M
3300015269\|Ga0182113_1097144	Not Available	502	Open in IMG/M
3300015274\|Ga0182188_1008098	Not Available	848	Open in IMG/M
3300015274\|Ga0182188_1040593	Not Available	564	Open in IMG/M
3300015274\|Ga0182188_1062407	Not Available	502	Open in IMG/M
3300015275\|Ga0182172_1002208	Not Available	1334	Open in IMG/M
3300015275\|Ga0182172_1005627	Not Available	1027	Open in IMG/M
3300015275\|Ga0182172_1062389	Not Available	535	Open in IMG/M
3300015275\|Ga0182172_1063985	Not Available	531	Open in IMG/M
3300015275\|Ga0182172_1074909	Not Available	506	Open in IMG/M
3300015275\|Ga0182172_1075650	Not Available	504	Open in IMG/M
3300015276\|Ga0182170_1007848	Not Available	944	Open in IMG/M
3300015276\|Ga0182170_1029773	Not Available	662	Open in IMG/M
3300015276\|Ga0182170_1061286	Not Available	540	Open in IMG/M
3300015277\|Ga0182128_1019473	Not Available	746	Open in IMG/M
3300015277\|Ga0182128_1025386	Not Available	695	Open in IMG/M
3300015279\|Ga0182174_1006570	Not Available	1028	Open in IMG/M
3300015279\|Ga0182174_1035691	Not Available	651	Open in IMG/M
3300015281\|Ga0182160_1012659	Not Available	850	Open in IMG/M
3300015281\|Ga0182160_1025007	Not Available	708	Open in IMG/M
3300015281\|Ga0182160_1033358	Not Available	654	Open in IMG/M
3300015281\|Ga0182160_1042782	Not Available	612	Open in IMG/M
3300015282\|Ga0182124_1003736	Not Available	1175	Open in IMG/M
3300015282\|Ga0182124_1008571	Not Available	937	Open in IMG/M
3300015282\|Ga0182124_1019547	Not Available	751	Open in IMG/M
3300015282\|Ga0182124_1046561	Not Available	595	Open in IMG/M
3300015282\|Ga0182124_1055271	Not Available	566	Open in IMG/M
3300015283\|Ga0182156_1009141	Not Available	952	Open in IMG/M
3300015283\|Ga0182156_1069404	Not Available	540	Open in IMG/M
3300015283\|Ga0182156_1070541	Not Available	538	Open in IMG/M
3300015285\|Ga0182186_1009848	Not Available	924	Open in IMG/M
3300015285\|Ga0182186_1033190	Not Available	657	Open in IMG/M
3300015285\|Ga0182186_1035125	Not Available	647	Open in IMG/M
3300015285\|Ga0182186_1035168	Not Available	646	Open in IMG/M
3300015285\|Ga0182186_1051383	Not Available	580	Open in IMG/M
3300015285\|Ga0182186_1057245	Not Available	562	Open in IMG/M
3300015285\|Ga0182186_1058545	Not Available	559	Open in IMG/M
3300015285\|Ga0182186_1066579	Not Available	537	Open in IMG/M
3300015285\|Ga0182186_1081509	Not Available	506	Open in IMG/M
3300015285\|Ga0182186_1082857	Not Available	503	Open in IMG/M
3300015286\|Ga0182176_1004790	Not Available	1347	Open in IMG/M
3300015286\|Ga0182176_1012186	Not Available	937	Open in IMG/M
3300015286\|Ga0182176_1021965	Not Available	769	Open in IMG/M
3300015286\|Ga0182176_1028248	Not Available	711	Open in IMG/M
3300015286\|Ga0182176_1036783	Not Available	656	Open in IMG/M
3300015286\|Ga0182176_1085795	Not Available	501	Open in IMG/M
3300015287\|Ga0182171_1013281	Not Available	855	Open in IMG/M
3300015287\|Ga0182171_1032754	Not Available	671	Open in IMG/M
3300015287\|Ga0182171_1053379	Not Available	585	Open in IMG/M
3300015287\|Ga0182171_1069231	Not Available	542	Open in IMG/M
3300015287\|Ga0182171_1079315	Not Available	520	Open in IMG/M
3300015287\|Ga0182171_1081970	Not Available	515	Open in IMG/M
3300015288\|Ga0182173_1044065	Not Available	612	Open in IMG/M
3300015288\|Ga0182173_1064905	Not Available	548	Open in IMG/M
3300015288\|Ga0182173_1077327	Not Available	520	Open in IMG/M
3300015289\|Ga0182138_1030353	Not Available	686	Open in IMG/M
3300015291\|Ga0182125_1006016	Not Available	1084	Open in IMG/M
3300015291\|Ga0182125_1017100	Not Available	819	Open in IMG/M
3300015291\|Ga0182125_1028761	Not Available	711	Open in IMG/M
3300015291\|Ga0182125_1062872	Not Available	569	Open in IMG/M
3300015291\|Ga0182125_1087075	Not Available	516	Open in IMG/M
3300015292\|Ga0182141_1022465	Not Available	759	Open in IMG/M
3300015292\|Ga0182141_1024595	Not Available	741	Open in IMG/M
3300015292\|Ga0182141_1056217	Not Available	587	Open in IMG/M
3300015292\|Ga0182141_1056939	Not Available	585	Open in IMG/M
3300015294\|Ga0182126_1040044	Not Available	651	Open in IMG/M
3300015294\|Ga0182126_1061177	Not Available	576	Open in IMG/M
3300015295\|Ga0182175_1042902	Not Available	645	Open in IMG/M
3300015295\|Ga0182175_1080686	Not Available	535	Open in IMG/M
3300015296\|Ga0182157_1038595	Not Available	674	Open in IMG/M
3300015296\|Ga0182157_1069503	Not Available	568	Open in IMG/M
3300015296\|Ga0182157_1092301	Not Available	521	Open in IMG/M
3300015296\|Ga0182157_1099889	Not Available	508	Open in IMG/M
3300015298\|Ga0182106_1012763	Not Available	927	Open in IMG/M
3300015298\|Ga0182106_1077513	Not Available	549	Open in IMG/M
3300015298\|Ga0182106_1079374	Not Available	545	Open in IMG/M
3300015298\|Ga0182106_1099989	Not Available	507	Open in IMG/M
3300015299\|Ga0182107_1030317	Not Available	727	Open in IMG/M
3300015299\|Ga0182107_1033796	Not Available	705	Open in IMG/M
3300015299\|Ga0182107_1069414	Not Available	571	Open in IMG/M
3300015299\|Ga0182107_1076091	Not Available	555	Open in IMG/M
3300015299\|Ga0182107_1077645	Not Available	552	Open in IMG/M
3300015299\|Ga0182107_1097107	Not Available	514	Open in IMG/M
3300015300\|Ga0182108_1018293	Not Available	845	Open in IMG/M
3300015300\|Ga0182108_1021582	Not Available	806	Open in IMG/M
3300015300\|Ga0182108_1033506	Not Available	712	Open in IMG/M
3300015300\|Ga0182108_1049455	Not Available	636	Open in IMG/M
3300015300\|Ga0182108_1073424	Not Available	565	Open in IMG/M
3300015302\|Ga0182143_1034170	Not Available	701	Open in IMG/M
3300015302\|Ga0182143_1066127	Not Available	579	Open in IMG/M
3300015303\|Ga0182123_1061809	Not Available	578	Open in IMG/M
3300015303\|Ga0182123_1062388	Not Available	576	Open in IMG/M
3300015303\|Ga0182123_1093498	Not Available	511	Open in IMG/M
3300015304\|Ga0182112_1022939	Not Available	787	Open in IMG/M
3300015304\|Ga0182112_1063543	Not Available	588	Open in IMG/M
3300015304\|Ga0182112_1071352	Not Available	568	Open in IMG/M
3300015304\|Ga0182112_1095528	Not Available	519	Open in IMG/M
3300015305\|Ga0182158_1010880	Not Available	959	Open in IMG/M
3300015305\|Ga0182158_1059762	Not Available	596	Open in IMG/M
3300015305\|Ga0182158_1076426	Not Available	554	Open in IMG/M
3300015305\|Ga0182158_1079554	Not Available	547	Open in IMG/M
3300015305\|Ga0182158_1079927	Not Available	546	Open in IMG/M
3300015305\|Ga0182158_1090717	Not Available	525	Open in IMG/M
3300015305\|Ga0182158_1095370	Not Available	517	Open in IMG/M
3300015307\|Ga0182144_1025883	Not Available	769	Open in IMG/M
3300015307\|Ga0182144_1066350	Not Available	586	Open in IMG/M
3300015307\|Ga0182144_1068136	Not Available	581	Open in IMG/M
3300015308\|Ga0182142_1013480	Not Available	943	Open in IMG/M
3300015308\|Ga0182142_1014351	Not Available	927	Open in IMG/M
3300015308\|Ga0182142_1015025	Not Available	915	Open in IMG/M
3300015308\|Ga0182142_1039713	Not Available	694	Open in IMG/M
3300015308\|Ga0182142_1050925	Not Available	646	Open in IMG/M
3300015308\|Ga0182142_1108296	Not Available	513	Open in IMG/M
3300015314\|Ga0182140_1020960	Not Available	833	Open in IMG/M
3300015314\|Ga0182140_1086908	Not Available	551	Open in IMG/M
3300015321\|Ga0182127_1015789	Not Available	934	Open in IMG/M
3300015321\|Ga0182127_1055512	Not Available	649	Open in IMG/M
3300015321\|Ga0182127_1092433	Not Available	554	Open in IMG/M
3300015321\|Ga0182127_1093878	Not Available	551	Open in IMG/M
3300015321\|Ga0182127_1099177	Not Available	541	Open in IMG/M
3300015321\|Ga0182127_1112955	Not Available	519	Open in IMG/M
3300015322\|Ga0182110_1026496	Not Available	803	Open in IMG/M
3300015322\|Ga0182110_1087277	Not Available	563	Open in IMG/M
3300015322\|Ga0182110_1099155	Not Available	541	Open in IMG/M
3300015323\|Ga0182129_1010799	Not Available	1004	Open in IMG/M
3300015323\|Ga0182129_1039711	Not Available	693	Open in IMG/M
3300015323\|Ga0182129_1080491	Not Available	563	Open in IMG/M
3300015323\|Ga0182129_1092870	Not Available	539	Open in IMG/M
3300015323\|Ga0182129_1101521	Not Available	524	Open in IMG/M
3300015341\|Ga0182187_1069232	Not Available	733	Open in IMG/M
3300015341\|Ga0182187_1071633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	724	Open in IMG/M
3300015341\|Ga0182187_1085415	Not Available	682	Open in IMG/M
3300015341\|Ga0182187_1138065	Not Available	576	Open in IMG/M
3300015341\|Ga0182187_1143842	Not Available	568	Open in IMG/M
3300015341\|Ga0182187_1184809	Not Available	518	Open in IMG/M
3300015342\|Ga0182109_1077638	Not Available	745	Open in IMG/M
3300015342\|Ga0182109_1107882	Not Available	662	Open in IMG/M
3300015342\|Ga0182109_1122102	Not Available	632	Open in IMG/M
3300015342\|Ga0182109_1216338	Not Available	508	Open in IMG/M
3300015343\|Ga0182155_1043558	Not Available	899	Open in IMG/M
3300015343\|Ga0182155_1072049	Not Available	757	Open in IMG/M
3300015343\|Ga0182155_1110737	Not Available	653	Open in IMG/M
3300015343\|Ga0182155_1139043	Not Available	601	Open in IMG/M
3300015343\|Ga0182155_1161992	Not Available	569	Open in IMG/M
3300015343\|Ga0182155_1188878	Not Available	537	Open in IMG/M
3300015343\|Ga0182155_1202827	Not Available	523	Open in IMG/M
3300015343\|Ga0182155_1207786	Not Available	518	Open in IMG/M
3300015343\|Ga0182155_1209511	Not Available	516	Open in IMG/M
3300015343\|Ga0182155_1213700	Not Available	512	Open in IMG/M
3300015344\|Ga0182189_1032803	Not Available	1006	Open in IMG/M
3300015344\|Ga0182189_1087529	Not Available	719	Open in IMG/M
3300015344\|Ga0182189_1134472	Not Available	616	Open in IMG/M
3300015344\|Ga0182189_1196229	Not Available	534	Open in IMG/M
3300015345\|Ga0182111_1080050	Not Available	768	Open in IMG/M
3300015345\|Ga0182111_1104085	Not Available	698	Open in IMG/M
3300015345\|Ga0182111_1116784	Not Available	669	Open in IMG/M
3300015345\|Ga0182111_1123754	Not Available	655	Open in IMG/M
3300015345\|Ga0182111_1199101	Not Available	545	Open in IMG/M
3300015345\|Ga0182111_1230309	Not Available	515	Open in IMG/M
3300015345\|Ga0182111_1239892	Not Available	506	Open in IMG/M
3300015346\|Ga0182139_1017889	Not Available	1278	Open in IMG/M
3300015346\|Ga0182139_1037612	Not Available	1006	Open in IMG/M
3300015346\|Ga0182139_1110861	Not Available	682	Open in IMG/M
3300015346\|Ga0182139_1159978	Not Available	594	Open in IMG/M
3300015346\|Ga0182139_1165792	Not Available	586	Open in IMG/M
3300015346\|Ga0182139_1182764	Not Available	565	Open in IMG/M
3300015346\|Ga0182139_1202107	Not Available	542	Open in IMG/M
3300015346\|Ga0182139_1210530	Not Available	534	Open in IMG/M
3300015346\|Ga0182139_1217200	Not Available	527	Open in IMG/M
3300015346\|Ga0182139_1224671	Not Available	520	Open in IMG/M
3300015347\|Ga0182177_1002896	Not Available	2338	Open in IMG/M
3300015347\|Ga0182177_1039482	Not Available	994	Open in IMG/M
3300015347\|Ga0182177_1138131	Not Available	631	Open in IMG/M
3300015347\|Ga0182177_1138921	Not Available	629	Open in IMG/M
3300015347\|Ga0182177_1142646	Not Available	623	Open in IMG/M
3300015347\|Ga0182177_1156129	Not Available	602	Open in IMG/M
3300015347\|Ga0182177_1175056	Not Available	576	Open in IMG/M
3300015347\|Ga0182177_1250434	Not Available	500	Open in IMG/M
3300015351\|Ga0182161_1050781	Not Available	954	Open in IMG/M
3300015351\|Ga0182161_1081950	Not Available	799	Open in IMG/M
3300015351\|Ga0182161_1086330	Not Available	783	Open in IMG/M
3300015351\|Ga0182161_1122315	Not Available	686	Open in IMG/M
3300015351\|Ga0182161_1125713	Not Available	679	Open in IMG/M
3300015351\|Ga0182161_1205018	Not Available	560	Open in IMG/M
3300015351\|Ga0182161_1208048	Not Available	557	Open in IMG/M
3300015351\|Ga0182161_1221100	Not Available	543	Open in IMG/M
3300015355\|Ga0182159_1136838	Not Available	754	Open in IMG/M
3300015355\|Ga0182159_1154156	Not Available	718	Open in IMG/M
3300015355\|Ga0182159_1160998	Not Available	705	Open in IMG/M
3300015355\|Ga0182159_1184467	Not Available	665	Open in IMG/M
3300015355\|Ga0182159_1316880	Not Available	526	Open in IMG/M
3300015355\|Ga0182159_1324122	Not Available	520	Open in IMG/M
3300015361\|Ga0182145_1097477	Not Available	634	Open in IMG/M
3300015361\|Ga0182145_1113673	Not Available	602	Open in IMG/M
3300017404\|Ga0182203_1009296	Not Available	1200	Open in IMG/M
3300017404\|Ga0182203_1027670	Not Available	878	Open in IMG/M
3300017404\|Ga0182203_1116202	Not Available	564	Open in IMG/M
3300017404\|Ga0182203_1159406	Not Available	507	Open in IMG/M
3300017404\|Ga0182203_1165733	Not Available	500	Open in IMG/M
3300017407\|Ga0182220_1001011	Not Available	1844	Open in IMG/M
3300017407\|Ga0182220_1029655	Not Available	719	Open in IMG/M
3300017407\|Ga0182220_1075910	Not Available	557	Open in IMG/M
3300017407\|Ga0182220_1092403	Not Available	526	Open in IMG/M
3300017407\|Ga0182220_1096136	Not Available	521	Open in IMG/M
3300017409\|Ga0182204_1019225	Not Available	863	Open in IMG/M
3300017409\|Ga0182204_1026964	Not Available	784	Open in IMG/M
3300017409\|Ga0182204_1113448	Not Available	511	Open in IMG/M
3300017410\|Ga0182207_1087575	Not Available	637	Open in IMG/M
3300017410\|Ga0182207_1099238	Not Available	612	Open in IMG/M
3300017410\|Ga0182207_1104896	Not Available	601	Open in IMG/M
3300017410\|Ga0182207_1109805	Not Available	592	Open in IMG/M
3300017411\|Ga0182208_1032997	Not Available	762	Open in IMG/M
3300017411\|Ga0182208_1051151	Not Available	670	Open in IMG/M
3300017413\|Ga0182222_1073685	Not Available	556	Open in IMG/M
3300017413\|Ga0182222_1079167	Not Available	546	Open in IMG/M
3300017413\|Ga0182222_1090459	Not Available	527	Open in IMG/M
3300017415\|Ga0182202_1033285	Not Available	786	Open in IMG/M
3300017415\|Ga0182202_1054891	Not Available	677	Open in IMG/M
3300017415\|Ga0182202_1080502	Not Available	600	Open in IMG/M
3300017417\|Ga0182230_1031605	Not Available	924	Open in IMG/M
3300017417\|Ga0182230_1046462	Not Available	761	Open in IMG/M
3300017420\|Ga0182228_1025913	Not Available	929	Open in IMG/M
3300017420\|Ga0182228_1039395	Not Available	784	Open in IMG/M
3300017420\|Ga0182228_1057451	Not Available	677	Open in IMG/M
3300017420\|Ga0182228_1066676	Not Available	640	Open in IMG/M
3300017420\|Ga0182228_1089155	Not Available	575	Open in IMG/M
3300017420\|Ga0182228_1128121	Not Available	504	Open in IMG/M
3300017424\|Ga0182219_1033400	Not Available	785	Open in IMG/M
3300017424\|Ga0182219_1054219	Not Available	675	Open in IMG/M
3300017424\|Ga0182219_1115801	Not Available	534	Open in IMG/M
3300017424\|Ga0182219_1121124	Not Available	526	Open in IMG/M
3300017425\|Ga0182224_1040049	Not Available	784	Open in IMG/M
3300017425\|Ga0182224_1042367	Not Available	772	Open in IMG/M
3300017425\|Ga0182224_1063888	Not Available	681	Open in IMG/M
3300017425\|Ga0182224_1099294	Not Available	594	Open in IMG/M
3300017425\|Ga0182224_1110909	Not Available	573	Open in IMG/M
3300017425\|Ga0182224_1122993	Not Available	555	Open in IMG/M
3300017427\|Ga0182190_1018337	Not Available	1043	Open in IMG/M
3300017427\|Ga0182190_1028157	Not Available	909	Open in IMG/M
3300017427\|Ga0182190_1048003	Not Available	764	Open in IMG/M
3300017427\|Ga0182190_1062715	Not Available	699	Open in IMG/M
3300017427\|Ga0182190_1070466	Not Available	673	Open in IMG/M
3300017427\|Ga0182190_1159837	Not Available	508	Open in IMG/M
3300017427\|Ga0182190_1159867	Not Available	508	Open in IMG/M
3300017430\|Ga0182192_1048708	Not Available	778	Open in IMG/M
3300017430\|Ga0182192_1054308	Not Available	750	Open in IMG/M
3300017430\|Ga0182192_1055654	Not Available	744	Open in IMG/M
3300017430\|Ga0182192_1072334	Not Available	680	Open in IMG/M
3300017430\|Ga0182192_1074858	Not Available	672	Open in IMG/M
3300017430\|Ga0182192_1075553	Not Available	670	Open in IMG/M
3300017430\|Ga0182192_1131014	Not Available	555	Open in IMG/M
3300017430\|Ga0182192_1139295	Not Available	543	Open in IMG/M
3300017433\|Ga0182206_1032120	Not Available	829	Open in IMG/M
3300017433\|Ga0182206_1106308	Not Available	573	Open in IMG/M
3300017433\|Ga0182206_1113725	Not Available	561	Open in IMG/M
3300017433\|Ga0182206_1133681	Not Available	532	Open in IMG/M
3300017436\|Ga0182209_1124123	Not Available	562	Open in IMG/M
3300017436\|Ga0182209_1135526	Not Available	546	Open in IMG/M
3300017436\|Ga0182209_1159082	Not Available	517	Open in IMG/M
3300017438\|Ga0182191_1091392	Not Available	635	Open in IMG/M
3300017438\|Ga0182191_1117963	Not Available	584	Open in IMG/M
3300017438\|Ga0182191_1149196	Not Available	539	Open in IMG/M
3300017438\|Ga0182191_1171014	Not Available	514	Open in IMG/M
3300017438\|Ga0182191_1181460	Not Available	503	Open in IMG/M
3300017442\|Ga0182221_1011565	Not Available	1131	Open in IMG/M
3300017442\|Ga0182221_1023272	Not Available	919	Open in IMG/M
3300017442\|Ga0182221_1038649	Not Available	791	Open in IMG/M
3300017442\|Ga0182221_1042835	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	768	Open in IMG/M
3300017442\|Ga0182221_1090124	Not Available	613	Open in IMG/M
3300017442\|Ga0182221_1096234	Not Available	601	Open in IMG/M
3300017442\|Ga0182221_1108666	Not Available	579	Open in IMG/M
3300017442\|Ga0182221_1149656	Not Available	524	Open in IMG/M
3300017443\|Ga0182193_1168942	Not Available	531	Open in IMG/M
3300017443\|Ga0182193_1174453	Not Available	525	Open in IMG/M
3300017680\|Ga0182233_1071348	Not Available	624	Open in IMG/M
3300017680\|Ga0182233_1098546	Not Available	540	Open in IMG/M
3300017680\|Ga0182233_1111890	Not Available	510	Open in IMG/M
3300017681\|Ga0182226_1048636	Not Available	766	Open in IMG/M
3300017682\|Ga0182229_1045164	Not Available	748	Open in IMG/M
3300017682\|Ga0182229_1068956	Not Available	607	Open in IMG/M
3300017683\|Ga0182218_1021280	Not Available	908	Open in IMG/M
3300017683\|Ga0182218_1075637	Not Available	626	Open in IMG/M
3300017683\|Ga0182218_1091651	Not Available	591	Open in IMG/M
3300017683\|Ga0182218_1154511	Not Available	501	Open in IMG/M
3300017684\|Ga0182225_1020211	Not Available	930	Open in IMG/M
3300017685\|Ga0182227_1060755	Not Available	685	Open in IMG/M
3300017685\|Ga0182227_1083785	Not Available	603	Open in IMG/M
3300017685\|Ga0182227_1132294	Not Available	508	Open in IMG/M
3300017686\|Ga0182205_1072267	Not Available	672	Open in IMG/M
3300017689\|Ga0182231_1010741	Not Available	1654	Open in IMG/M
3300017690\|Ga0182223_1038680	Not Available	693	Open in IMG/M
3300017690\|Ga0182223_1061497	Not Available	612	Open in IMG/M
3300017690\|Ga0182223_1063684	Not Available	606	Open in IMG/M
3300017690\|Ga0182223_1095622	Not Available	541	Open in IMG/M
3300017690\|Ga0182223_1104055	Not Available	529	Open in IMG/M
3300017690\|Ga0182223_1111337	Not Available	519	Open in IMG/M
3300017690\|Ga0182223_1114055	Not Available	515	Open in IMG/M
3300017690\|Ga0182223_1114566	Not Available	514	Open in IMG/M
3300021060\|Ga0182232_1042366	Not Available	764	Open in IMG/M
3300021060\|Ga0182232_1045816	Not Available	731	Open in IMG/M
3300021060\|Ga0182232_1052302	Not Available	677	Open in IMG/M
3300021060\|Ga0182232_1069447	Not Available	576	Open in IMG/M
3300021060\|Ga0182232_1076177	Not Available	546	Open in IMG/M
3300025908\|Ga0207643_10957966	Not Available	554	Open in IMG/M
3300025940\|Ga0207691_11414583	Not Available	571	Open in IMG/M
3300025942\|Ga0207689_11325897	Not Available	604	Open in IMG/M
3300026023\|Ga0207677_10527585	Not Available	1025	Open in IMG/M
3300026023\|Ga0207677_10777892	Not Available	855	Open in IMG/M
3300026023\|Ga0207677_11838402	Not Available	562	Open in IMG/M
3300026023\|Ga0207677_11996584	Not Available	539	Open in IMG/M
3300026089\|Ga0207648_10493633	Not Available	1119	Open in IMG/M
3300026118\|Ga0207675_102603245	Not Available	515	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	86.92%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.26%
Roots	Host-Associated → Plants → Roots	3.63%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.18%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	86.92%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.26%
Unclassified	Host-Associated → Plants → Roots → Unclassified	3.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.94%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.24%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	86.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.26%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	3.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.94%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.24%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	85.47%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	7.02%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	3.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.45%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	1.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.24%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1014549102	3300005334	Miscanthus Rhizosphere	VPNVPEAQKSFWTHSMVPLGEEAQVEARFGPFGHSANLDAR*
Ga0068869_1015481561	3300005334	Miscanthus Rhizosphere	VPNVPEAQKSFWTHSMVPLGDEAQVEAHFGPFEDCANLDAR*
Ga0068869_1016263261	3300005334	Miscanthus Rhizosphere	VPNVPQAQKSFWTHPMVLLGDEAQVDACFSPFGDSANLDAR*
Ga0068869_1017226921	3300005334	Miscanthus Rhizosphere	VPNVPSTQKSCWTHPMVLLDDEAQVEACFGPLGDSANLDAR*
Ga0068868_1005787471	3300005338	Miscanthus Rhizosphere	FAPNVPSTQISFWTHPTVPLGDEAQVEARFGPFGDSANLDAR*
Ga0068868_1010093591	3300005338	Miscanthus Rhizosphere	GAQFAPNVPSAQKSFWTHPIVPLGDGAQVEARFGPFGNSANLDGR*
Ga0068867_1010047682	3300005459	Miscanthus Rhizosphere	RFAPNVPSAQKSFWTQPMVLLGDEAQVKACLGPIGESANLDTR*
Ga0068867_1011683471	3300005459	Miscanthus Rhizosphere	CWCKIGARFVPNVPEAQKSFWTHSMVPLGEEAQVEARFGPFGHSANLDAR*
Ga0068867_1016021231	3300005459	Miscanthus Rhizosphere	MPNVPEAQKSFWTHSMVPLGEEAQVEARFGLFGDSANLDAR*
Ga0068867_1020485081	3300005459	Miscanthus Rhizosphere	VPIVPEAQKSFWTHSMVPLGDEALLEARFGPFGHSANLDARLVH
Ga0068866_107535811	3300005718	Miscanthus Rhizosphere	ARKSFWTYPMELLGDEAQVEAHLGAFGDSANLDAR*
Ga0068866_111811051	3300005718	Miscanthus Rhizosphere	QKSFWTHSMVPLGDEAQVEARFGPFGDSANVVAR*
Ga0068866_114345531	3300005718	Miscanthus Rhizosphere	VIDVPKAQKSFWTHLMVPLGDEAEVKAHFGPLEDSANLDAR*
Ga0068870_107532161	3300005840	Miscanthus Rhizosphere	VPSAQKSFWTHPIVPLGDEAQVEARFSPFGHSANLDAR*
Ga0068870_109878701	3300005840	Miscanthus Rhizosphere	AQKSFWTHSMVPLGDEAQVEAHFGPFGHSANIDAR*
Ga0068870_111293042	3300005840	Miscanthus Rhizosphere	VLDIPLAQKSFWMHPTVPLGDKAQVEAHFGTFGDSANFDAR*
Ga0068870_111989981	3300005840	Miscanthus Rhizosphere	AQKSFWTHLMVPLGDKALVEARFGPFRYSANYDAR*
Ga0068870_112281012	3300005840	Miscanthus Rhizosphere	NVPSAQKSFWTHPFVLRSDEAQVKARFGLFGDSANLDTR*
Ga0068865_1002795482	3300006881	Miscanthus Rhizosphere	VPNVPEAQKSFWTYSIVPLGEEAQVEARFGPFGHSANLDAR*
Ga0068865_1006067823	3300006881	Miscanthus Rhizosphere	VPNVPEAQKSFWTHSMVPLGDEAQVEARFGPFGHSANLDAR*
Ga0068865_1011493031	3300006881	Miscanthus Rhizosphere	QKSFWMHPTVPLGDEAQVEAHFGTFGDSANFDTR*
Ga0068865_1019335711	3300006881	Miscanthus Rhizosphere	CRCKIGAWFVLDIPLAQKLFWMHTMIPLGDEAQVERCFGPFRDSVNLDTR*
Ga0105243_125658871	3300009148	Miscanthus Rhizosphere	ALDVPHAQKSYWTHLMVPLGDKALVKARFGPFGYSANYDAR*
Ga0105246_124380552	3300011119	Miscanthus Rhizosphere	WFAPNVPSAKKSFWTHPLVLHGDEAQVKAHFGPFGDSASLDAR*
Ga0157374_109225501	3300013296	Miscanthus Rhizosphere	PSAQKSFWTHPIVPLGDGAQVEAHFGPFGNSANLDGR*
Ga0157374_129154891	3300013296	Miscanthus Rhizosphere	NVPSTQISFWTHPMVPLGDEAQVEARFDPFGDSANLD*
Ga0157378_109947311	3300013297	Miscanthus Rhizosphere	PLAQKSFWTHSMVPLGDEAQVEAHFGPFGHSANLDAR*
Ga0157378_122976011	3300013297	Miscanthus Rhizosphere	QTLLWTHSMVALGDEAQVEAHFGPFEHSANLDAR*
Ga0157378_129515981	3300013297	Miscanthus Rhizosphere	PSAQKSFWTHPMVLLGDEAQVKARLGPFGDSANLDAR*
Ga0157375_125871442	3300013308	Miscanthus Rhizosphere	QKSFWTHPMVLLGDEAQVEAYFGPFRDSDILDAR*
Ga0182004_100215381	3300014486	Root	VLNEPLAQKPFCTHMMVLLGEEDQVETQFGPFGDSANLDAR*
Ga0182004_100215382	3300014486	Root	VANVPYAQKLFWTHLMVLIREEAQVETQFGPFGASANLDAR*
Ga0182004_101456602	3300014486	Root	IDAWFAPNAPYSKKTFWTHSMVLLGEEAQVEARFGLFGGSDNLMQDSCTVCA*
Ga0182004_101554551	3300014486	Root	FAPNVPQAKKLFWTHPMVLLGEVAQVKARFSPFGDSATLDA*
Ga0182004_101583801	3300014486	Root	VPSAPYGQKPLWKFTMVRLGEEAQVKARFGLFGDSANLD
Ga0182004_101648421	3300014486	Root	SKKSFWTHLLVLLGEGAQVDARFGLFGDSANLDAR*
Ga0182004_101959461	3300014486	Root	APYSNKPFWTHPIVLLNEEAQVEARFGLFGDSANLDAR*
Ga0182004_102131291	3300014486	Root	IWYVPCKNAPQAKKPFWTHPMVLLGEVAQVKAWFSPFGDGATLDAK*
Ga0182004_102257231	3300014486	Root	RCKIGARFAPNVPQAKKLFWTHPMVLLGEVAQVKARFSPFGDSATLDTK*
Ga0182004_102391961	3300014486	Root	YSNKPFWTHPIVLLNEEAQVEARFGLFGDSANLDAR*
Ga0182004_102443541	3300014486	Root	PYSNKPFWMHPIVLLAEESQVDARFSLFGDSANLDAR*
Ga0182004_102606891	3300014486	Root	QKSLWKFLMVLLGEEAQVKARFGLFGDSANLDER*
Ga0182004_102751231	3300014486	Root	CKIVAWFVPNAPWAQKLLWKFPMVLLGEEAQVKARFGLFGDSANLDER*
Ga0182004_102757741	3300014486	Root	FQCKIGARFAPNAPEAKKPFWTHPMVLLGEEAQVKARFGLFRDSANLDAR*
Ga0182004_103022651	3300014486	Root	AQKSLWKFLMVLLGGGAQVKARFGMFGDSANLDER*
Ga0182122_10073691	3300015267	Miscanthus Phyllosphere	MAQKSFWTHQMVLLGDEAQVKARFGPFGDSANLYSR*
Ga0182122_10097312	3300015267	Miscanthus Phyllosphere	FALDVPYSQKSFWRHLMVPLGDEAQVEARFSSFVDKANLEAR*
Ga0182122_10398091	3300015267	Miscanthus Phyllosphere	AQKLFWTHLMVPLGDRAQVEPRFSPFGYSANLDAR*
Ga0182122_10466171	3300015267	Miscanthus Phyllosphere	SAQKSFWTHLMVLLGDEAQVNAHFGPFGDRANLDER*
Ga0182122_10569912	3300015267	Miscanthus Phyllosphere	QKSFWTHSMVPLGDEAQVEAHFGLFGDRANVDAR*
Ga0182122_10643951	3300015267	Miscanthus Phyllosphere	HGLHRNVPLAQKSFWMHPMVHLDDEAQVVARFDSFGDSANLDAR*
Ga0182154_10039062	3300015268	Miscanthus Phyllosphere	AHFAPNVPLAQKSFWTHSMVPLGDEAQVKAHFGPFGDSAHVDAR*
Ga0182154_10062071	3300015268	Miscanthus Phyllosphere	PNVPEAQKLFWTHSMVPLGDEAQAEARFGPFGHSAHLDAR*
Ga0182154_10462392	3300015268	Miscanthus Phyllosphere	VPNEPEAQKSFWTHSMVPVGDEAQVEASFGPFGHYANLD
Ga0182154_10514621	3300015268	Miscanthus Phyllosphere	VLDVPYVQKSFWAHSMVPLGDAAQVEARFGPFGDSANVVAR*
Ga0182113_10068281	3300015269	Miscanthus Phyllosphere	RFAPNVPKGQKLFWTHPMVLLGEEAQVEDRFSPFRDSGNIDARWVHSLR*
Ga0182113_10192321	3300015269	Miscanthus Phyllosphere	QKSFRTHSMVPVGDEAQVEASFGPFGHYANLDAR*
Ga0182113_10206591	3300015269	Miscanthus Phyllosphere	AQKSFWTHPMVLVGDEAQAEACFGPFGGGANLDAR*
Ga0182113_10512811	3300015269	Miscanthus Phyllosphere	DIPKAQKSFWTHSMVPLVDEAQVEACFGLFGDSANLDAR*
Ga0182113_10606411	3300015269	Miscanthus Phyllosphere	VPNVPEAQKSFWTHSMVPLGDEAQVEARFGPFGHSAH
Ga0182113_10607601	3300015269	Miscanthus Phyllosphere	VPNEPEAQKSFWTHSMVPLGDEAQVEAHLGPSGHS
Ga0182113_10791502	3300015269	Miscanthus Phyllosphere	EKSFWTHPMVPLGDEAQVEARIGPFGDKANHDAR*
Ga0182113_10872791	3300015269	Miscanthus Phyllosphere	TQKSFWMHPIVPLGDEAQVEAHFGLFGDSANLDAK*
Ga0182113_10876951	3300015269	Miscanthus Phyllosphere	AQKSFWTDLMVLQGDEAQVGAQCGLFGDNANLDAG*
Ga0182113_10971441	3300015269	Miscanthus Phyllosphere	AKRTIGSKTFWTHPMVLLRDGAQVEARFGPFGDSANLEAR*
Ga0182188_10080982	3300015274	Miscanthus Phyllosphere	AYKSFWTHPMVPLGYEAQVEAHFNPFRDSGNIDAR*
Ga0182188_10405931	3300015274	Miscanthus Phyllosphere	VIDVPKAEKSFWTHLMAPLGDKAEVKAHFGPLEDSANLDAR*
Ga0182188_10624071	3300015274	Miscanthus Phyllosphere	STQISFWTHPMVPLGDEAQVEARFGPFGDSANLDAR*
Ga0182172_10022081	3300015275	Miscanthus Phyllosphere	IPLAQKSFWMHPTVPLGDEAQVEAHFGTFGDSANFDAR*
Ga0182172_10056271	3300015275	Miscanthus Phyllosphere	EAQKSFWTHSMVPLGDEAQVEARFSPFGDRANLDAR*
Ga0182172_10623891	3300015275	Miscanthus Phyllosphere	FVPNEPEAQKSFWTHSIVPLGDEAQVEAHFGPFGHSANLNAR*
Ga0182172_10639851	3300015275	Miscanthus Phyllosphere	VRNVPEAQKSFWMHPMVPIGDEAHVKARFGLFEDRANLDAR*
Ga0182172_10749091	3300015275	Miscanthus Phyllosphere	WCKIGAQFAPNVPSAQKSFWMHLIVPLGDEAQVEAHFGPFEDSANID*
Ga0182172_10756501	3300015275	Miscanthus Phyllosphere	VPNEPEAQKSFWTHSIVPLGDEAQMEAHFGPFEDSANLDAR*
Ga0182170_10078482	3300015276	Miscanthus Phyllosphere	RCKIGAWFALDIPKAQKSFWTHSMVPLVDEAQVEACFGLFGDSANLDAR*
Ga0182170_10297731	3300015276	Miscanthus Phyllosphere	AQKSFWTHSMVPLGDEAQVEARFGPFGGSANLDAR*
Ga0182170_10612861	3300015276	Miscanthus Phyllosphere	HKSFWTHSMVTLGDEAQVEARFGPFGDSANLDAR*
Ga0182128_10033111	3300015277	Miscanthus Phyllosphere	NVPQAQELFWTHPMVLQCEETKVEARFSLFGDSANL*
Ga0182128_10194731	3300015277	Miscanthus Phyllosphere	AQKSFWTHSMVPIGDEDQPEACFGPFRHSANLDTR*
Ga0182128_10253861	3300015277	Miscanthus Phyllosphere	VIDVPKAQKSFWTHLMVPLGDESEVKAHFGPLEDSANLDAR*
Ga0182174_10065702	3300015279	Miscanthus Phyllosphere	VLDIPLAQKSFWMDPTVPLGDEAQAEARFGMFGESANFDGR*
Ga0182174_10300472	3300015279	Miscanthus Phyllosphere	ARFAPNVPQAQKLFWTQPMELLDDEAQVEARFGLFGDSANLDARYVPSLR*
Ga0182174_10356911	3300015279	Miscanthus Phyllosphere	IPKAQKSFWTHSMVPLVDEAQVEARFGLFGDSANLDAR*
Ga0182160_10126591	3300015281	Miscanthus Phyllosphere	VLDIPLAQKSFWMDPTVPLGDEAQAEAHFGMFGESANFDGR*
Ga0182160_10250071	3300015281	Miscanthus Phyllosphere	QKSFWTHPMVPLGDEAQVEARFGPFGHSANLDAR*
Ga0182160_10333581	3300015281	Miscanthus Phyllosphere	GARFAPNVPSTQKSFWTHPMVPLGDEAHVEARFGPLGESANLDAR*
Ga0182160_10427822	3300015281	Miscanthus Phyllosphere	FESNVPQARKSFWTHPMELLDDEAQVEARFGPFRDSANLDAR*
Ga0182160_10705721	3300015281	Miscanthus Phyllosphere	IGARIAQNIPSAQKSFWTHPLGLLGDEAQLKARIGPFGDSPNLEAR*
Ga0182124_10037361	3300015282	Miscanthus Phyllosphere	AQKSFWMHLMVPLGDDAQVEARVDPFRHSANLDAR*
Ga0182124_10085711	3300015282	Miscanthus Phyllosphere	QKSFWTHPMVLLGDEAQVEAHFGPFADSANLDAR*
Ga0182124_10195471	3300015282	Miscanthus Phyllosphere	ALKSFWTHPMVLQGDETQVEARFGLFGDSANLDAR*
Ga0182124_10465612	3300015282	Miscanthus Phyllosphere	VPNVPEAQKSFSTHSMVPPGDEAQVEAPFGSIGHSANLDAR*
Ga0182124_10552711	3300015282	Miscanthus Phyllosphere	VPSAQKSFWTHPFILRSDEAQVKARFGPFGDNANLDTR*
Ga0182156_10091411	3300015283	Miscanthus Phyllosphere	IGARFAPNVPSTQKSFWTNPIVPLGDEAQMEARFGPFGDSANLNAR*
Ga0182156_10365332	3300015283	Miscanthus Phyllosphere	AQKLFWTHPFVLLGDEAQVKARFGAFGDSANLDAN*
Ga0182156_10557091	3300015283	Miscanthus Phyllosphere	KIGARFAQNVPSAQKSDWTHPLGLLGDKAQVKARFRPFGDSADLDAR*
Ga0182156_10694041	3300015283	Miscanthus Phyllosphere	AQESFWTNQMELLGDEAQVEARFGPFGDSASLDAR*
Ga0182156_10705411	3300015283	Miscanthus Phyllosphere	AQKSFWTHPMVPQGDEAQVEACFGPFGDKANHDAR*
Ga0182186_10098481	3300015285	Miscanthus Phyllosphere	VLDVPGAHKSFWTHSMVTLGDEAQVEARFGPFGDSANLDAR*
Ga0182186_10331901	3300015285	Miscanthus Phyllosphere	WKIGAQFAPNVPSAQKSFWTHPLLLRSDEAQVKARFGLFGDSANLDTR*
Ga0182186_10351251	3300015285	Miscanthus Phyllosphere	VPNVPEAQKSFWTHSIVPLGDEAQVEARFCPFGHSANLDARLVHGLRR
Ga0182186_10351681	3300015285	Miscanthus Phyllosphere	GARFAPNVPSAQKSFWTHPMVLLGDEAQVKACFRPFGESANLDTR*
Ga0182186_10513832	3300015285	Miscanthus Phyllosphere	QESFWTNQMELLGDEAQVEARFGPFGDSANLDAR*
Ga0182186_10572451	3300015285	Miscanthus Phyllosphere	FVPNEPEAQKSFWTDSMVPLSDEAQVEACFGPLGHSANLDAK*
Ga0182186_10585452	3300015285	Miscanthus Phyllosphere	AQKSFWTHSMVPPSDEAQVEAHFGTFEHSAILDVG*
Ga0182186_10665791	3300015285	Miscanthus Phyllosphere	IPQAQKSFWTHLMLPLGDKAQVEARFGPFGKSANLNAR*
Ga0182186_10815091	3300015285	Miscanthus Phyllosphere	QKSFWTHPMVPLGDEAQVEARFGPLGYSANLDAR*
Ga0182186_10828571	3300015285	Miscanthus Phyllosphere	FAQDIPLAQKSFWTHSMVPLGDEAQVEVHFGPFGHSANLDARSVHGLRRA*
Ga0182176_10047902	3300015286	Miscanthus Phyllosphere	QKSLWTHSMVPLGDEAQVEARFGPFEHSANLDAR*
Ga0182176_10121861	3300015286	Miscanthus Phyllosphere	AQKSFWTHLMVPLCDEAQVEARFGPFRHSANPDAR*
Ga0182176_10219651	3300015286	Miscanthus Phyllosphere	FVPNVPEAQKSFWTHSMVPLGEEAQVEARFDPFGHSANLDTR*
Ga0182176_10282482	3300015286	Miscanthus Phyllosphere	IGARFAPNVPSTQKSFWTHPMVPLGDEAQVEARFGLFGESANLDAR*
Ga0182176_10367832	3300015286	Miscanthus Phyllosphere	QKSFWTHPMVPLGDEAQVEARFGPLGHSANLDAR*
Ga0182176_10857951	3300015286	Miscanthus Phyllosphere	CKIGAHFAPNVPLAQKSFWTHSMVPLGDEAQVKAHFSPFGDSAHVDAR*
Ga0182171_10132811	3300015287	Miscanthus Phyllosphere	AQKSFWTHRMVLLRDEAQVIAHFGPFRDSGNLDTR*
Ga0182171_10327541	3300015287	Miscanthus Phyllosphere	AQKLFWMHSMVLLGDEAQVEAHFGPFGHSANLDAR*
Ga0182171_10533791	3300015287	Miscanthus Phyllosphere	KSFWTHPMVLLGDEAQVDAHFILFGDSANLGVRKVHGLR*
Ga0182171_10692312	3300015287	Miscanthus Phyllosphere	VPNVPEAQKSFWTHSMVPLGDEALLEARFGPFGHSANLDARLV
Ga0182171_10793151	3300015287	Miscanthus Phyllosphere	IGARVVPNVPEAQKSFWTHLMLPLGDEAQVEACFGPFGHSANLDAR*
Ga0182171_10819701	3300015287	Miscanthus Phyllosphere	VPNEPEAQKSFWTHSIVPLGDEAQVEACFGPFGHSANL
Ga0182173_10440651	3300015288	Miscanthus Phyllosphere	PNVPSTQISFWTNPMVPLGDEVQVEARFGPFGDRANLYAR*
Ga0182173_10649051	3300015288	Miscanthus Phyllosphere	AWFAQDIPLAQKSFWTHSMVPLGDEAQVEAHFGPFGHSANLAAR*
Ga0182173_10773272	3300015288	Miscanthus Phyllosphere	CKIGARFASNVPSTHKSFWTYPTGPLGDEAQVEARFGPFGDSANLHAR*
Ga0182138_10303531	3300015289	Miscanthus Phyllosphere	ALYVPWAQKSFWMHSMVPLGDEAQLKAHFDLFGDSTNLDAR*
Ga0182138_10355421	3300015289	Miscanthus Phyllosphere	KIGAWFAPNVPWAQKSFWTHPIVLLGDEAQVEACFSPFGDSANLDAR*
Ga0182125_10060161	3300015291	Miscanthus Phyllosphere	AQESFWTNQMELLGDEAQVEARFGPFGDSANLDAR*
Ga0182125_10171003	3300015291	Miscanthus Phyllosphere	AWFALDIPKAQKSFWTHSMVPLVDEAQVEACFGLFGDSANLDAR*
Ga0182125_10287611	3300015291	Miscanthus Phyllosphere	ARVVPNVPEAQKSFWTHSMVPLGDEAQVEAHFGPFENCANLDAR*
Ga0182125_10628721	3300015291	Miscanthus Phyllosphere	AKQSFWTHPTVPLGDEAQEEARFGPFGDSDNLDTR*
Ga0182125_10870751	3300015291	Miscanthus Phyllosphere	QKSFWTHSMVPLGDEAQVEAHFGPFGHSANIDAR*
Ga0182141_10224651	3300015292	Miscanthus Phyllosphere	MPNVPSAQKSFWTHPMVLLGDEAQVESCFGPFGDS
Ga0182141_10245952	3300015292	Miscanthus Phyllosphere	CKIGAWFALDIPKAQKSFWTHSMVPLVDEAQVEACFGLFGDSANLDAR*
Ga0182141_10562171	3300015292	Miscanthus Phyllosphere	MAQKSFWTHQMVLLGDEAQVEARLGLFGDSVNLGPR*
Ga0182141_10569391	3300015292	Miscanthus Phyllosphere	QKSYWTHLMVPLGDKVLVEARFGPFGYSANYDAR*
Ga0182126_10400442	3300015294	Miscanthus Phyllosphere	MGARFVPKVPSAQKSFWTHRMILLGDETQTEARFGPFGDGANLDA
Ga0182126_10611771	3300015294	Miscanthus Phyllosphere	AQKSFWTHSMVPLGDEAQVEARFGPFGDSANVVAR*
Ga0182126_10778681	3300015294	Miscanthus Phyllosphere	AQKLFWMHPMVLLADVVQVEARFGPFRHSANLDA*
Ga0182175_10429022	3300015295	Miscanthus Phyllosphere	APNVPSTQKSFWTHPTVPLGDEAQVEAHFGLFGDSANLDAR*
Ga0182175_10806861	3300015295	Miscanthus Phyllosphere	QKSFWMHLMVPLGDDAQVEARVDPFRHSANLDAR*
Ga0182157_10017392	3300015296	Miscanthus Phyllosphere	EWLAPNVPQAQKSFWTQPMVLLGDEAQVVACFGPFRDSDNVDAR*
Ga0182157_10385951	3300015296	Miscanthus Phyllosphere	QKLFWRHLMVPLGDEAQVEARFSPFVDKANLEAR*
Ga0182157_10695031	3300015296	Miscanthus Phyllosphere	NVLVAQKSFWMHSMVPLGDEAQVEAHFNPFGHSANLDAR*
Ga0182157_10776491	3300015296	Miscanthus Phyllosphere	FAPNVPYAQNSFWTHPMVLQCDETQVETRFDLFGDSANLGVR*
Ga0182157_10923011	3300015296	Miscanthus Phyllosphere	VPNVPEAQKFFWTHPLVHLVDEAQVVARFGPFGNSVT
Ga0182157_10998892	3300015296	Miscanthus Phyllosphere	MGALFTPNVPSTQKSFWTHPIVPQVDEAQVEGRFGPFGHSAN
Ga0182106_10127633	3300015298	Miscanthus Phyllosphere	AQKSFWTHPMVLLSVEAQVKAHFDPFGHSANLDAR*
Ga0182106_10775131	3300015298	Miscanthus Phyllosphere	QKSFWSHPMVPLGDEAQVEAHFGTFGDSANLDAR*
Ga0182106_10793741	3300015298	Miscanthus Phyllosphere	TQKSFWTHPTVPLGDEAQVEARFGLFGDSANLDAR*
Ga0182106_10999891	3300015298	Miscanthus Phyllosphere	ETVIGACFVPNVSVAQKSFWTHSMVPLGDEALVEARFGLFRHSANLDAR*
Ga0182107_10303172	3300015299	Miscanthus Phyllosphere	AHKSFWTHSMVTLGDEAQVEARFGPFGDSANLDAR*
Ga0182107_10337961	3300015299	Miscanthus Phyllosphere	VANVPEAQKSFWTHSMVPLGEEAQVEARFGPFGHS
Ga0182107_10694141	3300015299	Miscanthus Phyllosphere	RFALDVPHAYKLFWTHPMVPLVDEAQVEVRFGPFGDRANIDAR*
Ga0182107_10760912	3300015299	Miscanthus Phyllosphere	GQKLFWRQPMELLGEEAQVEAHFWPFGDSANLDA*
Ga0182107_10776451	3300015299	Miscanthus Phyllosphere	AQKSFWTHSKVPLGDKALVEAQFCPLGHGANLDAR*
Ga0182107_10971071	3300015299	Miscanthus Phyllosphere	VPLAQKSFWSHPMVPLGDEAQVEAHFGTFGDSANLDAR*
Ga0182107_11034411	3300015299	Miscanthus Phyllosphere	GRCKIVALFATNVPSAHKSFWTHPIVPLGDEAQVEACFGPFGHSANLDAR*
Ga0182108_10182931	3300015300	Miscanthus Phyllosphere	FARFVPNVLVAQKSFWTHSMVPLGDEAQVEARFGPFGHSANLDAR*
Ga0182108_10215822	3300015300	Miscanthus Phyllosphere	QKSFWTHLMVPLGDEAQVEAHFGPFEDSANLDAR*
Ga0182108_10335061	3300015300	Miscanthus Phyllosphere	VLDIPLAQKSFWMHPMVPLGDEAQVEARFGMFGDSANFDAR*
Ga0182108_10494551	3300015300	Miscanthus Phyllosphere	CRIGAWFAPNVPSAQKSFWTHPMVLLSVEAQVKARFDPF*
Ga0182108_10734241	3300015300	Miscanthus Phyllosphere	MIGARFVPNVPEAQKSFWPHLMVPLGDEAQVEARFGPFGHC
Ga0182108_10925891	3300015300	Miscanthus Phyllosphere	AHKSFWTHSMVTLGYKAQVEAHFGSFGDSANLDAR*
Ga0182143_10341701	3300015302	Miscanthus Phyllosphere	KVPSAQKSFWTHPLVLRSDEAQVKPYFGPFGDSANLDIR*
Ga0182143_10661271	3300015302	Miscanthus Phyllosphere	PSSQISFWTHPMVPLGDEAQVEARFGPFGDSANLDAR*
Ga0182123_10399211	3300015303	Miscanthus Phyllosphere	QKSFWTHPMVLVGDEAQAKAYFGPFGGGANLDAR*
Ga0182123_10618091	3300015303	Miscanthus Phyllosphere	VLDIPLAQKSFWMDPTVPLGDEAQAEARFGMFGDSANLDFR*
Ga0182123_10623881	3300015303	Miscanthus Phyllosphere	EPEAQKSFWTHSMVPLGDEAQVEARFGPFGDSANLDAR*
Ga0182123_10934981	3300015303	Miscanthus Phyllosphere	VPQAQKSFWTHPMVLLGDEPQVESCFGPFGDSVSISAR*
Ga0182112_10229391	3300015304	Miscanthus Phyllosphere	AQKSFWTHSMVPVGDEAQVEASFGPFGHYANLDAR*
Ga0182112_10635432	3300015304	Miscanthus Phyllosphere	VPDVPEAQKLFWTHSMVPLGDEALLEARFGPFGHSANL
Ga0182112_10713521	3300015304	Miscanthus Phyllosphere	PKVPEAQKSFWTHSMVPLGDEAQVEARFSPFGDRANLDAR*
Ga0182112_10955281	3300015304	Miscanthus Phyllosphere	VVPNVPEAQKSFWTHSMVPLGDEGQVEARFGPFEYSANLDAR*
Ga0182158_10108801	3300015305	Miscanthus Phyllosphere	PEAQKSFWTHSMVPLGDEAQVEAHFGPFGHSANLDAR*
Ga0182158_10597621	3300015305	Miscanthus Phyllosphere	GACFVPNEPEAQKSFWTHSIKPLGDEAQVEARFGPFGDSANVDAR*
Ga0182158_10764261	3300015305	Miscanthus Phyllosphere	VPNVPEAQKSFWTHSIVPLGDEAQVEAYFGPFEDSANLDAR*
Ga0182158_10795542	3300015305	Miscanthus Phyllosphere	VPNVPEAQKSFWTHSMVPLGDEALLEARFGPFGHSANLD
Ga0182158_10799271	3300015305	Miscanthus Phyllosphere	PIVPSTQKSFWTHPMIPLGDEAQVEARFGPFGDIANLDAR*
Ga0182158_10907173	3300015305	Miscanthus Phyllosphere	QKSFWTHQMVLLGDEAQTEARFGPFGDSANLDSR*
Ga0182158_10953701	3300015305	Miscanthus Phyllosphere	KKGARFAPNVPSAQKSFWTHPMVLLGDEAQVKACFIPFGESANLDTR*
Ga0182144_10258832	3300015307	Miscanthus Phyllosphere	HFAPNVPLAQKSFWTHSMVPLGDEAQVKAHFGPFGDSAHVDAR*
Ga0182144_10436111	3300015307	Miscanthus Phyllosphere	HKSFWTHSMVTLGYKAQVEAYFGPFGDSATLHAR*
Ga0182144_10663502	3300015307	Miscanthus Phyllosphere	PQSFWTHPMVLLGDEAQVEAHFGSFGDSANLDASYVP*
Ga0182144_10681361	3300015307	Miscanthus Phyllosphere	FALDVPYSQKLFWRHLMVPLGDEAQVEARFSPFVDKANLEAR*
Ga0182144_10948741	3300015307	Miscanthus Phyllosphere	MGERFALNITYAQKSFWTHPMLLLGDEAQLDARFGPFGDSVNLD
Ga0182142_10134801	3300015308	Miscanthus Phyllosphere	NVPEAQKSFWTHSMVPLGDEAQVEAHFGPFEDCANIDAR*
Ga0182142_10143513	3300015308	Miscanthus Phyllosphere	KIGAWFALDVPYSQKLFWRHLMVPLGDEAQVEARFGPFVDKANLDAR*
Ga0182142_10150251	3300015308	Miscanthus Phyllosphere	AWFALDVPYSQKSFWRHLMVPLGDEAQVEARFSSFVDKANLEAR*
Ga0182142_10397131	3300015308	Miscanthus Phyllosphere	RFAPNVPKAQKSFWTHSMVPLGDEAQVESCFGPFRDSVNLDAR*
Ga0182142_10509251	3300015308	Miscanthus Phyllosphere	HKSFWTHLMVPLGDEAQVEAHFGPFGHSANLDAR*
Ga0182142_10886431	3300015308	Miscanthus Phyllosphere	AHKSSWTHPIVLLVDEAQVEARFGPIGESANIDAR*
Ga0182142_11082961	3300015308	Miscanthus Phyllosphere	ALDIILAQKSFWTHSMVPLGDEAQVEARFGPFGDSANLDAR*
Ga0182140_10209602	3300015314	Miscanthus Phyllosphere	LEAQKSFWTHSMVPLGDEAQVEARFGPFGHSTNLDAR*
Ga0182140_10869081	3300015314	Miscanthus Phyllosphere	STQISFWTHPMVPLGDEAQVEARFGPFGDSANLDGR*
Ga0182127_10157891	3300015321	Miscanthus Phyllosphere	AQFAPNVPSAQKSFWTHPFVLRSDEAQVKARFGLFGDSANLDTR*
Ga0182127_10555121	3300015321	Miscanthus Phyllosphere	VPKAHKSFWTHLMVLLGDEAQVEARFVLFGDSANLEAR*
Ga0182127_10924331	3300015321	Miscanthus Phyllosphere	ICAQFAPNVPSAQKLFWTHPLVLRSDENQVKASFGPFGDSANLDTR*
Ga0182127_10938782	3300015321	Miscanthus Phyllosphere	VPNVPEAQKSFWTHSMVPLGDEALLEARFGPFGHSANLDARL
Ga0182127_10991771	3300015321	Miscanthus Phyllosphere	VPIVPEAQKSFWTHSMVPLGDEALLEARFGPFGHSANLDARLV
Ga0182127_11129551	3300015321	Miscanthus Phyllosphere	AQKSFWKHSMVPLGDEVQVEARFCLFGDSANVVAR*
Ga0182110_10264961	3300015322	Miscanthus Phyllosphere	VPIVPEAQKSFWTHSMVPLGDEALLEARFGPFGHSANL
Ga0182110_10872771	3300015322	Miscanthus Phyllosphere	VPNVPSAQKLFWTHLTVPLGDEAQVEARFGPFGDSANL
Ga0182110_10991551	3300015322	Miscanthus Phyllosphere	CRCKIGAWFALYVPQAQKLFWTHLMVPLGDEVLVEVRFGPFQHSANLDAR*
Ga0182129_10107991	3300015323	Miscanthus Phyllosphere	ARKLFWTHPVKLLGDEAQVKASFGPFANSANLDTR*
Ga0182129_10397111	3300015323	Miscanthus Phyllosphere	FAPNVPSAQKSFWTHLMVLLGDEAEVKARFRPFAESANLDTRLVHGLC*
Ga0182129_10804911	3300015323	Miscanthus Phyllosphere	PSAQKSFWTHSMVLLGDEAQVEDRFGLSGDSAKLDAR*
Ga0182129_10928701	3300015323	Miscanthus Phyllosphere	VPNVPSAQKLFWTHLTVPLGDEAQVEARFGPFGDSANLV
Ga0182129_11015211	3300015323	Miscanthus Phyllosphere	AQKSFWMLPMVLGDKAQVEARFGPFGDIANLDAR*
Ga0182187_10692321	3300015341	Miscanthus Phyllosphere	PSAQKSFWTNPLGLLDDESQVKPHFGPFGDSANLDAR*
Ga0182187_10716331	3300015341	Miscanthus Phyllosphere	AQKSFWTHSMVPLGDEAQLEARFGPFGHSAILDER*
Ga0182187_10854151	3300015341	Miscanthus Phyllosphere	QARKLFRTHPMELLGDEAQVEARFGPFVDSANLDVR*
Ga0182187_11380651	3300015341	Miscanthus Phyllosphere	QKSFWTHSMVPLGDEAQVEARFGPFGDSANVVPR*
Ga0182187_11438421	3300015341	Miscanthus Phyllosphere	ARFAPNVPSAQKSFWTHPMVLLGDEAQVKACFGPFGEIANLDTR*
Ga0182187_11594111	3300015341	Miscanthus Phyllosphere	AQKSFWTHPMVLVGDEAQAEARFGPFGGGANLVAR*
Ga0182187_11848091	3300015341	Miscanthus Phyllosphere	ARFAPIVPSTQKSFWTHPMVPLGDEAQVEAHFGPFGDIANLDAR*
Ga0182109_10776381	3300015342	Miscanthus Phyllosphere	QKSFWSHPMVPLGDEAQVEAHFGTFGDSANLNAR*
Ga0182109_11078821	3300015342	Miscanthus Phyllosphere	IGARVVPNVPEAQKSFWTHSMVPLGDEAQLEAHFGLFKDCANLDAR*
Ga0182109_11221021	3300015342	Miscanthus Phyllosphere	AQKSFWTHPMVLLGDEAQVDARFGLFGDSANLDTR*
Ga0182109_11941691	3300015342	Miscanthus Phyllosphere	FAPNVPSAQKSFLMHPLGLLGDEAQVKARFNLFGDSANLDAR*
Ga0182109_12163381	3300015342	Miscanthus Phyllosphere	LRKSFWTHPMVLQGDETQVEARFGLFGDSANLDVR*
Ga0182155_10435581	3300015343	Miscanthus Phyllosphere	KTGAQFVPNVPSAQKSFWTHPMVLQGDGAQVEAPFGPFRDIANPNAR*
Ga0182155_10720491	3300015343	Miscanthus Phyllosphere	AQKSFWTHPMVLLRDEAQVEARFGPFGDSANLDAR*
Ga0182155_11107371	3300015343	Miscanthus Phyllosphere	FAPNVPWAQKSFWTHPMVLLGDEAQVEACFGPFGDSANLDAR*
Ga0182155_11390432	3300015343	Miscanthus Phyllosphere	VCADIPLAQKSFWTHPTVPLGDVAQVEAHFGQFGGSANLDAR*
Ga0182155_11619921	3300015343	Miscanthus Phyllosphere	RKSFWTHPMELLGDEGHVESCFGPFGDSANLDER*
Ga0182155_11888781	3300015343	Miscanthus Phyllosphere	KAQKSFWTHPMVLLGDEAQVDARFCPFGESANVDAR*
Ga0182155_12028271	3300015343	Miscanthus Phyllosphere	LINRFGHLMVTLGDEAQVEACFGPFGDSANLDAR*
Ga0182155_12077861	3300015343	Miscanthus Phyllosphere	QFLCRFKIGARFAPNVPSAQKSFWTHPMILLGDKALVKAHFGPFGDSANLQAR*
Ga0182155_12095111	3300015343	Miscanthus Phyllosphere	HGRECLRRWKIGARFALDIPYAQKSVGTHSMVPLGYRAQVEARFGPFGNSANLDGR*
Ga0182155_12137001	3300015343	Miscanthus Phyllosphere	VPNVPEAQKLFWTHSMVPLGDEAQVEARFCPSGHSANLDARLVHGLSSVP*
Ga0182189_10328032	3300015344	Miscanthus Phyllosphere	YHRLRKLFWTHSMVPLRDEAQVEAHFGPFGDSPNLDAR*
Ga0182189_10875291	3300015344	Miscanthus Phyllosphere	QKSFWTHSMVPLVDEAQVEACFGLFGDNANLDAR*
Ga0182189_11344721	3300015344	Miscanthus Phyllosphere	IGARFAPNVPSAQKSFWMHPTVRPDDEAQVEDQFGSFRNSANLDAR*
Ga0182189_11962291	3300015344	Miscanthus Phyllosphere	RFVLNVPLAQKSFWTHSMVLLGDEAQVESCFGPFGDSVSNSAR*
Ga0182189_12258501	3300015344	Miscanthus Phyllosphere	PSALKSFWTHPMVLLGDEAQLEARFGPFGDSANLDAR*
Ga0182111_10796611	3300015345	Miscanthus Phyllosphere	KSFWTHPMVLLGDEAPVEACFGPFGDSANLNEREVHGLH*
Ga0182111_10800501	3300015345	Miscanthus Phyllosphere	FVRNVPSAQKSFWTHLTVPLGDEAQVEASFGPFGDSANLVAR*
Ga0182111_11040851	3300015345	Miscanthus Phyllosphere	FAPNVPSAQKSFWTHLTLLLGDEAQVKARFCPFGESANLDAR*
Ga0182111_11167841	3300015345	Miscanthus Phyllosphere	AQKSFWTHLMVPLGDEAQVEAHLGPFKDSANLDAR*
Ga0182111_11237541	3300015345	Miscanthus Phyllosphere	FAPNLPLAQKSFWTHPLVLCSDEAHVKARFGLFGDSANLDTR*
Ga0182111_11774441	3300015345	Miscanthus Phyllosphere	PLAQKSFWTHPLGLLGDEAQVKAHFGLFGDSANLEAR*
Ga0182111_11991011	3300015345	Miscanthus Phyllosphere	AQKSFWTHLMVPLGDEAQVEAHFGPFEGSANLDAR*
Ga0182111_12207491	3300015345	Miscanthus Phyllosphere	VPLAQKSFWTHPLGLLGYEAQVKAHFSPFGDSANLDTR*
Ga0182111_12303091	3300015345	Miscanthus Phyllosphere	QKSFWTHSMVPLGDEAQVEARFGPFKHSANLDAR*
Ga0182111_12398922	3300015345	Miscanthus Phyllosphere	CKIGARVVPNVPEAQKSFWTHSMVPLGDEALVEARFCSFGHSANLDAR*
Ga0182139_10178891	3300015346	Miscanthus Phyllosphere	FVTNEPEAQKSFWTHSMVPLGGVAQMEASFGPFGHCANLDAR*
Ga0182139_10376123	3300015346	Miscanthus Phyllosphere	CKIGARFVPNVPSAEKSFWIHPMVLLGDEAQLEGCFGLFGDSANLHAR*
Ga0182139_11108611	3300015346	Miscanthus Phyllosphere	DVPYSQKLFWRHLMVPLGDEAQVEARFSPFVDKANLEAR*
Ga0182139_11599781	3300015346	Miscanthus Phyllosphere	ISVRFAPNIPLAQKSFWTHPKIVLVDEAQVEACFGLFGNSANLGAR*
Ga0182139_11657921	3300015346	Miscanthus Phyllosphere	VPNVPLAQKSFWTHPMVLLGDEAQVDACFSLFGDSANLDARYVQAL
Ga0182139_11827641	3300015346	Miscanthus Phyllosphere	PNKPEAQKSFWTHSMVPLGDEAQVEARFGPFGDSANLDAR*
Ga0182139_12021071	3300015346	Miscanthus Phyllosphere	AYKSFWTHPMVPLGDEAQVEAHFVPFGDSANLDAR*
Ga0182139_12105301	3300015346	Miscanthus Phyllosphere	CKIGARVVPNVPEAQKSFWTHSMVPLGDEAQVEAHFGPFEDCANLDAR*
Ga0182139_12172001	3300015346	Miscanthus Phyllosphere	QKSFWMHPMVPLGDEAQVEARFSPFRDSANLDAR*
Ga0182139_12246711	3300015346	Miscanthus Phyllosphere	MGALFTPNIPSAQKSFWTHPIVPQVDGAQVEGRFGP
Ga0182177_10028961	3300015347	Miscanthus Phyllosphere	IVPKVPEAQKSFWTHSMVPLGDEAQVEARFSPFGDRANLDAR*
Ga0182177_10394821	3300015347	Miscanthus Phyllosphere	VSSAQKSFWTHPMVPLGYKAQVKARFGPFGDSANLDAR*
Ga0182177_11381311	3300015347	Miscanthus Phyllosphere	KIGAWFALDVPYAQKSFWSLPMVPLIDEAQAEAHFGTFGDSANLDAR*
Ga0182177_11389211	3300015347	Miscanthus Phyllosphere	NVPYGQKSFSTIPMVLQGDEAQVVAHFGPFGGSANHDAS*
Ga0182177_11426461	3300015347	Miscanthus Phyllosphere	EAQKSFWTHQLVLQGDEAHVEARFGLFGDSANLDS*
Ga0182177_11561291	3300015347	Miscanthus Phyllosphere	AHKSFWSHPMVPLGDEAQVEAHFSTFGDSANLDAR*
Ga0182177_11750561	3300015347	Miscanthus Phyllosphere	VIGVQFAPNVPSAQKSFWMHPMEPLGDEAQVEARFGPFGNSVSLDAR*
Ga0182177_12504341	3300015347	Miscanthus Phyllosphere	QNSFWTHPMVLQGDETQVETRFDLFGDSANLGVR*
Ga0182161_10507811	3300015351	Miscanthus Phyllosphere	QKSFWTHPVVLLGDNAQVEAHFGLFGYNSNLDAG*
Ga0182161_10819502	3300015351	Miscanthus Phyllosphere	VRNVPEAQKSFWLHSMVPLGDEAQVEARFGPFRHSANLDA
Ga0182161_10863301	3300015351	Miscanthus Phyllosphere	IGARFAPNVPSAQKSFWTHLILLLGDKMQVKARFGPFGESANPDAR*
Ga0182161_11223152	3300015351	Miscanthus Phyllosphere	IGARFVPNVPEAQKSFSTHSMVPPGDEAQVDAPFGSFGHSANLDAR*
Ga0182161_11257131	3300015351	Miscanthus Phyllosphere	IGAWFALDVPYSQKLFWRHLMVPLGDEAQVEARFSPFVDKANLEAR*
Ga0182161_12050182	3300015351	Miscanthus Phyllosphere	AQKSFWTHPMVLLSVEAQVKARFDPFGHSANLDAS*
Ga0182161_12080481	3300015351	Miscanthus Phyllosphere	QKSFWTHPMELIGDVGQVKARLGPFGDSVNLGTI*
Ga0182161_12211001	3300015351	Miscanthus Phyllosphere	AYKSFWTHPMVPLGDEAQVKAHFGPFGDSANLDAR*
Ga0182161_12294721	3300015351	Miscanthus Phyllosphere	QRLFWTHPMVLLGDEAKVEACFRPFGDSANLDTR*
Ga0182159_11368381	3300015355	Miscanthus Phyllosphere	AQKSFWTHPMVLLGDEAQVDASFSPFGDSANLAAR*
Ga0182159_11541561	3300015355	Miscanthus Phyllosphere	CVIGVQFAPNVPSARKSFWMHPMEPLGDEAQVEARFDPFGNSVSLDAI*
Ga0182159_11609981	3300015355	Miscanthus Phyllosphere	AQKSFWTHLMVPLGDEAQVEAHFGPFEGSANLNAR*
Ga0182159_11844671	3300015355	Miscanthus Phyllosphere	CQCKIGAWFAPNVPSAQKSFWTHSMVLLGDEAQVEDRFGLFGDSAKLDAT*
Ga0182159_13168801	3300015355	Miscanthus Phyllosphere	KGARFAPNVPSAQKSFWTHPMVLLGDVGLVESHFYPFGDSVSVSAR*
Ga0182159_13241222	3300015355	Miscanthus Phyllosphere	AQKSFWTHLMVPLGDEAQVEAHFGPFEDSANLDAR*
Ga0182145_10786011	3300015361	Miscanthus Phyllosphere	MICAWFATNVPYAQESFGTLPMVLQGDEAQVEARFGLFGDSGNLEAR*
Ga0182145_10974771	3300015361	Miscanthus Phyllosphere	CEIGAWFAIDVAYAQKSFWTHPMVPLGDEAQVEARFGLFGDKANLDAR*
Ga0182145_11136731	3300015361	Miscanthus Phyllosphere	VPNVLGAQKSFWTHSMVPLGDEAQVEDRFGPFGHSANLDAR
Ga0182145_11804391	3300015361	Miscanthus Phyllosphere	FAQNMPSAKKSFWTHPLGLLGNEAQVKAHFGLFGDSANLDAR*
Ga0182203_10092961	3300017404	Miscanthus Phyllosphere	NVPEAQKSFWTHSMVPLGDEAQVEARFSPFGDRANLDAR
Ga0182203_10276701	3300017404	Miscanthus Phyllosphere	IGAQFAPNIPSAQKSFWTHPLVLRSDEAQVKVRFGPFRDSAHLDTR
Ga0182203_10529501	3300017404	Miscanthus Phyllosphere	VPDVPSAQKSFLTLPLGLLGDEARVKARFSLFGDS
Ga0182203_11162021	3300017404	Miscanthus Phyllosphere	IGAWFAPNVPLAQKSFWTHLTLLLVDEAQVKARFGPFGESANRDAR
Ga0182203_11594061	3300017404	Miscanthus Phyllosphere	RCKIGARFAPNVPSAQKSFWTHPLGLLGDDAQVKAHFGPLGDSATLDAR
Ga0182203_11657332	3300017404	Miscanthus Phyllosphere	MGAWFAPNVPKAQKSFWTHLIVLLGDEAQVEAHFGSFEDCANLD
Ga0182220_10010111	3300017407	Miscanthus Phyllosphere	VPNEPEAQKSFWTHSMVPLGDEAQVEARFGLFGGPFGDSANLDAT
Ga0182220_10296552	3300017407	Miscanthus Phyllosphere	FALDVPYSQKLFWRHLMVPLGDEAQVEARFSPFVDKANLEAR
Ga0182220_10759101	3300017407	Miscanthus Phyllosphere	RCKIGAWFALDIPLAQKSFWTHSMVPLGDEAQVEVHFGPFGHSANLDARSVHGLRRA
Ga0182220_10924031	3300017407	Miscanthus Phyllosphere	VHGFALDVQLGQKSFWMHPMVPLGDVAQVEARLGPFEDCANLDTR
Ga0182220_10961361	3300017407	Miscanthus Phyllosphere	VFNKARKSFWMRAMELLGDEAQVEACFGSVGDSANLDER
Ga0182204_10192251	3300017409	Miscanthus Phyllosphere	ARLAPNVPSTQISFWTHPMVPLGDEAQGEARFGPFGDSANLDAR
Ga0182204_10269641	3300017409	Miscanthus Phyllosphere	KIGARFVPNIPEAQKSFWTHSMVPLGEEAQVEAHLGPSGHSANLDAR
Ga0182204_10801661	3300017409	Miscanthus Phyllosphere	RFVPNVPSAQKSFWMHPMVVLGDEAQPEARFGLFGDSANLHAR
Ga0182204_11134481	3300017409	Miscanthus Phyllosphere	KTGAQFVPNVPSAQKSFWTHPMVLQGDGAQVEAPFGPFGDVANPNAR
Ga0182204_11206431	3300017409	Miscanthus Phyllosphere	KVCAKHTMAQKSFWTHQIVLLGDEAQVEARFGLFGDSDNLDS
Ga0182207_10715061	3300017410	Miscanthus Phyllosphere	IGARFAPDVPSAQKSFLTLPLGLLGDEARVKARFSLFGDSANLDAR
Ga0182207_10875751	3300017410	Miscanthus Phyllosphere	ARFVPKVPSAQKSFWTHRMILLGDETQTEARFGPFGDGANLDAR
Ga0182207_10992382	3300017410	Miscanthus Phyllosphere	AQKSFWTHPLEPLGDETQVEARFGPFQNSANLDAR
Ga0182207_11048961	3300017410	Miscanthus Phyllosphere	IGAQFAPNVPSAQKSFWTHPFVLRSDEAQVKARFGLFGDSANLDTR
Ga0182207_11098051	3300017410	Miscanthus Phyllosphere	PNVLEAQKSFWTHSMVPLGDEAQVEAHFSPFGHSANLDAR
Ga0182207_11659861	3300017410	Miscanthus Phyllosphere	GARFAPNVPLAQESFWTHPMVLLGDEAQVEARFCPFGDSANHDVR
Ga0182208_10329971	3300017411	Miscanthus Phyllosphere	GARFAPNVPSAQKSFWTHPMVLLGDEAQVKACFGPFGEIANLDTR
Ga0182208_10511511	3300017411	Miscanthus Phyllosphere	KIGAQFVRNVPSAQKSFWTHLTVPLGDEAQVEARFGLFGDTATLDAR
Ga0182208_11067671	3300017411	Miscanthus Phyllosphere	MIGVRFAQNMPSAKKSFWTHPLGLLGDEAQVKAHFGLFGDSANLDA
Ga0182222_10142212	3300017413	Miscanthus Phyllosphere	VLDVPGAHKSFWTHSMVTLGDEAQVEARFDPFGGSANLDAR
Ga0182222_10736851	3300017413	Miscanthus Phyllosphere	NVPSTQISFWTHPMVPLGDEAQVEARFGPFGDSASLDGR
Ga0182222_10791671	3300017413	Miscanthus Phyllosphere	AQKSFWTHPMVLLGDEAQVDASFSPFGDSANLDAR
Ga0182222_10904591	3300017413	Miscanthus Phyllosphere	VPNVPEAQKSCWTHSMVPLGDEAQVEAHFGPFEDCANL
Ga0182222_11076241	3300017413	Miscanthus Phyllosphere	PNVQYTQKLFWTHPMVLLSDEAQLVARFGLFGDSVKLNAR
Ga0182202_10332851	3300017415	Miscanthus Phyllosphere	APNVPSTQISFWTHPTVPLGDEAQVEARFGPFGDTANLDAR
Ga0182202_10548912	3300017415	Miscanthus Phyllosphere	VPNVPEAQKLFWTHSMVPLGDEGLVEAHFGPFEYSANLDAR
Ga0182202_10805021	3300017415	Miscanthus Phyllosphere	MVSWFVLDIPLAQKSFWMHTMVPLGDEAQVEACFGT
Ga0182230_10316051	3300017417	Miscanthus Phyllosphere	AQKLFWTHSEVPLGDEAQVEAHFGPFEDSANVVAR
Ga0182230_10464621	3300017417	Miscanthus Phyllosphere	VPNVPEAQNSFWTHSMVPLGEEAQVEARFGPFGHSANLDAR
Ga0182228_10259131	3300017420	Miscanthus Phyllosphere	MGALFTPNVPSALKSFWTHPIVPQGDGAQVEGRFGPFGHSANHD
Ga0182228_10393951	3300017420	Miscanthus Phyllosphere	AQKSFWTHSMVPLGDEAQVEAHFGPFGHSANLDAR
Ga0182228_10574511	3300017420	Miscanthus Phyllosphere	VIDVPKAKKSFWTHLMVPLGDEAEVKAHFGPLEDSANLDAR
Ga0182228_10666761	3300017420	Miscanthus Phyllosphere	IPQAQKSFWTHLMLPLGDKAQVEACFGPFGHSANLDAR
Ga0182228_10891551	3300017420	Miscanthus Phyllosphere	KKGAQFAPNVPSAQKLFWSHPMVLLVDEAQVKARYSLFGDSANLDAR
Ga0182228_11281211	3300017420	Miscanthus Phyllosphere	EIGAQFVPNVPSAQKSFWTHPFVLRSDEAQVKARFGPFGDSANLDTR
Ga0182219_10334001	3300017424	Miscanthus Phyllosphere	VPEAQKSFWTHSMVPLGDEAQVEACFGLFRDSANLEA
Ga0182219_10542193	3300017424	Miscanthus Phyllosphere	AQKLFWTHPMELLGDEAQVEARFGPFGNSVSVGTT
Ga0182219_11158011	3300017424	Miscanthus Phyllosphere	VQKSLWTHSMEPLGDEAQVEARFGPFKHSANHDAR
Ga0182219_11211241	3300017424	Miscanthus Phyllosphere	VLDVPGAHKSFWTHSMVTLGDEAQVEARFGPFGDSANLDAR
Ga0182224_10400492	3300017425	Miscanthus Phyllosphere	VLDVPGAHKSFWTHSMVTLGDEAQVEARFDPFGDSANLDAR
Ga0182224_10423671	3300017425	Miscanthus Phyllosphere	AHFAPNVPLAQKSFWTHSMVPLGDEAQVKAHFSPFGDSAHVDAR
Ga0182224_10638881	3300017425	Miscanthus Phyllosphere	TQISFWTNSTVPLVDEAQVEARFRPFGDSANLDAR
Ga0182224_10992942	3300017425	Miscanthus Phyllosphere	IGARFAPNVPSVQKSFWTHPLVLLGDEAQVKARFGLFGDSANLYAR
Ga0182224_11109091	3300017425	Miscanthus Phyllosphere	VPNVPSAQKSFWMHPTVLLGDETQVKAHFGPFGESPNLDTRQVHGLRRMC
Ga0182224_11229931	3300017425	Miscanthus Phyllosphere	CKIGAWFAPNVPYAQNSFWTHPMVLQGDETQVEARFDLFGDSANLGLR
Ga0182190_10183371	3300017427	Miscanthus Phyllosphere	VIDVPKAEKSFWTHLMAPLGDKAEVKAHFGPLEDSANLDAR
Ga0182190_10281572	3300017427	Miscanthus Phyllosphere	CKIGAWFALDIPKAQKSFWTHSMVPLVDEAQVEACFGLFGDSANLDAR
Ga0182190_10480031	3300017427	Miscanthus Phyllosphere	ARFAPNVPSAQKSFWTHPMVLLGDEAQVKACFRPFGESANLDTR
Ga0182190_10627152	3300017427	Miscanthus Phyllosphere	VVPNVPEAQKSFWTHSMVPRGNEAQVEARFGPFGHSANLDAR
Ga0182190_10704661	3300017427	Miscanthus Phyllosphere	AQKLFWTHSMVPLVDEVQVEARVGPFLDSANLNAR
Ga0182190_11598372	3300017427	Miscanthus Phyllosphere	VPNEPEAQKSFWMDSMVPLSDEAQVEACFGPLGHSANLDA
Ga0182190_11598671	3300017427	Miscanthus Phyllosphere	VPNVPEAQKSFWTHSMVPLGDEALLEARFGPFGHSANL
Ga0182192_10487082	3300017430	Miscanthus Phyllosphere	CKKGARFAPNVPSAQKSFWTHPMVLLGDEAQVKACFRPFGESANLDTR
Ga0182192_10543081	3300017430	Miscanthus Phyllosphere	AQKSSWMHPMVLLDDEAQVEARFGPFGESANLDARLALIVP
Ga0182192_10556541	3300017430	Miscanthus Phyllosphere	CKIGAHFAPNVPLAQKSFWTHSMVPLGDEAQVKAHFSPFGDSAHVDAR
Ga0182192_10723341	3300017430	Miscanthus Phyllosphere	RIGARFAPNVPSAQKLFSMHPMVLLGDEAQVKARFGPFGESANLDTR
Ga0182192_10748581	3300017430	Miscanthus Phyllosphere	QFAPNVTSAQKSFWTHPIVPLGEEAQVEARFGPFEHSANFDAR
Ga0182192_10755531	3300017430	Miscanthus Phyllosphere	SQISFWTHPMVPLGDEAQVEARFGPFGDSANLDAR
Ga0182192_11310141	3300017430	Miscanthus Phyllosphere	AQKSFWTHLMLPLGDKAQVEARFGPFGKSANLNAR
Ga0182192_11392951	3300017430	Miscanthus Phyllosphere	LAQKSFWSHPMVPLGDEAQVEAHFGTFGDSANLDAR
Ga0182206_10321202	3300017433	Miscanthus Phyllosphere	VPIVPEAQKLFWTHSMVPLGDEALLEARFGPFGHSANLDARLV
Ga0182206_11063081	3300017433	Miscanthus Phyllosphere	ALDVPLAQKSFWTHSMVPIGDEAQQEACFGPFGHSANLDIR
Ga0182206_11137251	3300017433	Miscanthus Phyllosphere	ARFVPNVLVAQKSFWTHSMVPLGDEAQVEARFGPFGHSVNLDAR
Ga0182206_11164401	3300017433	Miscanthus Phyllosphere	NVPSAQKSFWTHPFVLRSDEAQVKARFGLFGDSANLDTR
Ga0182206_11336811	3300017433	Miscanthus Phyllosphere	AQKSFWTQPMVLLDDEAQVEAHFGPFGDSANIDVR
Ga0182209_10794841	3300017436	Miscanthus Phyllosphere	AHKSFWTYPMELLGDEAQVEARLGPFGDSANLDTR
Ga0182209_11241231	3300017436	Miscanthus Phyllosphere	GARVVPNVPEAQKSFWTHSMVPLGDEAQVEAHFGPFEDCANIDAR
Ga0182209_11355261	3300017436	Miscanthus Phyllosphere	VLDIPLAQKSFWMDPTVPLGDEAQAEARFGMFGESANFDGR
Ga0182209_11590822	3300017436	Miscanthus Phyllosphere	AQKLFWTHPAVPLGHEGHVEPRFYMFGDSANLDAR
Ga0182191_10913922	3300017438	Miscanthus Phyllosphere	APNVPSAQKSFWTHPMVLLGDEAQVKARFGPFGDSANLFTR
Ga0182191_11179631	3300017438	Miscanthus Phyllosphere	VLDVPGAHKSFWTHSMVTLGDEAQVEARFDPFGDSANLD
Ga0182191_11298641	3300017438	Miscanthus Phyllosphere	RRCKIGERFAPNVPKGQKLFWTHPMVLLGEEAQVEDRFSPFRDSGNIDARWVHSLR
Ga0182191_11491961	3300017438	Miscanthus Phyllosphere	VLDIPLAQKSFWMHPTVPLGDEAQVEARFGTFGDSANFD
Ga0182191_11710141	3300017438	Miscanthus Phyllosphere	IGAWFAPNVPSAQKSFWTHLTLLLGDEAQVKARFCPFGESVNLDAR
Ga0182191_11814601	3300017438	Miscanthus Phyllosphere	AQKLFWTHSMVPLGNVAHVEAHFDPFGHSANLDAR
Ga0182221_10115651	3300017442	Miscanthus Phyllosphere	KIFARFVPNVLVAQKSFWTHSMVPLGDEAQVEARFGPFGHSANLDAR
Ga0182221_10232721	3300017442	Miscanthus Phyllosphere	NVPSAQKSFWTHPIVPLGDEAQVEGRFGPFGHSANLDAR
Ga0182221_10386492	3300017442	Miscanthus Phyllosphere	CRCKIVARFAPNVPSAQKSFWTHPMGLLGDEAQSKARFGPFGDSANLDAR
Ga0182221_10428352	3300017442	Miscanthus Phyllosphere	FAPNVPSAQKSFWTHPMVLLGDEAQVKALFGPFGDGANLDAR
Ga0182221_10901242	3300017442	Miscanthus Phyllosphere	RCKIGARFAPNVPSTQKSFWTHPMVPLGDEAQVEAHFGSFGDIANLDVR
Ga0182221_10962341	3300017442	Miscanthus Phyllosphere	VPSAQKSFWTHSMVPLGDEAQVEARFGPFGDSANLDAR
Ga0182221_11086661	3300017442	Miscanthus Phyllosphere	VPEAQKSFWTHSMVPLGDEAQVEAHFGPFGHSANLDAR
Ga0182221_11496561	3300017442	Miscanthus Phyllosphere	AQKSFWTHPMVPLDDEAQVEACFSPFGDSVNLETR
Ga0182193_11689421	3300017443	Miscanthus Phyllosphere	VSNVPQAQKSFWTDPMVPLGDGAHVEAQFGPFGDNANLD
Ga0182193_11744531	3300017443	Miscanthus Phyllosphere	LDIPLAQKSFWTHSMVPLGDEAQVEAHFGPFVHSANLDAR
Ga0182233_10713481	3300017680	Miscanthus Phyllosphere	IGARFVPNGPEAQKSFWTHSIVPLGDEAQVEACFGPFGHSANLDAR
Ga0182233_10985461	3300017680	Miscanthus Phyllosphere	AQISFWTLSMIPLGDEAQVEARFGPFGHSANPDAR
Ga0182233_11118902	3300017680	Miscanthus Phyllosphere	AQKSFWTHSMVPLGDEAQVEARFGPFGDSANVVAG
Ga0182226_10486361	3300017681	Miscanthus Phyllosphere	PNIPSAQKSFWTHPMVLLGDEAQVEARFDPFGDSANLDAR
Ga0182229_10451641	3300017682	Miscanthus Phyllosphere	VPNVPEAQKSFWTHSMVPLGDEAQVEAHFGPFEDCANRDAR
Ga0182229_10689562	3300017682	Miscanthus Phyllosphere	VPNVPSAQKLFWTHGTVPLGDEAQVEARFSPFGDSA
Ga0182218_10212801	3300017683	Miscanthus Phyllosphere	PYSQKLFWRHLMVPLGDEAQVEAHFSPFVDKANLEAR
Ga0182218_10756371	3300017683	Miscanthus Phyllosphere	PSAQKPFWTHPIVPLGDEAQVEAGFGPFGHSANVDAR
Ga0182218_10916511	3300017683	Miscanthus Phyllosphere	RCKVGAWFAPNVSSTQKSFSTHSTVPLGDDAQVEARFGPFGDSANLDAR
Ga0182218_11545111	3300017683	Miscanthus Phyllosphere	AWFAQDIPLAQKSFWTHSMVPLGDEAQVEAHFGPFGHSANLAAR
Ga0182225_10202111	3300017684	Miscanthus Phyllosphere	VPEAQKSFWTHSMVPLGDEAQVEARFSPFGDRANLDAR
Ga0182227_10607551	3300017685	Miscanthus Phyllosphere	FASNVPSAQKSFWTDLMVLLGDETQVKARFGPFGESANLDTR
Ga0182227_10837851	3300017685	Miscanthus Phyllosphere	VPNEPEAQKSFWTHSMVPLGDEAQVEARFGPFGDSANLDAR
Ga0182227_11322941	3300017685	Miscanthus Phyllosphere	VPNVPSAQKSFWPHLIIPLGDKAQVEARFGPFEHS
Ga0182205_10722671	3300017686	Miscanthus Phyllosphere	PLTQISFWTHPTVPLGDEARVEARFGPFGDSANLDAT
Ga0182231_10107412	3300017689	Miscanthus Phyllosphere	VLDIPLAQKLFWMQPTVPLGDEAQVEAHFGTFGDSANFDTR
Ga0182231_11128921	3300017689	Miscanthus Phyllosphere	PNVPSALKSFWTHPTVLLGDEAQVEAHFDPFGDSSNLDA
Ga0182223_10386801	3300017690	Miscanthus Phyllosphere	VPNVPSAQKSFWMHPTVRPDDEAQVEARFGPFGHSANLDA
Ga0182223_10614971	3300017690	Miscanthus Phyllosphere	AQKSFWTHSMVPIGDEAQPEACFGPFGHSANLDTR
Ga0182223_10636841	3300017690	Miscanthus Phyllosphere	EAQKSFWTHSMVPLGDETQVEARFGPFGHSANLDAR
Ga0182223_10799421	3300017690	Miscanthus Phyllosphere	APNVPSAQKSFWTHPLGLLGDEAQVKARFSTFGDSANLDIG
Ga0182223_10956222	3300017690	Miscanthus Phyllosphere	VHGLRQNVPQAQKSFWTHLIVLLGEEAQVEPCFGLFGDSANLDARLV
Ga0182223_11040551	3300017690	Miscanthus Phyllosphere	FALDIPLAQKSFWTHSMVPLGDEAQVEAHFGPFGHSANLDARSVHGLRRA
Ga0182223_11113371	3300017690	Miscanthus Phyllosphere	IDARVVPNVPEAQKSFWTHSMVPLGDEAQMEARFDPFGHSANLDAR
Ga0182223_11140551	3300017690	Miscanthus Phyllosphere	LAYKSFWTHPMVPLGDEALVEACFGLFGDSANLDAR
Ga0182223_11145661	3300017690	Miscanthus Phyllosphere	VLDIPLAQKSFWMDPTVPLGDEAQTEARFSMFGDSANFDGR
Ga0182232_10281951	3300021060	Phyllosphere	VPNEPEAEKSFWTHPTVPLGDQAQVEARFGLFGDSANLDAR
Ga0182232_10423661	3300021060	Phyllosphere	AQKLFKTHPMVPLGDEAQVEALFGPFGHSTNLDTR
Ga0182232_10458161	3300021060	Phyllosphere	WFDLDIPLAHKSFWTHSMVPLGDEAQVEAHFGLFGHSANIDVR
Ga0182232_10523022	3300021060	Phyllosphere	AQKLFWTHLMVPLGDEAQVEARFGHFGHSANLDAR
Ga0182232_10694472	3300021060	Phyllosphere	IQCLCRCKIGAWFAPNVPQAQKSFWTQPMELLDDEAQVEARFSTFGDSANIDVR
Ga0182232_10761771	3300021060	Phyllosphere	HGFAPNVPSNQKSFWTHPMVPLGDEAQVEARFGPFGDIANLDAR
Ga0207643_109579661	3300025908	Miscanthus Rhizosphere	VPNVPSAQKAFWTHPMEPQGDDAQVEARFGPFGNSANLDAR
Ga0207691_114145832	3300025940	Miscanthus Rhizosphere	VLVAQKSFWTHSMVPLGDEAQVEARFGPFGHSANIDAR
Ga0207689_113258971	3300025942	Miscanthus Rhizosphere	VPSTQKSFWTNPIVPLGDEAQMEARFGPFGDSANLNAR
Ga0207677_105275851	3300026023	Miscanthus Rhizosphere	VLDIPLAQKSFWMHPTVPLGDEAQVEAHFGTFGEC
Ga0207677_107778923	3300026023	Miscanthus Rhizosphere	ARFAPNVPSAQKSFWTHPMVLLGDEAQVEARFDPFGDSANLDAR
Ga0207677_118384021	3300026023	Miscanthus Rhizosphere	APNVPKAHKSFWTHLMVVLGDEAQVEARFVLFGDSANLDAR
Ga0207677_119965841	3300026023	Miscanthus Rhizosphere	AQKSFWTHPMVLQGDEAQVDTCFSPFGDSANLDAR
Ga0207648_104936331	3300026089	Miscanthus Rhizosphere	IVSWFVLDIPLAQKSFWMHPTVPLGVEAQVEAHFGTFGDSANFDTR
Ga0207675_1026032451	3300026118	Switchgrass Rhizosphere	IVPNVPEAQKLFWTHSMVPLGDEAQVEARFGPFGHSANLDTR

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.20
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.20
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F005049

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign