Metagenome / Metatranscriptome Family F005073

Basic Information
Family ID	F005073
Family Type	Metagenome / Metatranscriptome
Number of Sequences	413
Average Sequence Length	46 residues
Representative Sequence	MSGGWLIVFVGVFVAGLIGLFLYGWLRRKEKPPPGVKPLKDDDDW
Number of Associated Samples	256
Number of Associated Scaffolds	413

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	29.20 %
% of genes near scaffold ends (potentially truncated)	24.46 %
% of genes from short scaffolds (< 2000 bps)	80.87 %
Associated GOLD sequencing projects	241
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.53

Most Common Taxonomy
Group	Bacteria (82.567 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.138 % of family members)
Environment Ontology (ENVO)	Unclassified (30.266 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (34.383 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 36.99% β-sheet: 0.00% Coil/Unstructured: 63.01%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 413 Family Scaffolds
PF03401	TctC	26.15
PF07075	DUF1343	10.90
PF13577	SnoaL_4	8.47
PF01070	FMN_dh	7.99
PF07883	Cupin_2	4.12
PF13231	PMT_2	3.87
PF00975	Thioesterase	2.42
PF13193	AMP-binding_C	1.21
PF02366	PMT	0.97
PF00920	ILVD_EDD	0.97
PF01370	Epimerase	0.97
PF00072	Response_reg	0.73
PF01464	SLT	0.73
PF00550	PP-binding	0.48
PF13519	VWA_2	0.48
PF01041	DegT_DnrJ_EryC1	0.48
PF00106	adh_short	0.24
PF13091	PLDc_2	0.24
PF00092	VWA	0.24
PF03480	DctP	0.24
PF06808	DctM	0.24
PF03992	ABM	0.24
PF01408	GFO_IDH_MocA	0.24
PF13560	HTH_31	0.24
PF15943	YdaS_antitoxin	0.24
PF02518	HATPase_c	0.24
PF07726	AAA_3	0.24
PF00216	Bac_DNA_binding	0.24

COG ID	Name	Functional Category	% Frequency in 413 Family Scaffolds
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	26.15
COG3876	Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family	Cell wall/membrane/envelope biogenesis [M]	10.90
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	7.99
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	7.99
COG0129	Dihydroxyacid dehydratase/phosphogluconate dehydratase	Carbohydrate transport and metabolism [G]	1.94
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.48
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.48
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.48
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.48
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	0.48
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.48
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.24

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.81 %
Unclassified	root	N/A	17.19 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.81 %
Unclassified	root	N/A	17.19 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	82.57 %
Unclassified	root	N/A	17.19 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.24 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	59.08 %
Unclassified	root	N/A	17.19 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.24 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.24 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	35.59 %
Unclassified	root	N/A	17.19 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.24 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	9.20 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	4.36 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	2.42 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
unclassified Burkholderiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	2.42 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Grewioideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Apeibeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Corchorus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	17.19 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.66 %
Polynucleobacter rarus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	2.42 %
Corchorus olitorius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	0.24 %
Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	0.24 %
Alcaligenaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	0.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.24 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.24 %
Burkholderiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	0.73 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.73 %
Betaproteobacteria bacterium HGW-Betaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	0.73 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.73 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.73 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090015\|GPICI_9186841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1197	Open in IMG/M
3300000956\|JGI10216J12902_100217547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	778	Open in IMG/M
3300001686\|C688J18823_10186533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1407	Open in IMG/M
3300001686\|C688J18823_10244165	All Organisms → cellular organisms → Bacteria	1196	Open in IMG/M
3300003319\|soilL2_10010272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3645	Open in IMG/M
3300003319\|soilL2_10069439	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300003324\|soilH2_10110159	All Organisms → cellular organisms → Bacteria → Proteobacteria	1153	Open in IMG/M
3300004022\|Ga0055432_10006545	All Organisms → cellular organisms → Bacteria	2029	Open in IMG/M
3300004114\|Ga0062593_101019631	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	850	Open in IMG/M
3300004114\|Ga0062593_101487964	All Organisms → cellular organisms → Bacteria	729	Open in IMG/M
3300004156\|Ga0062589_100947691	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	798	Open in IMG/M
3300004156\|Ga0062589_101838893	Not Available	609	Open in IMG/M
3300004157\|Ga0062590_100065334	All Organisms → cellular organisms → Bacteria → Proteobacteria	2116	Open in IMG/M
3300004157\|Ga0062590_102470971	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	550	Open in IMG/M
3300004463\|Ga0063356_100010219	All Organisms → cellular organisms → Bacteria → Proteobacteria	8402	Open in IMG/M
3300004463\|Ga0063356_100131900	All Organisms → cellular organisms → Bacteria → Proteobacteria	2802	Open in IMG/M
3300004463\|Ga0063356_100137154	All Organisms → cellular organisms → Bacteria → Proteobacteria	2755	Open in IMG/M
3300004463\|Ga0063356_100190886	All Organisms → cellular organisms → Bacteria → Proteobacteria	2401	Open in IMG/M
3300004463\|Ga0063356_100242445	All Organisms → cellular organisms → Bacteria → Proteobacteria	2175	Open in IMG/M
3300004463\|Ga0063356_100396141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1773	Open in IMG/M
3300004463\|Ga0063356_100910828	All Organisms → cellular organisms → Bacteria	1243	Open in IMG/M
3300004463\|Ga0063356_100926295	Not Available	1234	Open in IMG/M
3300004463\|Ga0063356_101122274	All Organisms → cellular organisms → Bacteria → Proteobacteria	1135	Open in IMG/M
3300004480\|Ga0062592_101693469	All Organisms → cellular organisms → Bacteria	615	Open in IMG/M
3300004782\|Ga0062382_10275180	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300004798\|Ga0058859_11320720	All Organisms → cellular organisms → Bacteria → Proteobacteria	629	Open in IMG/M
3300005093\|Ga0062594_100108440	All Organisms → cellular organisms → Bacteria → Proteobacteria	1685	Open in IMG/M
3300005093\|Ga0062594_102514283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	566	Open in IMG/M
3300005294\|Ga0065705_10049864	All Organisms → cellular organisms → Bacteria → Proteobacteria	1205	Open in IMG/M
3300005294\|Ga0065705_10374090	Not Available	906	Open in IMG/M
3300005294\|Ga0065705_10703556	Not Available	651	Open in IMG/M
3300005328\|Ga0070676_10732276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	724	Open in IMG/M
3300005330\|Ga0070690_100523147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	890	Open in IMG/M
3300005330\|Ga0070690_100674314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	792	Open in IMG/M
3300005332\|Ga0066388_100165019	Not Available	2809	Open in IMG/M
3300005332\|Ga0066388_102009068	All Organisms → cellular organisms → Bacteria → Proteobacteria	1037	Open in IMG/M
3300005332\|Ga0066388_103846425	All Organisms → cellular organisms → Bacteria → Proteobacteria	766	Open in IMG/M
3300005336\|Ga0070680_100249330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1501	Open in IMG/M
3300005336\|Ga0070680_100383400	All Organisms → cellular organisms → Bacteria → Proteobacteria	1197	Open in IMG/M
3300005338\|Ga0068868_100586995	All Organisms → cellular organisms → Bacteria → Proteobacteria	986	Open in IMG/M
3300005341\|Ga0070691_10944660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	535	Open in IMG/M
3300005406\|Ga0070703_10463877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	563	Open in IMG/M
3300005438\|Ga0070701_10724097	All Organisms → cellular organisms → Bacteria	671	Open in IMG/M
3300005440\|Ga0070705_100021606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3425	Open in IMG/M
3300005444\|Ga0070694_100006938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6882	Open in IMG/M
3300005444\|Ga0070694_100457515	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1009	Open in IMG/M
3300005444\|Ga0070694_100631020	All Organisms → cellular organisms → Bacteria → Proteobacteria	866	Open in IMG/M
3300005444\|Ga0070694_100776752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	784	Open in IMG/M
3300005446\|Ga0066686_10482077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	845	Open in IMG/M
3300005450\|Ga0066682_10404507	All Organisms → cellular organisms → Bacteria → Proteobacteria	874	Open in IMG/M
3300005455\|Ga0070663_100244735	All Organisms → cellular organisms → Bacteria	1417	Open in IMG/M
3300005526\|Ga0073909_10207967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	849	Open in IMG/M
3300005526\|Ga0073909_10267896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	765	Open in IMG/M
3300005545\|Ga0070695_101610298	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	542	Open in IMG/M
3300005546\|Ga0070696_101533951	All Organisms → cellular organisms → Bacteria → Proteobacteria	571	Open in IMG/M
3300005549\|Ga0070704_101933477	Not Available	547	Open in IMG/M
3300005576\|Ga0066708_10704981	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300005617\|Ga0068859_103146605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	503	Open in IMG/M
3300005618\|Ga0068864_100032498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4434	Open in IMG/M
3300005713\|Ga0066905_100013455	All Organisms → cellular organisms → Bacteria → Proteobacteria	4038	Open in IMG/M
3300005713\|Ga0066905_100486519	All Organisms → cellular organisms → Bacteria	1023	Open in IMG/M
3300005713\|Ga0066905_102055788	Not Available	531	Open in IMG/M
3300005764\|Ga0066903_102936863	Not Available	924	Open in IMG/M
3300005842\|Ga0068858_101351605	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300006046\|Ga0066652_101158071	Not Available	732	Open in IMG/M
3300006163\|Ga0070715_10728699	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300006574\|Ga0074056_10004011	All Organisms → cellular organisms → Bacteria → Proteobacteria	1304	Open in IMG/M
3300006574\|Ga0074056_11736480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	742	Open in IMG/M
3300006577\|Ga0074050_12049499	All Organisms → cellular organisms → Bacteria → Proteobacteria	970	Open in IMG/M
3300006605\|Ga0074057_11997721	All Organisms → cellular organisms → Bacteria → Proteobacteria	742	Open in IMG/M
3300006797\|Ga0066659_10210442	Not Available	1430	Open in IMG/M
3300006844\|Ga0075428_100004106	All Organisms → cellular organisms → Bacteria → Proteobacteria	16026	Open in IMG/M
3300006844\|Ga0075428_100101225	All Organisms → cellular organisms → Bacteria → Proteobacteria	3141	Open in IMG/M
3300006844\|Ga0075428_100670543	Not Available	1105	Open in IMG/M
3300006844\|Ga0075428_101008011	All Organisms → cellular organisms → Bacteria	881	Open in IMG/M
3300006845\|Ga0075421_100012234	All Organisms → cellular organisms → Bacteria → Proteobacteria	10654	Open in IMG/M
3300006845\|Ga0075421_101790826	Not Available	661	Open in IMG/M
3300006845\|Ga0075421_101944729	All Organisms → cellular organisms → Bacteria → Proteobacteria	628	Open in IMG/M
3300006846\|Ga0075430_100115440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2237	Open in IMG/M
3300006846\|Ga0075430_100436382	Not Available	1081	Open in IMG/M
3300006853\|Ga0075420_100306595	All Organisms → cellular organisms → Bacteria	1376	Open in IMG/M
3300006854\|Ga0075425_101383306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	797	Open in IMG/M
3300006871\|Ga0075434_100602297	All Organisms → cellular organisms → Bacteria → Proteobacteria	1118	Open in IMG/M
3300006871\|Ga0075434_101937873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	595	Open in IMG/M
3300006871\|Ga0075434_102064378	Not Available	575	Open in IMG/M
3300006876\|Ga0079217_10001464	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6398	Open in IMG/M
3300006876\|Ga0079217_10047939	All Organisms → cellular organisms → Bacteria	1699	Open in IMG/M
3300006876\|Ga0079217_10258031	All Organisms → cellular organisms → Bacteria	936	Open in IMG/M
3300006876\|Ga0079217_10273337	All Organisms → cellular organisms → Bacteria	918	Open in IMG/M
3300006876\|Ga0079217_10549915	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300006876\|Ga0079217_10615250	Not Available	709	Open in IMG/M
3300006880\|Ga0075429_101043220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	714	Open in IMG/M
3300006894\|Ga0079215_10231654	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	963	Open in IMG/M
3300006894\|Ga0079215_10337644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	854	Open in IMG/M
3300006894\|Ga0079215_10361062	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300006894\|Ga0079215_10563037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	731	Open in IMG/M
3300006894\|Ga0079215_10569690	All Organisms → cellular organisms → Bacteria	729	Open in IMG/M
3300006894\|Ga0079215_10960566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	622	Open in IMG/M
3300006918\|Ga0079216_10504148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	800	Open in IMG/M
3300006918\|Ga0079216_11195953	All Organisms → cellular organisms → Bacteria	610	Open in IMG/M
3300006969\|Ga0075419_10154534	All Organisms → cellular organisms → Bacteria	1502	Open in IMG/M
3300007004\|Ga0079218_10015965	All Organisms → cellular organisms → Bacteria → Proteobacteria	3919	Open in IMG/M
3300007004\|Ga0079218_10115852	All Organisms → cellular organisms → Bacteria → Proteobacteria	1879	Open in IMG/M
3300007004\|Ga0079218_10533920	Not Available	1049	Open in IMG/M
3300007004\|Ga0079218_10929260	Not Available	859	Open in IMG/M
3300007004\|Ga0079218_12452229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	615	Open in IMG/M
3300007004\|Ga0079218_12639194	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300007004\|Ga0079218_12723573	Not Available	590	Open in IMG/M
3300007076\|Ga0075435_101225520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	657	Open in IMG/M
3300007076\|Ga0075435_101665890	Not Available	560	Open in IMG/M
3300007265\|Ga0099794_10003056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	6319	Open in IMG/M
3300009053\|Ga0105095_10118557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1439	Open in IMG/M
3300009053\|Ga0105095_10478455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	690	Open in IMG/M
3300009078\|Ga0105106_10027506	All Organisms → cellular organisms → Bacteria → Proteobacteria	4199	Open in IMG/M
3300009078\|Ga0105106_10505887	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	868	Open in IMG/M
3300009078\|Ga0105106_11215390	Not Available	535	Open in IMG/M
3300009078\|Ga0105106_11329486	Not Available	510	Open in IMG/M
3300009087\|Ga0105107_10087819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	2190	Open in IMG/M
3300009087\|Ga0105107_10183194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1469	Open in IMG/M
3300009088\|Ga0099830_10492106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	999	Open in IMG/M
3300009089\|Ga0099828_10407640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1226	Open in IMG/M
3300009089\|Ga0099828_11275146	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	650	Open in IMG/M
3300009094\|Ga0111539_10014798	All Organisms → cellular organisms → Bacteria → Proteobacteria	9730	Open in IMG/M
3300009094\|Ga0111539_10803359	All Organisms → cellular organisms → Bacteria → Proteobacteria	1095	Open in IMG/M
3300009095\|Ga0079224_100097143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4268	Open in IMG/M
3300009098\|Ga0105245_10963364	All Organisms → cellular organisms → Bacteria → Proteobacteria	896	Open in IMG/M
3300009100\|Ga0075418_11217116	All Organisms → cellular organisms → Bacteria → Proteobacteria	816	Open in IMG/M
3300009100\|Ga0075418_12262056	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300009137\|Ga0066709_100379935	All Organisms → cellular organisms → Bacteria → Proteobacteria	1952	Open in IMG/M
3300009147\|Ga0114129_10160203	All Organisms → cellular organisms → Bacteria	3075	Open in IMG/M
3300009147\|Ga0114129_10873245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1142	Open in IMG/M
3300009147\|Ga0114129_11116816	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300009153\|Ga0105094_10504026	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	704	Open in IMG/M
3300009156\|Ga0111538_12127750	All Organisms → cellular organisms → Bacteria → Proteobacteria	705	Open in IMG/M
3300009162\|Ga0075423_10323758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1616	Open in IMG/M
3300009166\|Ga0105100_10670497	Not Available	638	Open in IMG/M
3300009171\|Ga0105101_10012674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4013	Open in IMG/M
3300009597\|Ga0105259_1028925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1186	Open in IMG/M
3300009597\|Ga0105259_1134628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	597	Open in IMG/M
3300009609\|Ga0105347_1023879	All Organisms → cellular organisms → Bacteria	2111	Open in IMG/M
3300009609\|Ga0105347_1539343	Not Available	508	Open in IMG/M
3300009610\|Ga0105340_1000449	All Organisms → cellular organisms → Bacteria → Proteobacteria	19927	Open in IMG/M
3300009678\|Ga0105252_10024872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2164	Open in IMG/M
3300010039\|Ga0126309_11293633	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	505	Open in IMG/M
3300010045\|Ga0126311_11177605	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	633	Open in IMG/M
3300010047\|Ga0126382_10474198	Not Available	998	Open in IMG/M
3300010333\|Ga0134080_10436974	Not Available	611	Open in IMG/M
3300010362\|Ga0126377_10746518	All Organisms → cellular organisms → Bacteria → Proteobacteria	1034	Open in IMG/M
3300010362\|Ga0126377_11067063	Not Available	876	Open in IMG/M
3300010371\|Ga0134125_11124617	All Organisms → cellular organisms → Bacteria	859	Open in IMG/M
3300010399\|Ga0134127_10267161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1630	Open in IMG/M
3300010399\|Ga0134127_10287963	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Grewioideae → Apeibeae → Corchorus → Corchorus olitorius	1576	Open in IMG/M
3300010399\|Ga0134127_11001045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	896	Open in IMG/M
3300010399\|Ga0134127_11076531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	867	Open in IMG/M
3300010399\|Ga0134127_11102170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	858	Open in IMG/M
3300010399\|Ga0134127_11462059	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	755	Open in IMG/M
3300010399\|Ga0134127_12232596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	626	Open in IMG/M
3300010400\|Ga0134122_10253409	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1488	Open in IMG/M
3300010401\|Ga0134121_10222226	All Organisms → cellular organisms → Bacteria → Proteobacteria	1641	Open in IMG/M
3300010403\|Ga0134123_10104378	All Organisms → cellular organisms → Bacteria	2263	Open in IMG/M
3300010403\|Ga0134123_11774000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	670	Open in IMG/M
3300011269\|Ga0137392_10370593	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1187	Open in IMG/M
3300011333\|Ga0127502_10234354	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	710	Open in IMG/M
3300011398\|Ga0137348_1020826	All Organisms → cellular organisms → Bacteria	1027	Open in IMG/M
3300011399\|Ga0137466_1013287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1021	Open in IMG/M
3300011402\|Ga0137356_1019550	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1218	Open in IMG/M
3300011403\|Ga0137313_1013312	All Organisms → cellular organisms → Bacteria	1318	Open in IMG/M
3300011405\|Ga0137340_1010998	All Organisms → cellular organisms → Bacteria → Proteobacteria	1627	Open in IMG/M
3300011413\|Ga0137333_1043085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	1020	Open in IMG/M
3300011415\|Ga0137325_1002389	All Organisms → cellular organisms → Bacteria → Proteobacteria	4057	Open in IMG/M
3300011417\|Ga0137326_1006820	All Organisms → cellular organisms → Bacteria → Proteobacteria	2667	Open in IMG/M
3300011430\|Ga0137423_1005244	All Organisms → cellular organisms → Bacteria	4118	Open in IMG/M
3300011432\|Ga0137428_1018538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	1747	Open in IMG/M
3300011432\|Ga0137428_1021051	All Organisms → cellular organisms → Bacteria	1638	Open in IMG/M
3300011434\|Ga0137464_1016584	All Organisms → cellular organisms → Bacteria	1936	Open in IMG/M
3300011434\|Ga0137464_1040207	All Organisms → cellular organisms → Bacteria → Proteobacteria	1293	Open in IMG/M
3300011438\|Ga0137451_1147472	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	735	Open in IMG/M
3300011438\|Ga0137451_1281579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	522	Open in IMG/M
3300011439\|Ga0137432_1100953	Not Available	904	Open in IMG/M
3300011442\|Ga0137437_1081266	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae	1107	Open in IMG/M
3300011444\|Ga0137463_1021939	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2292	Open in IMG/M
3300011445\|Ga0137427_10048181	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1683	Open in IMG/M
3300011445\|Ga0137427_10062012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1483	Open in IMG/M
3300011993\|Ga0120182_1006545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	765	Open in IMG/M
3300012034\|Ga0137453_1030303	All Organisms → cellular organisms → Bacteria	909	Open in IMG/M
3300012039\|Ga0137421_1249371	Not Available	514	Open in IMG/M
3300012122\|Ga0137332_1036325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	576	Open in IMG/M
3300012159\|Ga0137344_1009388	All Organisms → cellular organisms → Bacteria	1439	Open in IMG/M
3300012161\|Ga0137336_1015964	All Organisms → cellular organisms → Bacteria → Proteobacteria	1314	Open in IMG/M
3300012163\|Ga0137355_1033368	All Organisms → cellular organisms → Bacteria → Proteobacteria	950	Open in IMG/M
3300012167\|Ga0137319_1040357	Not Available	934	Open in IMG/M
3300012189\|Ga0137388_10925462	Not Available	806	Open in IMG/M
3300012189\|Ga0137388_11255341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	679	Open in IMG/M
3300012204\|Ga0137374_10031120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	5833	Open in IMG/M
3300012206\|Ga0137380_10427700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1173	Open in IMG/M
3300012212\|Ga0150985_106013023	All Organisms → cellular organisms → Bacteria → Proteobacteria	1374	Open in IMG/M
3300012232\|Ga0137435_1040754	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1356	Open in IMG/M
3300012469\|Ga0150984_103002690	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	555	Open in IMG/M
3300012469\|Ga0150984_112057625	All Organisms → cellular organisms → Bacteria → Proteobacteria	961	Open in IMG/M
3300012469\|Ga0150984_116218916	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	537	Open in IMG/M
3300012685\|Ga0137397_10084716	All Organisms → cellular organisms → Bacteria → Proteobacteria	2310	Open in IMG/M
3300012897\|Ga0157285_10054516	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300012905\|Ga0157296_10055680	All Organisms → cellular organisms → Bacteria	948	Open in IMG/M
3300012907\|Ga0157283_10072858	All Organisms → cellular organisms → Bacteria → Proteobacteria	853	Open in IMG/M
3300012908\|Ga0157286_10176465	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300012910\|Ga0157308_10021185	All Organisms → cellular organisms → Bacteria → Proteobacteria	1462	Open in IMG/M
3300012922\|Ga0137394_10234341	All Organisms → cellular organisms → Bacteria → Proteobacteria	1569	Open in IMG/M
3300012944\|Ga0137410_10000360	All Organisms → cellular organisms → Bacteria → Proteobacteria	31942	Open in IMG/M
3300012958\|Ga0164299_10844452	All Organisms → cellular organisms → Bacteria → Proteobacteria	658	Open in IMG/M
3300012960\|Ga0164301_10588594	Not Available	819	Open in IMG/M
3300012971\|Ga0126369_12437786	All Organisms → cellular organisms → Bacteria → Proteobacteria	609	Open in IMG/M
3300013100\|Ga0157373_10738474	All Organisms → cellular organisms → Bacteria → Proteobacteria	723	Open in IMG/M
3300013297\|Ga0157378_12557265	All Organisms → cellular organisms → Bacteria → Proteobacteria	563	Open in IMG/M
3300013307\|Ga0157372_11380640	Not Available	812	Open in IMG/M
3300014308\|Ga0075354_1003912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1884	Open in IMG/M
3300014864\|Ga0180068_1070281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	584	Open in IMG/M
3300014868\|Ga0180088_1078283	Not Available	593	Open in IMG/M
3300014871\|Ga0180095_1084156	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300014872\|Ga0180087_1101385	Not Available	552	Open in IMG/M
3300014879\|Ga0180062_1114351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	618	Open in IMG/M
3300014968\|Ga0157379_12151833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	553	Open in IMG/M
3300015084\|Ga0167654_1047281	All Organisms → cellular organisms → Bacteria → Proteobacteria	595	Open in IMG/M
3300015170\|Ga0120098_1058208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	559	Open in IMG/M
3300015200\|Ga0173480_10911710	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300015245\|Ga0137409_10452467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1104	Open in IMG/M
3300015371\|Ga0132258_10388799	All Organisms → cellular organisms → Bacteria → Proteobacteria	3462	Open in IMG/M
3300015371\|Ga0132258_11046630	All Organisms → cellular organisms → Bacteria → Proteobacteria	2063	Open in IMG/M
3300015372\|Ga0132256_100078232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3155	Open in IMG/M
3300018027\|Ga0184605_10064814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1573	Open in IMG/M
3300018027\|Ga0184605_10128132	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1133	Open in IMG/M
3300018028\|Ga0184608_10475948	Not Available	536	Open in IMG/M
3300018056\|Ga0184623_10195064	All Organisms → cellular organisms → Bacteria	932	Open in IMG/M
3300018422\|Ga0190265_10014009	All Organisms → cellular organisms → Bacteria	6164	Open in IMG/M
3300018422\|Ga0190265_10023448	All Organisms → cellular organisms → Bacteria → Proteobacteria	4977	Open in IMG/M
3300018422\|Ga0190265_10023609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4962	Open in IMG/M
3300018422\|Ga0190265_10037354	All Organisms → cellular organisms → Bacteria → Proteobacteria	4106	Open in IMG/M
3300018422\|Ga0190265_10163089	All Organisms → cellular organisms → Bacteria	2197	Open in IMG/M
3300018422\|Ga0190265_10337765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1589	Open in IMG/M
3300018422\|Ga0190265_10469732	All Organisms → cellular organisms → Bacteria	1367	Open in IMG/M
3300018422\|Ga0190265_10863846	All Organisms → cellular organisms → Bacteria	1027	Open in IMG/M
3300018422\|Ga0190265_13773185	Not Available	505	Open in IMG/M
3300018429\|Ga0190272_10004319	All Organisms → cellular organisms → Bacteria → Proteobacteria	6769	Open in IMG/M
3300018429\|Ga0190272_10016394	All Organisms → cellular organisms → Bacteria	3755	Open in IMG/M
3300018429\|Ga0190272_10596518	All Organisms → cellular organisms → Bacteria	967	Open in IMG/M
3300018429\|Ga0190272_11480655	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300018429\|Ga0190272_11725580	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	649	Open in IMG/M
3300018429\|Ga0190272_11836835	Not Available	634	Open in IMG/M
3300018429\|Ga0190272_12539769	Not Available	559	Open in IMG/M
3300018432\|Ga0190275_10359233	All Organisms → cellular organisms → Bacteria → Proteobacteria	1452	Open in IMG/M
3300018432\|Ga0190275_10533301	All Organisms → cellular organisms → Bacteria	1212	Open in IMG/M
3300018465\|Ga0190269_11028407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	626	Open in IMG/M
3300018466\|Ga0190268_11406636	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300018466\|Ga0190268_11873140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	544	Open in IMG/M
3300018468\|Ga0066662_12673113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	528	Open in IMG/M
3300018469\|Ga0190270_10402187	Not Available	1268	Open in IMG/M
3300018469\|Ga0190270_11514309	All Organisms → cellular organisms → Bacteria	720	Open in IMG/M
3300018476\|Ga0190274_10406986	All Organisms → cellular organisms → Bacteria → Proteobacteria	1322	Open in IMG/M
3300019208\|Ga0180110_1036762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	592	Open in IMG/M
3300019257\|Ga0180115_1344283	All Organisms → cellular organisms → Bacteria	687	Open in IMG/M
3300019361\|Ga0173482_10738347	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300019377\|Ga0190264_10028247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2001	Open in IMG/M
3300019377\|Ga0190264_10254254	All Organisms → cellular organisms → Bacteria	1022	Open in IMG/M
3300019377\|Ga0190264_10556903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	804	Open in IMG/M
3300019377\|Ga0190264_11219303	Not Available	627	Open in IMG/M
3300019458\|Ga0187892_10006495	All Organisms → cellular organisms → Bacteria → Proteobacteria	17298	Open in IMG/M
3300019884\|Ga0193741_1017296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	1857	Open in IMG/M
3300020066\|Ga0180108_1229125	Not Available	511	Open in IMG/M
3300020146\|Ga0196977_1113628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	624	Open in IMG/M
3300020147\|Ga0196976_1024954	Not Available	1360	Open in IMG/M
3300020202\|Ga0196964_10013727	All Organisms → cellular organisms → Bacteria → Proteobacteria	3365	Open in IMG/M
3300020202\|Ga0196964_10034518	All Organisms → cellular organisms → Bacteria	2105	Open in IMG/M
3300020202\|Ga0196964_10235485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	855	Open in IMG/M
3300020202\|Ga0196964_10281257	Not Available	785	Open in IMG/M
3300020202\|Ga0196964_10338934	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	717	Open in IMG/M
3300020202\|Ga0196964_10473561	Not Available	610	Open in IMG/M
3300020215\|Ga0196963_10023494	All Organisms → cellular organisms → Bacteria → Proteobacteria	2642	Open in IMG/M
3300020215\|Ga0196963_10150509	Not Available	994	Open in IMG/M
3300020215\|Ga0196963_10217361	All Organisms → cellular organisms → Bacteria	829	Open in IMG/M
3300021057\|Ga0196981_1045897	All Organisms → cellular organisms → Bacteria → Proteobacteria	659	Open in IMG/M
3300021066\|Ga0196980_1012209	Not Available	1314	Open in IMG/M
3300021066\|Ga0196980_1052514	All Organisms → cellular organisms → Bacteria	680	Open in IMG/M
3300021082\|Ga0210380_10266789	All Organisms → cellular organisms → Bacteria → Proteobacteria	777	Open in IMG/M
3300022756\|Ga0222622_11335133	Not Available	528	Open in IMG/M
3300023102\|Ga0247754_1133986	All Organisms → cellular organisms → Bacteria	611	Open in IMG/M
3300024177\|Ga0247686_1000644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4706	Open in IMG/M
3300024177\|Ga0247686_1052615	All Organisms → cellular organisms → Bacteria → Proteobacteria	508	Open in IMG/M
3300024317\|Ga0247660_1012541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1303	Open in IMG/M
3300024430\|Ga0196962_10262073	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300025155\|Ga0209320_10030528	All Organisms → cellular organisms → Bacteria → Proteobacteria	2603	Open in IMG/M
3300025167\|Ga0209642_10173121	All Organisms → cellular organisms → Bacteria	1247	Open in IMG/M
3300025893\|Ga0207682_10302632	All Organisms → cellular organisms → Bacteria	750	Open in IMG/M
3300025901\|Ga0207688_10105397	All Organisms → cellular organisms → Bacteria	1632	Open in IMG/M
3300025917\|Ga0207660_10094893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2218	Open in IMG/M
3300025917\|Ga0207660_10333664	All Organisms → cellular organisms → Bacteria	1213	Open in IMG/M
3300025918\|Ga0207662_10039769	All Organisms → cellular organisms → Bacteria → Proteobacteria	2760	Open in IMG/M
3300025923\|Ga0207681_10362452	Not Available	1163	Open in IMG/M
3300025930\|Ga0207701_11000399	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300025949\|Ga0207667_10725581	Not Available	995	Open in IMG/M
3300025960\|Ga0207651_11592772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	588	Open in IMG/M
3300026075\|Ga0207708_10234406	All Organisms → cellular organisms → Bacteria	1474	Open in IMG/M
3300026088\|Ga0207641_10448772	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1246	Open in IMG/M
3300026088\|Ga0207641_11164844	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	770	Open in IMG/M
3300026118\|Ga0207675_100716147	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1010	Open in IMG/M
3300026300\|Ga0209027_1255198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14	562	Open in IMG/M
3300026342\|Ga0209057_1212272	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300027533\|Ga0208185_1001297	All Organisms → cellular organisms → Bacteria	7329	Open in IMG/M
3300027543\|Ga0209999_1060454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	721	Open in IMG/M
3300027573\|Ga0208454_1006910	All Organisms → cellular organisms → Bacteria → Proteobacteria	3049	Open in IMG/M
3300027637\|Ga0209818_1004797	All Organisms → cellular organisms → Bacteria	2614	Open in IMG/M
3300027637\|Ga0209818_1034067	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300027637\|Ga0209818_1128165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	695	Open in IMG/M
3300027639\|Ga0209387_1101029	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	707	Open in IMG/M
3300027639\|Ga0209387_1166545	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300027639\|Ga0209387_1218068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	531	Open in IMG/M
3300027664\|Ga0207873_1129184	All Organisms → cellular organisms → Bacteria → Proteobacteria	773	Open in IMG/M
3300027695\|Ga0209966_1001941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3467	Open in IMG/M
3300027695\|Ga0209966_1008012	All Organisms → cellular organisms → Bacteria	1865	Open in IMG/M
3300027713\|Ga0209286_1073214	Not Available	1282	Open in IMG/M
3300027723\|Ga0209703_1026158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium HGW-Betaproteobacteria-13	2229	Open in IMG/M
3300027778\|Ga0209464_10069233	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300027818\|Ga0209706_10108994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium	1376	Open in IMG/M
3300027821\|Ga0209811_10008845	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3238	Open in IMG/M
3300027821\|Ga0209811_10223931	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	714	Open in IMG/M
3300027873\|Ga0209814_10228601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	805	Open in IMG/M
3300027873\|Ga0209814_10322586	Not Available	674	Open in IMG/M
3300027880\|Ga0209481_10001551	All Organisms → cellular organisms → Bacteria → Proteobacteria	9315	Open in IMG/M
3300027880\|Ga0209481_10284015	Not Available	838	Open in IMG/M
3300027880\|Ga0209481_10770044	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300027886\|Ga0209486_10040016	All Organisms → cellular organisms → Bacteria	2304	Open in IMG/M
3300027886\|Ga0209486_10252935	Not Available	1019	Open in IMG/M
3300027886\|Ga0209486_10510841	Not Available	748	Open in IMG/M
3300027886\|Ga0209486_10517006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	744	Open in IMG/M
3300027907\|Ga0207428_10038497	All Organisms → cellular organisms → Bacteria → Proteobacteria	3887	Open in IMG/M
3300027909\|Ga0209382_11936436	Not Available	568	Open in IMG/M
3300027909\|Ga0209382_12053793	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	546	Open in IMG/M
3300027979\|Ga0209705_10241667	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	935	Open in IMG/M
3300027979\|Ga0209705_10565808	Not Available	547	Open in IMG/M
3300028380\|Ga0268265_10151526	All Organisms → cellular organisms → Bacteria → Proteobacteria	1956	Open in IMG/M
3300028381\|Ga0268264_10066470	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3040	Open in IMG/M
3300028381\|Ga0268264_11692047	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300028592\|Ga0247822_10166186	All Organisms → cellular organisms → Bacteria → Proteobacteria	1633	Open in IMG/M
3300028592\|Ga0247822_10288677	All Organisms → cellular organisms → Bacteria	1251	Open in IMG/M
3300028809\|Ga0247824_10017229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3839	Open in IMG/M
3300028809\|Ga0247824_10073963	Not Available	1772	Open in IMG/M
3300028812\|Ga0247825_10018376	All Organisms → cellular organisms → Bacteria	4565	Open in IMG/M
3300028812\|Ga0247825_10081363	All Organisms → cellular organisms → Bacteria → Proteobacteria	2178	Open in IMG/M
3300028812\|Ga0247825_10331946	Not Available	1066	Open in IMG/M
3300028812\|Ga0247825_10490860	Not Available	873	Open in IMG/M
3300028812\|Ga0247825_11390944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	514	Open in IMG/M
3300030006\|Ga0299907_10006147	All Organisms → cellular organisms → Bacteria → Proteobacteria	8187	Open in IMG/M
3300030006\|Ga0299907_11105270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	575	Open in IMG/M
3300030619\|Ga0268386_10956662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	531	Open in IMG/M
3300031229\|Ga0299913_10059405	All Organisms → cellular organisms → Bacteria → Proteobacteria	3669	Open in IMG/M
3300031547\|Ga0310887_10106770	All Organisms → cellular organisms → Bacteria	1398	Open in IMG/M
3300031547\|Ga0310887_10944631	Not Available	548	Open in IMG/M
3300031548\|Ga0307408_100229133	All Organisms → cellular organisms → Bacteria	1520	Open in IMG/M
3300031548\|Ga0307408_100625935	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300031548\|Ga0307408_101581979	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300031562\|Ga0310886_10264283	Not Available	969	Open in IMG/M
3300031720\|Ga0307469_12291995	All Organisms → cellular organisms → Bacteria → Proteobacteria	526	Open in IMG/M
3300031731\|Ga0307405_10897327	All Organisms → cellular organisms → Bacteria → Proteobacteria	749	Open in IMG/M
3300031731\|Ga0307405_11502876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	592	Open in IMG/M
3300031731\|Ga0307405_11650464	Not Available	567	Open in IMG/M
3300031740\|Ga0307468_100179203	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1404	Open in IMG/M
3300031740\|Ga0307468_100206219	All Organisms → cellular organisms → Bacteria	1336	Open in IMG/M
3300031740\|Ga0307468_100657638	Not Available	867	Open in IMG/M
3300031740\|Ga0307468_101299001	All Organisms → cellular organisms → Bacteria → Proteobacteria	662	Open in IMG/M
3300031740\|Ga0307468_101838656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	575	Open in IMG/M
3300031740\|Ga0307468_102159001	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300031820\|Ga0307473_10481018	Not Available	834	Open in IMG/M
3300031824\|Ga0307413_11265656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	644	Open in IMG/M
3300031852\|Ga0307410_10447549	All Organisms → cellular organisms → Bacteria	1053	Open in IMG/M
3300031854\|Ga0310904_10573951	Not Available	766	Open in IMG/M
3300031901\|Ga0307406_10686345	All Organisms → cellular organisms → Bacteria	854	Open in IMG/M
3300031911\|Ga0307412_11744572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	571	Open in IMG/M
3300031943\|Ga0310885_10643450	Not Available	591	Open in IMG/M
3300031944\|Ga0310884_10905156	All Organisms → cellular organisms → Bacteria → Proteobacteria	544	Open in IMG/M
3300032000\|Ga0310903_10847053	All Organisms → cellular organisms → Bacteria → Proteobacteria	503	Open in IMG/M
3300032002\|Ga0307416_100259965	All Organisms → cellular organisms → Bacteria	1696	Open in IMG/M
3300032002\|Ga0307416_102990483	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300032005\|Ga0307411_10187399	All Organisms → cellular organisms → Bacteria → Proteobacteria	1576	Open in IMG/M
3300032005\|Ga0307411_10242517	All Organisms → cellular organisms → Bacteria	1412	Open in IMG/M
3300032005\|Ga0307411_10822013	Not Available	820	Open in IMG/M
3300032005\|Ga0307411_11681326	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	587	Open in IMG/M
3300032013\|Ga0310906_10018423	All Organisms → cellular organisms → Bacteria → Proteobacteria	2915	Open in IMG/M
3300032013\|Ga0310906_11022100	All Organisms → cellular organisms → Bacteria → Proteobacteria	595	Open in IMG/M
3300032017\|Ga0310899_10082482	All Organisms → cellular organisms → Bacteria	1261	Open in IMG/M
3300032017\|Ga0310899_10686052	All Organisms → cellular organisms → Bacteria → Proteobacteria	519	Open in IMG/M
3300032126\|Ga0307415_101562893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	633	Open in IMG/M
3300032144\|Ga0315910_10017370	All Organisms → cellular organisms → Bacteria	5393	Open in IMG/M
3300032144\|Ga0315910_10030802	All Organisms → cellular organisms → Bacteria	3934	Open in IMG/M
3300032144\|Ga0315910_10095906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2175	Open in IMG/M
3300032157\|Ga0315912_11068978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	640	Open in IMG/M
3300032174\|Ga0307470_10671357	Not Available	785	Open in IMG/M
3300032174\|Ga0307470_11314890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	593	Open in IMG/M
3300032180\|Ga0307471_101502488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	832	Open in IMG/M
3300032180\|Ga0307471_102835127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	615	Open in IMG/M
3300032180\|Ga0307471_102946547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	604	Open in IMG/M
3300032205\|Ga0307472_100239632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1413	Open in IMG/M
3300032205\|Ga0307472_100614687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter rarus	962	Open in IMG/M
3300032770\|Ga0335085_10020296	All Organisms → cellular organisms → Bacteria	9497	Open in IMG/M
3300033407\|Ga0214472_10767255	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	871	Open in IMG/M
3300033412\|Ga0310810_10574380	All Organisms → cellular organisms → Bacteria	1093	Open in IMG/M
3300033550\|Ga0247829_11168527	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	638	Open in IMG/M
3300033551\|Ga0247830_10986044	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	672	Open in IMG/M
3300034149\|Ga0364929_0110800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	871	Open in IMG/M
3300034150\|Ga0364933_037843	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1183	Open in IMG/M
3300034151\|Ga0364935_0168533	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300034164\|Ga0364940_0267976	All Organisms → cellular organisms → Bacteria → Proteobacteria	506	Open in IMG/M
3300034354\|Ga0364943_0008951	All Organisms → cellular organisms → Bacteria → Proteobacteria	2963	Open in IMG/M
3300034819\|Ga0373958_0042189	Not Available	937	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	76.76%
Host-Associated	Host-Associated	23.00%
Engineered	Engineered	0.24%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	59.56%
Plants	Host-Associated → Plants	22.76%
Aquatic	Environmental → Aquatic	17.19%
Human	Host-Associated → Human	0.24%
Solid Waste	Engineered → Solid Waste	0.24%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	58.11%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.22%
Sediment	Environmental → Aquatic → Sediment	11.38%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.54%
Freshwater	Environmental → Aquatic → Freshwater	5.57%
Floodplain	Environmental → Terrestrial → Floodplain	1.21%
Marine	Environmental → Aquatic → Marine	0.24%
Cave	Environmental → Terrestrial → Cave	0.24%
Digestive System	Host-Associated → Human → Digestive System	0.24%
Feedstock	Engineered → Solid Waste → Feedstock	0.24%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	11.38%
Loam	Environmental → Terrestrial → Soil → Loam	7.26%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.81%
Sediment	Environmental → Aquatic → Freshwater → Sediment	4.84%
Sand	Environmental → Terrestrial → Soil → Sand	3.63%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.42%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.21%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.73%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.48%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.48%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.24%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.24%
Fossil	Environmental → Terrestrial → Soil → Fossil	0.24%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.24%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.24%
Composting	Engineered → Solid Waste → Feedstock → Composting	0.24%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.52%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	11.38%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	10.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.81%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.33%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	4.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.84%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.36%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.15%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	3.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.69%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.21%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.73%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.48%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.48%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.48%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.48%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.24%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.24%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.24%
Unclassified	Environmental → Terrestrial → Soil → Fossil → Unclassified	0.24%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.24%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.24%
Unclassified	Engineered → Solid Waste → Feedstock → Composting → Unclassified	0.24%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.14%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	10.17%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.47%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	7.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	4.12%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.87%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.15%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.15%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.63%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	3.63%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.91%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	2.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.18%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.18%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.18%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.21%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.21%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.97%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.97%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.97%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.97%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.97%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.73%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.73%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.73%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.73%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.73%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.48%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.48%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.48%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.48%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.48%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.48%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.24%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.24%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.24%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.24%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil	0.24%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.24%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.24%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.24%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.24%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.24%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.24%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.24%
Fossill	Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill	0.24%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	0.24%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.24%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.24%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.24%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.24%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.24%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.24%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.24%
Feedstock Adapted Compost	Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost	0.24%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090015	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300003319	Sugarcane bulk soil Sample L2	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300004022	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004782	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh	Environmental	Open in IMG/M
3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005294	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006574	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006577	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006605	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009095	Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009597	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299	Environmental	Open in IMG/M
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300011398	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2	Environmental	Open in IMG/M
3300011399	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2	Environmental	Open in IMG/M
3300011402	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2	Environmental	Open in IMG/M
3300011403	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2	Environmental	Open in IMG/M
3300011405	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2	Environmental	Open in IMG/M
3300011413	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2	Environmental	Open in IMG/M
3300011415	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2	Environmental	Open in IMG/M
3300011417	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2	Environmental	Open in IMG/M
3300011430	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2	Environmental	Open in IMG/M
3300011432	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2	Environmental	Open in IMG/M
3300011434	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2	Environmental	Open in IMG/M
3300011438	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2	Environmental	Open in IMG/M
3300011439	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2	Environmental	Open in IMG/M
3300011442	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2	Environmental	Open in IMG/M
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental	Open in IMG/M
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental	Open in IMG/M
3300011993	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1	Environmental	Open in IMG/M
3300012034	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2	Environmental	Open in IMG/M
3300012039	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2	Environmental	Open in IMG/M
3300012122	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT200_2	Environmental	Open in IMG/M
3300012159	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2	Environmental	Open in IMG/M
3300012160	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2	Environmental	Open in IMG/M
3300012161	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2	Environmental	Open in IMG/M
3300012163	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2	Environmental	Open in IMG/M
3300012167	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012232	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental	Open in IMG/M
3300012905	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012908	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1	Environmental	Open in IMG/M
3300012910	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014308	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1	Environmental	Open in IMG/M
3300014864	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D	Environmental	Open in IMG/M
3300014868	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D	Environmental	Open in IMG/M
3300014871	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1Da	Environmental	Open in IMG/M
3300014872	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D	Environmental	Open in IMG/M
3300014879	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015084	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)	Environmental	Open in IMG/M
3300015170	Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48	Environmental	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019208	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019257	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300019884	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2	Environmental	Open in IMG/M
3300020066	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020146	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C	Environmental	Open in IMG/M
3300020147	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C	Environmental	Open in IMG/M
3300020202	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10	Environmental	Open in IMG/M
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental	Open in IMG/M
3300021057	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_20-13C	Environmental	Open in IMG/M
3300021066	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3_10-13C	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300023102	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5	Environmental	Open in IMG/M
3300024177	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27	Environmental	Open in IMG/M
3300024317	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01	Environmental	Open in IMG/M
3300024430	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20	Environmental	Open in IMG/M
3300025155	Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4	Environmental	Open in IMG/M
3300025167	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026342	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)	Environmental	Open in IMG/M
3300027533	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)	Environmental	Open in IMG/M
3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027573	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)	Environmental	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027639	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)	Environmental	Open in IMG/M
3300027664	Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes)	Engineered	Open in IMG/M
3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)	Host-Associated	Open in IMG/M
3300027713	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027723	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental	Open in IMG/M
3300027778	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)	Environmental	Open in IMG/M
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300027821	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027979	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028809	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48	Environmental	Open in IMG/M
3300028812	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Host-Associated	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Host-Associated	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033407	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M
3300034150	Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17	Environmental	Open in IMG/M
3300034151	Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17	Environmental	Open in IMG/M
3300034164	Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M
3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.53
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.53
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F005073

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign