Basic Information | |
---|---|
Family ID | F005792 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 390 |
Average Sequence Length | 43 residues |
Representative Sequence | MSKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLEQAAKLKAK |
Number of Associated Samples | 256 |
Number of Associated Scaffolds | 390 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 81.49 % |
% of genes near scaffold ends (potentially truncated) | 31.54 % |
% of genes from short scaffolds (< 2000 bps) | 67.69 % |
Associated GOLD sequencing projects | 231 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.128 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.821 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.897 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.949 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 390 Family Scaffolds |
---|---|---|
PF01165 | Ribosomal_S21 | 15.13 |
PF00072 | Response_reg | 2.31 |
PF03979 | Sigma70_r1_1 | 2.05 |
PF13620 | CarboxypepD_reg | 1.28 |
PF00196 | GerE | 1.03 |
PF05690 | ThiG | 1.03 |
PF08281 | Sigma70_r4_2 | 1.03 |
PF03544 | TonB_C | 1.03 |
PF04551 | GcpE | 1.03 |
PF00501 | AMP-binding | 0.77 |
PF00140 | Sigma70_r1_2 | 0.77 |
PF13545 | HTH_Crp_2 | 0.77 |
PF00011 | HSP20 | 0.77 |
PF00313 | CSD | 0.77 |
PF00484 | Pro_CA | 0.77 |
PF08592 | Anthrone_oxy | 0.77 |
PF00425 | Chorismate_bind | 0.77 |
PF14384 | BrnA_antitoxin | 0.77 |
PF01019 | G_glu_transpept | 0.51 |
PF12779 | WXXGXW | 0.51 |
PF00005 | ABC_tran | 0.51 |
PF01895 | PhoU | 0.51 |
PF09723 | Zn-ribbon_8 | 0.51 |
PF02566 | OsmC | 0.51 |
PF07238 | PilZ | 0.51 |
PF14534 | DUF4440 | 0.51 |
PF13380 | CoA_binding_2 | 0.51 |
PF02922 | CBM_48 | 0.51 |
PF00486 | Trans_reg_C | 0.51 |
PF01521 | Fe-S_biosyn | 0.51 |
PF08240 | ADH_N | 0.51 |
PF06262 | Zincin_1 | 0.51 |
PF13185 | GAF_2 | 0.51 |
PF11645 | PDDEXK_5 | 0.51 |
PF13180 | PDZ_2 | 0.51 |
PF05167 | DUF711 | 0.51 |
PF07676 | PD40 | 0.51 |
PF12002 | MgsA_C | 0.51 |
PF02559 | CarD_CdnL_TRCF | 0.51 |
PF00825 | Ribonuclease_P | 0.26 |
PF00582 | Usp | 0.26 |
PF00149 | Metallophos | 0.26 |
PF11752 | DUF3309 | 0.26 |
PF02669 | KdpC | 0.26 |
PF01979 | Amidohydro_1 | 0.26 |
PF14022 | DUF4238 | 0.26 |
PF13439 | Glyco_transf_4 | 0.26 |
PF13602 | ADH_zinc_N_2 | 0.26 |
PF00578 | AhpC-TSA | 0.26 |
PF01593 | Amino_oxidase | 0.26 |
PF00118 | Cpn60_TCP1 | 0.26 |
PF00392 | GntR | 0.26 |
PF01909 | NTP_transf_2 | 0.26 |
PF00128 | Alpha-amylase | 0.26 |
PF01850 | PIN | 0.26 |
PF01594 | AI-2E_transport | 0.26 |
PF02321 | OEP | 0.26 |
PF12836 | HHH_3 | 0.26 |
PF04715 | Anth_synt_I_N | 0.26 |
PF02518 | HATPase_c | 0.26 |
PF14371 | DUF4412 | 0.26 |
PF00857 | Isochorismatase | 0.26 |
PF00171 | Aldedh | 0.26 |
PF02464 | CinA | 0.26 |
PF02558 | ApbA | 0.26 |
PF10026 | DUF2268 | 0.26 |
PF03693 | ParD_antitoxin | 0.26 |
PF04055 | Radical_SAM | 0.26 |
PF03062 | MBOAT | 0.26 |
PF05015 | HigB-like_toxin | 0.26 |
PF13507 | GATase_5 | 0.26 |
PF01229 | Glyco_hydro_39 | 0.26 |
PF12811 | BaxI_1 | 0.26 |
PF13377 | Peripla_BP_3 | 0.26 |
PF13517 | FG-GAP_3 | 0.26 |
PF03372 | Exo_endo_phos | 0.26 |
PF13289 | SIR2_2 | 0.26 |
PF01479 | S4 | 0.26 |
PF12773 | DZR | 0.26 |
PF07479 | NAD_Gly3P_dh_C | 0.26 |
PF05128 | DUF697 | 0.26 |
PF12704 | MacB_PCD | 0.26 |
PF05569 | Peptidase_M56 | 0.26 |
PF16518 | GrlR | 0.26 |
PF02834 | LigT_PEase | 0.26 |
PF13492 | GAF_3 | 0.26 |
PF01968 | Hydantoinase_A | 0.26 |
PF02685 | Glucokinase | 0.26 |
PF09957 | VapB_antitoxin | 0.26 |
PF05977 | MFS_3 | 0.26 |
PF00117 | GATase | 0.26 |
PF13396 | PLDc_N | 0.26 |
PF08533 | Glyco_hydro_42C | 0.26 |
PF00355 | Rieske | 0.26 |
PF00563 | EAL | 0.26 |
PF03631 | Virul_fac_BrkB | 0.26 |
PF02225 | PA | 0.26 |
PF09286 | Pro-kuma_activ | 0.26 |
PF06559 | DCD | 0.26 |
PF00753 | Lactamase_B | 0.26 |
PF04073 | tRNA_edit | 0.26 |
PF07732 | Cu-oxidase_3 | 0.26 |
PF13490 | zf-HC2 | 0.26 |
PF00795 | CN_hydrolase | 0.26 |
PF01520 | Amidase_3 | 0.26 |
PF00581 | Rhodanese | 0.26 |
PF05235 | CHAD | 0.26 |
PF16193 | AAA_assoc_2 | 0.26 |
PF02472 | ExbD | 0.26 |
PF00665 | rve | 0.26 |
PF04264 | YceI | 0.26 |
PF00589 | Phage_integrase | 0.26 |
PF02449 | Glyco_hydro_42 | 0.26 |
PF01709 | Transcrip_reg | 0.26 |
PF00069 | Pkinase | 0.26 |
PF07730 | HisKA_3 | 0.26 |
PF09349 | OHCU_decarbox | 0.26 |
PF04545 | Sigma70_r4 | 0.26 |
PF00015 | MCPsignal | 0.26 |
COG ID | Name | Functional Category | % Frequency in 390 Family Scaffolds |
---|---|---|---|
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 15.13 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.82 |
COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 1.03 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.03 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.03 |
COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 1.03 |
COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 1.03 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 1.03 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.77 |
COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 0.51 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.51 |
COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 0.51 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.51 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.51 |
COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.51 |
COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 0.51 |
COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.51 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.26 |
COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.26 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.26 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.26 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG0594 | RNase P protein component | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.26 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.26 |
COG0837 | Glucokinase | Carbohydrate transport and metabolism [G] | 0.26 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.26 |
COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.26 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.26 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.26 |
COG1514 | RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase) | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.26 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.26 |
COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.26 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.26 |
COG2156 | K+-transporting ATPase, KdpC subunit | Inorganic ion transport and metabolism [P] | 0.26 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.26 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.26 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.26 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.26 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.26 |
COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.26 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.26 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.26 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.26 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.26 |
COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.26 |
COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.26 |
COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 0.26 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.26 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.26 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.26 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.26 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.26 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.26 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.26 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.26 |
COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.64 % |
Unclassified | root | N/A | 24.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ02GUACV | Not Available | 518 | Open in IMG/M |
2189573004|GZGWRS401D0SJ1 | Not Available | 512 | Open in IMG/M |
3300000567|JGI12270J11330_10011947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5711 | Open in IMG/M |
3300000567|JGI12270J11330_10015716 | All Organisms → cellular organisms → Bacteria | 4845 | Open in IMG/M |
3300000567|JGI12270J11330_10047688 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
3300000567|JGI12270J11330_10170013 | Not Available | 786 | Open in IMG/M |
3300001100|JGI12703J13194_101106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1267 | Open in IMG/M |
3300001154|JGI12636J13339_1003945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2452 | Open in IMG/M |
3300001154|JGI12636J13339_1005498 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300001593|JGI12635J15846_10070388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2590 | Open in IMG/M |
3300001593|JGI12635J15846_10123840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1822 | Open in IMG/M |
3300001593|JGI12635J15846_10221276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1236 | Open in IMG/M |
3300001593|JGI12635J15846_10520392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 699 | Open in IMG/M |
3300001593|JGI12635J15846_10562317 | Not Available | 667 | Open in IMG/M |
3300001661|JGI12053J15887_10162060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1165 | Open in IMG/M |
3300002568|C688J35102_119681559 | Not Available | 747 | Open in IMG/M |
3300002914|JGI25617J43924_10105543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
3300003218|JGI26339J46600_10000965 | All Organisms → cellular organisms → Bacteria | 9388 | Open in IMG/M |
3300004080|Ga0062385_10042460 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
3300004080|Ga0062385_10243309 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300004080|Ga0062385_10569120 | Not Available | 711 | Open in IMG/M |
3300004082|Ga0062384_100011683 | All Organisms → cellular organisms → Bacteria | 3414 | Open in IMG/M |
3300004082|Ga0062384_101056787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 583 | Open in IMG/M |
3300004091|Ga0062387_100279817 | Not Available | 1062 | Open in IMG/M |
3300004091|Ga0062387_101719551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 510 | Open in IMG/M |
3300004092|Ga0062389_102829302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 648 | Open in IMG/M |
3300004121|Ga0058882_1810951 | Not Available | 626 | Open in IMG/M |
3300004152|Ga0062386_100077541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2533 | Open in IMG/M |
3300004469|Ga0068931_1290706 | Not Available | 520 | Open in IMG/M |
3300004476|Ga0068966_1484066 | Not Available | 705 | Open in IMG/M |
3300004477|Ga0068971_1556701 | Not Available | 534 | Open in IMG/M |
3300004478|Ga0068972_1472431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 533 | Open in IMG/M |
3300004631|Ga0058899_10013549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 574 | Open in IMG/M |
3300004631|Ga0058899_12187473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
3300004631|Ga0058899_12276229 | Not Available | 945 | Open in IMG/M |
3300004631|Ga0058899_12279612 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300004635|Ga0062388_100560625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
3300005167|Ga0066672_10284189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
3300005174|Ga0066680_10108676 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
3300005176|Ga0066679_10002611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7700 | Open in IMG/M |
3300005340|Ga0070689_101121618 | Not Available | 704 | Open in IMG/M |
3300005355|Ga0070671_100785754 | Not Available | 828 | Open in IMG/M |
3300005436|Ga0070713_100083062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2737 | Open in IMG/M |
3300005445|Ga0070708_100257700 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
3300005445|Ga0070708_100303404 | Not Available | 1503 | Open in IMG/M |
3300005446|Ga0066686_10200176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1338 | Open in IMG/M |
3300005467|Ga0070706_100078170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3063 | Open in IMG/M |
3300005467|Ga0070706_100192498 | Not Available | 1905 | Open in IMG/M |
3300005467|Ga0070706_101737996 | Not Available | 568 | Open in IMG/M |
3300005468|Ga0070707_100140819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2347 | Open in IMG/M |
3300005468|Ga0070707_100775246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
3300005468|Ga0070707_100825781 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300005471|Ga0070698_101066647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 756 | Open in IMG/M |
3300005518|Ga0070699_100782890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 873 | Open in IMG/M |
3300005529|Ga0070741_10048968 | All Organisms → cellular organisms → Bacteria | 5184 | Open in IMG/M |
3300005536|Ga0070697_101790139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300005537|Ga0070730_10439026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 842 | Open in IMG/M |
3300005538|Ga0070731_10186920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1376 | Open in IMG/M |
3300005541|Ga0070733_10007781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6903 | Open in IMG/M |
3300005541|Ga0070733_10115978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1719 | Open in IMG/M |
3300005541|Ga0070733_10170813 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300005542|Ga0070732_10752229 | Not Available | 594 | Open in IMG/M |
3300005554|Ga0066661_10411775 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobi bacterium OLB5 | 828 | Open in IMG/M |
3300005568|Ga0066703_10101342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1693 | Open in IMG/M |
3300005586|Ga0066691_10029637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2815 | Open in IMG/M |
3300005591|Ga0070761_10381218 | Not Available | 858 | Open in IMG/M |
3300005602|Ga0070762_10010095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4722 | Open in IMG/M |
3300005602|Ga0070762_10015235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 3931 | Open in IMG/M |
3300005610|Ga0070763_10225084 | Not Available | 1008 | Open in IMG/M |
3300005712|Ga0070764_10040922 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
3300005712|Ga0070764_10387466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
3300005843|Ga0068860_101214982 | Not Available | 774 | Open in IMG/M |
3300005938|Ga0066795_10011453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2414 | Open in IMG/M |
3300005938|Ga0066795_10021904 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300005947|Ga0066794_10001873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5158 | Open in IMG/M |
3300005952|Ga0080026_10123541 | Not Available | 735 | Open in IMG/M |
3300006028|Ga0070717_11269648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300006041|Ga0075023_100050084 | Not Available | 1306 | Open in IMG/M |
3300006041|Ga0075023_100316121 | Not Available | 649 | Open in IMG/M |
3300006050|Ga0075028_100191608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
3300006052|Ga0075029_100070031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2060 | Open in IMG/M |
3300006052|Ga0075029_100402984 | Not Available | 889 | Open in IMG/M |
3300006052|Ga0075029_100928628 | Not Available | 598 | Open in IMG/M |
3300006059|Ga0075017_101104007 | Not Available | 620 | Open in IMG/M |
3300006059|Ga0075017_101210379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300006059|Ga0075017_101536379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 525 | Open in IMG/M |
3300006102|Ga0075015_100002605 | All Organisms → cellular organisms → Bacteria | 7088 | Open in IMG/M |
3300006162|Ga0075030_101354666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 558 | Open in IMG/M |
3300006162|Ga0075030_101571704 | Not Available | 515 | Open in IMG/M |
3300006174|Ga0075014_100221815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 963 | Open in IMG/M |
3300006174|Ga0075014_100289690 | Not Available | 859 | Open in IMG/M |
3300006175|Ga0070712_101379836 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300006176|Ga0070765_100065085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3035 | Open in IMG/M |
3300006176|Ga0070765_101003892 | Not Available | 789 | Open in IMG/M |
3300006354|Ga0075021_11098088 | Not Available | 521 | Open in IMG/M |
3300006642|Ga0075521_10102280 | Not Available | 1315 | Open in IMG/M |
3300006893|Ga0073928_10426172 | Not Available | 965 | Open in IMG/M |
3300006893|Ga0073928_10449088 | Not Available | 933 | Open in IMG/M |
3300007258|Ga0099793_10016494 | All Organisms → cellular organisms → Bacteria | 2964 | Open in IMG/M |
3300008787|Ga0103640_1001884 | Not Available | 605 | Open in IMG/M |
3300009088|Ga0099830_10413057 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300009089|Ga0099828_10026796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4589 | Open in IMG/M |
3300009519|Ga0116108_1083228 | Not Available | 980 | Open in IMG/M |
3300009520|Ga0116214_1012472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3008 | Open in IMG/M |
3300009520|Ga0116214_1264156 | Not Available | 655 | Open in IMG/M |
3300009520|Ga0116214_1401669 | Not Available | 535 | Open in IMG/M |
3300009521|Ga0116222_1420651 | Not Available | 582 | Open in IMG/M |
3300009524|Ga0116225_1191681 | Not Available | 925 | Open in IMG/M |
3300009524|Ga0116225_1444010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 576 | Open in IMG/M |
3300009616|Ga0116111_1069580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
3300009623|Ga0116133_1098920 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300009623|Ga0116133_1136870 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300009631|Ga0116115_1174742 | Not Available | 543 | Open in IMG/M |
3300009632|Ga0116102_1010018 | All Organisms → cellular organisms → Bacteria | 3483 | Open in IMG/M |
3300009632|Ga0116102_1148764 | Not Available | 646 | Open in IMG/M |
3300009633|Ga0116129_1131177 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300009644|Ga0116121_1154172 | Not Available | 726 | Open in IMG/M |
3300009645|Ga0116106_1131763 | Not Available | 803 | Open in IMG/M |
3300009665|Ga0116135_1264395 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300009683|Ga0116224_10524603 | Not Available | 565 | Open in IMG/M |
3300009698|Ga0116216_10302370 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300009698|Ga0116216_10579566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
3300009700|Ga0116217_10365881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
3300009759|Ga0116101_1024752 | Not Available | 1198 | Open in IMG/M |
3300009764|Ga0116134_1011774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3738 | Open in IMG/M |
3300009764|Ga0116134_1170447 | Not Available | 763 | Open in IMG/M |
3300009824|Ga0116219_10242377 | Not Available | 1025 | Open in IMG/M |
3300009824|Ga0116219_10543771 | Not Available | 641 | Open in IMG/M |
3300010339|Ga0074046_10082405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2089 | Open in IMG/M |
3300010341|Ga0074045_10012671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6909 | Open in IMG/M |
3300010341|Ga0074045_10029078 | All Organisms → cellular organisms → Bacteria | 4197 | Open in IMG/M |
3300010341|Ga0074045_10063137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2640 | Open in IMG/M |
3300010341|Ga0074045_10111256 | Not Available | 1887 | Open in IMG/M |
3300010341|Ga0074045_10331961 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300010343|Ga0074044_10001085 | All Organisms → cellular organisms → Bacteria | 25007 | Open in IMG/M |
3300010343|Ga0074044_10280396 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300010343|Ga0074044_10700894 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300010379|Ga0136449_100008642 | All Organisms → cellular organisms → Bacteria | 28721 | Open in IMG/M |
3300010379|Ga0136449_100187814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3960 | Open in IMG/M |
3300010379|Ga0136449_103129391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300011085|Ga0138581_1078480 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300011120|Ga0150983_12835754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 581 | Open in IMG/M |
3300011120|Ga0150983_13663847 | Not Available | 1742 | Open in IMG/M |
3300011120|Ga0150983_14961478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 744 | Open in IMG/M |
3300011269|Ga0137392_10051019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3112 | Open in IMG/M |
3300011269|Ga0137392_10225639 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300011270|Ga0137391_10248649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1542 | Open in IMG/M |
3300011270|Ga0137391_10425695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1132 | Open in IMG/M |
3300011271|Ga0137393_10360966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
3300011271|Ga0137393_10558460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
3300012200|Ga0137382_10194066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1393 | Open in IMG/M |
3300012202|Ga0137363_10295536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1328 | Open in IMG/M |
3300012203|Ga0137399_10187434 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300012205|Ga0137362_10017114 | All Organisms → cellular organisms → Bacteria | 5496 | Open in IMG/M |
3300012205|Ga0137362_10341188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1297 | Open in IMG/M |
3300012210|Ga0137378_10161616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2078 | Open in IMG/M |
3300012210|Ga0137378_11453054 | Not Available | 598 | Open in IMG/M |
3300012361|Ga0137360_10683585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300012361|Ga0137360_11511315 | Not Available | 576 | Open in IMG/M |
3300012362|Ga0137361_10515068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
3300012362|Ga0137361_10537044 | Not Available | 1073 | Open in IMG/M |
3300012362|Ga0137361_11824683 | Not Available | 526 | Open in IMG/M |
3300012685|Ga0137397_10059748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2748 | Open in IMG/M |
3300012917|Ga0137395_10268667 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300012917|Ga0137395_10658079 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300012927|Ga0137416_10558206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
3300014152|Ga0181533_1015018 | All Organisms → cellular organisms → Bacteria | 5421 | Open in IMG/M |
3300014155|Ga0181524_10034157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3456 | Open in IMG/M |
3300014155|Ga0181524_10054704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2495 | Open in IMG/M |
3300014159|Ga0181530_10115966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
3300014161|Ga0181529_10536818 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 616 | Open in IMG/M |
3300014162|Ga0181538_10044075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2828 | Open in IMG/M |
3300014162|Ga0181538_10445512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
3300014164|Ga0181532_10002750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16288 | Open in IMG/M |
3300014200|Ga0181526_10382716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300014489|Ga0182018_10000438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 54843 | Open in IMG/M |
3300014490|Ga0182010_10001697 | All Organisms → cellular organisms → Bacteria | 11497 | Open in IMG/M |
3300014490|Ga0182010_10241960 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300014495|Ga0182015_10004496 | All Organisms → cellular organisms → Bacteria | 14985 | Open in IMG/M |
3300014498|Ga0182019_10030446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3017 | Open in IMG/M |
3300014502|Ga0182021_10303139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1882 | Open in IMG/M |
3300014502|Ga0182021_11592759 | Not Available | 787 | Open in IMG/M |
3300014638|Ga0181536_10038359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3367 | Open in IMG/M |
3300014638|Ga0181536_10541051 | Not Available | 502 | Open in IMG/M |
3300014838|Ga0182030_10182943 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2558 | Open in IMG/M |
3300014838|Ga0182030_10870118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
3300015193|Ga0167668_1001000 | All Organisms → cellular organisms → Bacteria | 5700 | Open in IMG/M |
3300015264|Ga0137403_10087566 | All Organisms → cellular organisms → Bacteria | 3138 | Open in IMG/M |
3300017823|Ga0187818_10200616 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300017823|Ga0187818_10224489 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300017823|Ga0187818_10290763 | Not Available | 717 | Open in IMG/M |
3300017932|Ga0187814_10026814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2153 | Open in IMG/M |
3300017933|Ga0187801_10088124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1167 | Open in IMG/M |
3300017934|Ga0187803_10091414 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300017935|Ga0187848_10359328 | Not Available | 603 | Open in IMG/M |
3300017938|Ga0187854_10022032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 3534 | Open in IMG/M |
3300017938|Ga0187854_10067469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1738 | Open in IMG/M |
3300017938|Ga0187854_10157927 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300017943|Ga0187819_10004190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7813 | Open in IMG/M |
3300017943|Ga0187819_10011171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5087 | Open in IMG/M |
3300017946|Ga0187879_10058378 | Not Available | 2259 | Open in IMG/M |
3300017946|Ga0187879_10238400 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300017948|Ga0187847_10411401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 744 | Open in IMG/M |
3300017988|Ga0181520_10074617 | All Organisms → cellular organisms → Bacteria | 3036 | Open in IMG/M |
3300017995|Ga0187816_10034090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2079 | Open in IMG/M |
3300017995|Ga0187816_10137940 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300017995|Ga0187816_10386838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300017996|Ga0187891_1002185 | All Organisms → cellular organisms → Bacteria | 15213 | Open in IMG/M |
3300018003|Ga0187876_1203961 | Not Available | 662 | Open in IMG/M |
3300018006|Ga0187804_10399115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300018016|Ga0187880_1145544 | Not Available | 1118 | Open in IMG/M |
3300018016|Ga0187880_1209989 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300018020|Ga0187861_10001573 | All Organisms → cellular organisms → Bacteria | 23274 | Open in IMG/M |
3300018022|Ga0187864_10003433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12989 | Open in IMG/M |
3300018023|Ga0187889_10166006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1036 | Open in IMG/M |
3300018024|Ga0187881_10033105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 2656 | Open in IMG/M |
3300018024|Ga0187881_10319597 | Not Available | 642 | Open in IMG/M |
3300018033|Ga0187867_10342576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
3300018034|Ga0187863_10074900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1910 | Open in IMG/M |
3300018035|Ga0187875_10014394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4906 | Open in IMG/M |
3300018040|Ga0187862_10003555 | All Organisms → cellular organisms → Bacteria | 15130 | Open in IMG/M |
3300018042|Ga0187871_10057516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2319 | Open in IMG/M |
3300018044|Ga0187890_10015371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4782 | Open in IMG/M |
3300018468|Ga0066662_11014325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
3300018468|Ga0066662_12513694 | Not Available | 543 | Open in IMG/M |
3300018482|Ga0066669_11831321 | Not Available | 562 | Open in IMG/M |
3300019787|Ga0182031_1219080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2015 | Open in IMG/M |
3300019888|Ga0193751_1012228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4479 | Open in IMG/M |
3300019888|Ga0193751_1013321 | All Organisms → cellular organisms → Bacteria | 4252 | Open in IMG/M |
3300019888|Ga0193751_1064628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1517 | Open in IMG/M |
3300020170|Ga0179594_10354010 | Not Available | 557 | Open in IMG/M |
3300020579|Ga0210407_10002386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 16203 | Open in IMG/M |
3300020579|Ga0210407_10272080 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300020579|Ga0210407_10617398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 844 | Open in IMG/M |
3300020579|Ga0210407_10728627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 768 | Open in IMG/M |
3300020580|Ga0210403_10171119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1779 | Open in IMG/M |
3300020580|Ga0210403_10530149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 955 | Open in IMG/M |
3300020581|Ga0210399_10446111 | Not Available | 1078 | Open in IMG/M |
3300020582|Ga0210395_10438263 | Not Available | 983 | Open in IMG/M |
3300020583|Ga0210401_10004152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 15159 | Open in IMG/M |
3300020583|Ga0210401_10007793 | All Organisms → cellular organisms → Bacteria | 10693 | Open in IMG/M |
3300020583|Ga0210401_10311086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1436 | Open in IMG/M |
3300020583|Ga0210401_11217041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 611 | Open in IMG/M |
3300021086|Ga0179596_10047908 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
3300021088|Ga0210404_10622752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300021168|Ga0210406_11362883 | Not Available | 508 | Open in IMG/M |
3300021170|Ga0210400_10000157 | All Organisms → cellular organisms → Bacteria | 91264 | Open in IMG/M |
3300021170|Ga0210400_10098649 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
3300021170|Ga0210400_10460837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1049 | Open in IMG/M |
3300021171|Ga0210405_10001669 | All Organisms → cellular organisms → Bacteria | 24652 | Open in IMG/M |
3300021171|Ga0210405_10144255 | Not Available | 1884 | Open in IMG/M |
3300021171|Ga0210405_10384299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
3300021171|Ga0210405_10674542 | Not Available | 800 | Open in IMG/M |
3300021180|Ga0210396_10119681 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
3300021180|Ga0210396_10190256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1836 | Open in IMG/M |
3300021181|Ga0210388_10140347 | All Organisms → cellular organisms → Bacteria | 2094 | Open in IMG/M |
3300021181|Ga0210388_10273197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1484 | Open in IMG/M |
3300021181|Ga0210388_10502465 | Not Available | 1064 | Open in IMG/M |
3300021181|Ga0210388_11779943 | Not Available | 508 | Open in IMG/M |
3300021402|Ga0210385_10039141 | All Organisms → cellular organisms → Bacteria | 3116 | Open in IMG/M |
3300021402|Ga0210385_11247839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 570 | Open in IMG/M |
3300021404|Ga0210389_10957745 | Not Available | 665 | Open in IMG/M |
3300021405|Ga0210387_10065347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2962 | Open in IMG/M |
3300021406|Ga0210386_10409097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1170 | Open in IMG/M |
3300021407|Ga0210383_10004919 | All Organisms → cellular organisms → Bacteria | 11800 | Open in IMG/M |
3300021407|Ga0210383_10463708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1094 | Open in IMG/M |
3300021407|Ga0210383_11649273 | Not Available | 526 | Open in IMG/M |
3300021420|Ga0210394_10000053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 279519 | Open in IMG/M |
3300021432|Ga0210384_10053524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3658 | Open in IMG/M |
3300021433|Ga0210391_10035249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4008 | Open in IMG/M |
3300021433|Ga0210391_10085306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2493 | Open in IMG/M |
3300021433|Ga0210391_10138706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1914 | Open in IMG/M |
3300021433|Ga0210391_10727319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 777 | Open in IMG/M |
3300021433|Ga0210391_11029423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300021475|Ga0210392_10526610 | Not Available | 872 | Open in IMG/M |
3300021478|Ga0210402_10329034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
3300021478|Ga0210402_10539785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1082 | Open in IMG/M |
3300021559|Ga0210409_10029544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5281 | Open in IMG/M |
3300022521|Ga0224541_1014111 | Not Available | 861 | Open in IMG/M |
3300022557|Ga0212123_10013128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10900 | Open in IMG/M |
3300022557|Ga0212123_10042094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4370 | Open in IMG/M |
3300022881|Ga0224545_1023345 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300023090|Ga0224558_1003607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12712 | Open in IMG/M |
3300023090|Ga0224558_1053787 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
3300024227|Ga0228598_1002522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3986 | Open in IMG/M |
3300025484|Ga0208587_1062099 | Not Available | 844 | Open in IMG/M |
3300025507|Ga0208188_1100129 | Not Available | 654 | Open in IMG/M |
3300025527|Ga0208714_1015545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1911 | Open in IMG/M |
3300025910|Ga0207684_10042742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3843 | Open in IMG/M |
3300025939|Ga0207665_10907738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300026223|Ga0209840_1005684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2798 | Open in IMG/M |
3300026291|Ga0209890_10000219 | All Organisms → cellular organisms → Bacteria | 26689 | Open in IMG/M |
3300026318|Ga0209471_1137566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
3300026334|Ga0209377_1008299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6036 | Open in IMG/M |
3300026358|Ga0257166_1058449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 554 | Open in IMG/M |
3300026376|Ga0257167_1061900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
3300026467|Ga0257154_1083066 | Not Available | 512 | Open in IMG/M |
3300026474|Ga0247846_1009365 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
3300026489|Ga0257160_1047584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300026557|Ga0179587_10344527 | Not Available | 966 | Open in IMG/M |
3300027432|Ga0209421_1029620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
3300027439|Ga0209332_1003140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3514 | Open in IMG/M |
3300027521|Ga0209524_1023988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1266 | Open in IMG/M |
3300027570|Ga0208043_1143000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 627 | Open in IMG/M |
3300027603|Ga0209331_1052900 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon 13_1_40CM_4_48_7 | 1025 | Open in IMG/M |
3300027605|Ga0209329_1145607 | Not Available | 521 | Open in IMG/M |
3300027645|Ga0209117_1185234 | Not Available | 530 | Open in IMG/M |
3300027648|Ga0209420_1037242 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300027648|Ga0209420_1152323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300027662|Ga0208565_1161225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 650 | Open in IMG/M |
3300027662|Ga0208565_1208545 | Not Available | 554 | Open in IMG/M |
3300027674|Ga0209118_1000016 | All Organisms → cellular organisms → Bacteria | 154412 | Open in IMG/M |
3300027674|Ga0209118_1003270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6642 | Open in IMG/M |
3300027674|Ga0209118_1017932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2290 | Open in IMG/M |
3300027676|Ga0209333_1064882 | Not Available | 1002 | Open in IMG/M |
3300027696|Ga0208696_1043438 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
3300027701|Ga0209447_10049716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → unclassified Edaphobacter → Edaphobacter sp. 4G125 | 1155 | Open in IMG/M |
3300027738|Ga0208989_10008184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3559 | Open in IMG/M |
3300027738|Ga0208989_10063852 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon 13_1_40CM_4_48_7 | 1266 | Open in IMG/M |
3300027767|Ga0209655_10030891 | Not Available | 1793 | Open in IMG/M |
3300027825|Ga0209039_10020935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3332 | Open in IMG/M |
3300027825|Ga0209039_10166098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300027829|Ga0209773_10028148 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
3300027846|Ga0209180_10348414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300027854|Ga0209517_10015752 | All Organisms → cellular organisms → Bacteria | 7576 | Open in IMG/M |
3300027854|Ga0209517_10073653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2411 | Open in IMG/M |
3300027854|Ga0209517_10091370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2079 | Open in IMG/M |
3300027854|Ga0209517_10106579 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
3300027854|Ga0209517_10210171 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300027875|Ga0209283_10025493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3657 | Open in IMG/M |
3300027879|Ga0209169_10055021 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300027879|Ga0209169_10081054 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
3300027879|Ga0209169_10087680 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300027879|Ga0209169_10334331 | Not Available | 796 | Open in IMG/M |
3300027884|Ga0209275_10007655 | All Organisms → cellular organisms → Bacteria | 4549 | Open in IMG/M |
3300027895|Ga0209624_10998195 | Not Available | 543 | Open in IMG/M |
3300027903|Ga0209488_10081860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2403 | Open in IMG/M |
3300027905|Ga0209415_10003568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 28928 | Open in IMG/M |
3300027905|Ga0209415_10097873 | All Organisms → cellular organisms → Bacteria | 3241 | Open in IMG/M |
3300027905|Ga0209415_10853358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 626 | Open in IMG/M |
3300027908|Ga0209006_11221923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 586 | Open in IMG/M |
3300027911|Ga0209698_10041194 | All Organisms → cellular organisms → Bacteria | 4129 | Open in IMG/M |
3300027911|Ga0209698_10113970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2248 | Open in IMG/M |
3300027911|Ga0209698_10148783 | Not Available | 1922 | Open in IMG/M |
3300028015|Ga0265353_1025161 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300028379|Ga0268266_10461625 | Not Available | 1208 | Open in IMG/M |
3300028536|Ga0137415_10000960 | All Organisms → cellular organisms → Bacteria | 28345 | Open in IMG/M |
3300028558|Ga0265326_10049042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
3300028649|Ga0302162_10004569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3144 | Open in IMG/M |
3300028906|Ga0308309_10347532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1264 | Open in IMG/M |
3300029987|Ga0311334_10163468 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
3300030053|Ga0302177_10352707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300030114|Ga0311333_11189685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300030707|Ga0310038_10450967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 551 | Open in IMG/M |
3300030940|Ga0265740_1003628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1164 | Open in IMG/M |
3300030943|Ga0311366_10715610 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300031122|Ga0170822_15439616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300031247|Ga0265340_10099920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1349 | Open in IMG/M |
3300031708|Ga0310686_100044571 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2177 | Open in IMG/M |
3300031708|Ga0310686_102910663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 591 | Open in IMG/M |
3300031708|Ga0310686_104639956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter | 2426 | Open in IMG/M |
3300031708|Ga0310686_115723877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2453 | Open in IMG/M |
3300031708|Ga0310686_116949367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1318 | Open in IMG/M |
3300031708|Ga0310686_118999625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter | 866 | Open in IMG/M |
3300031708|Ga0310686_119318212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2717 | Open in IMG/M |
3300031716|Ga0310813_10272808 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300031720|Ga0307469_10295550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1331 | Open in IMG/M |
3300031753|Ga0307477_10017246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4927 | Open in IMG/M |
3300031820|Ga0307473_10510675 | Not Available | 813 | Open in IMG/M |
3300031918|Ga0311367_11356603 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300032160|Ga0311301_10004569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 49497 | Open in IMG/M |
3300032160|Ga0311301_10607233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1574 | Open in IMG/M |
3300032160|Ga0311301_11281941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 928 | Open in IMG/M |
3300032180|Ga0307471_100001811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11974 | Open in IMG/M |
3300032180|Ga0307471_100216073 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
3300032180|Ga0307471_100404663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
3300032180|Ga0307471_100594540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1265 | Open in IMG/M |
3300032421|Ga0310812_10264482 | Not Available | 759 | Open in IMG/M |
3300032515|Ga0348332_14366501 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300032782|Ga0335082_10032312 | All Organisms → cellular organisms → Bacteria | 5546 | Open in IMG/M |
3300033402|Ga0326728_10659104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 797 | Open in IMG/M |
3300033412|Ga0310810_11116577 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300033475|Ga0310811_10458741 | Not Available | 1359 | Open in IMG/M |
3300033798|Ga0334821_030869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1075 | Open in IMG/M |
3300033825|Ga0334843_034785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
3300033888|Ga0334792_010322 | All Organisms → cellular organisms → Bacteria | 3736 | Open in IMG/M |
3300034091|Ga0326724_0033413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4062 | Open in IMG/M |
3300034125|Ga0370484_0076983 | Not Available | 854 | Open in IMG/M |
3300034163|Ga0370515_0333872 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.82% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.51% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.46% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.46% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.64% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.62% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.10% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.10% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.59% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.08% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.31% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.31% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.05% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.79% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.28% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.28% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.28% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.03% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.03% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.77% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.77% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.51% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.51% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.51% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.51% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.26% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.26% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.26% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.26% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.26% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.26% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.26% |
Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.26% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004469 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300008787 | Microbial communities from wetland soil in Czech Republic - R3_cDNA | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026474 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0 | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033798 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-S | Environmental | Open in IMG/M |
3300033825 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 1-5 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_02921840 | 2170459024 | Grass Soil | MSKHDSVTKRNRRPKSDKRVDYTARTMAAVKKLEEAAKAKLK |
FG2_07500930 | 2189573004 | Grass Soil | MSKHDSVTKRNRRPKSDKRVDYTARTMAAVKQLEQAAKLKK |
JGI12270J11330_100119474 | 3300000567 | Peatlands Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALKELEKAAKLRTKTA* |
JGI12270J11330_100157163 | 3300000567 | Peatlands Soil | MAKHDSVTKRHRRPKSAKREDYTARTMAAVKELEQAAKLKGK* |
JGI12270J11330_100476882 | 3300000567 | Peatlands Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALRELEKAAKLKSKTA* |
JGI12270J11330_101700131 | 3300000567 | Peatlands Soil | MSNQHSVTKRHRRPKSEKRADYTARTMAAVKQLEQAAKLKAK* |
JGI12703J13194_1011061 | 3300001100 | Forest Soil | MSNNHSVTKRHRRPKSVKRTDHTATTMAAIRKLELAAKPKAK* |
JGI12636J13339_10039452 | 3300001154 | Forest Soil | MSKHDTATKRHRRPKSKKRVDYTARTMAALKELNQAARLRTKAG* |
JGI12636J13339_10054985 | 3300001154 | Forest Soil | MSKHDTATKRHRRPKSGKRVDYTARTMAVLKELKQAAKLRNKAG* |
JGI12269J14319_102326982 | 3300001356 | Peatlands Soil | MADAKCGKQQEKPMSKHDTPTKPHRRPKSKKRVDYTARTMAALRELKEAAKVKS* |
JGI12635J15846_100703883 | 3300001593 | Forest Soil | MSNQHSVTKRHRRPKSPKRLDSTAKTMAAVKELEQAAKKKEK* |
JGI12635J15846_101238403 | 3300001593 | Forest Soil | MSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKKRSEH* |
JGI12635J15846_102212762 | 3300001593 | Forest Soil | MSNQHSVTKRHRRPKSVKRADYTARTMAAVKQLEQAAKLKK* |
JGI12635J15846_105203922 | 3300001593 | Forest Soil | MSNQHSVTKRHRRPKSEKRVDYTARTMAAVKQLEQAAKPKTK* |
JGI12635J15846_105623172 | 3300001593 | Forest Soil | MSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKKSSER* |
JGI12053J15887_101620602 | 3300001661 | Forest Soil | MSQQHSVTKRHRRPKSEKRVDYTARTMAAVKRLEQAAKLKK* |
C688J35102_1196815592 | 3300002568 | Soil | MSKHDTPTKPHRRPKSPKRVDYTASTMIALRRLKEAEKQKTT* |
JGI25617J43924_101055432 | 3300002914 | Grasslands Soil | MSKHNSVTKRNRRPKSDKRADYTARTMAAVKELEQAAKLKVKLETH* |
JGI26339J46600_1000096520 | 3300003218 | Bog Forest Soil | MSKQHSATKRHRRPKSDKRLDCTARTMAAVKQLEQAAKLKVK* |
Ga0062385_100424602 | 3300004080 | Bog Forest Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALKELEKAAKLKAKSA* |
Ga0062385_102433092 | 3300004080 | Bog Forest Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELRRAAKETSK* |
Ga0062385_105691202 | 3300004080 | Bog Forest Soil | SKHDTPTKRHRRPKSGKRIDYTAPTMAALKELEKAAKLKTKPA* |
Ga0062384_1000116834 | 3300004082 | Bog Forest Soil | MSKHDSVTKRNRRPKSGKRVDYTARTMAALKALEQAAKLKIRAA* |
Ga0062384_1010567871 | 3300004082 | Bog Forest Soil | MSKHDTPTKRHRRPKSGKRIDYTALTMAALKELEKAAKLRTKPA* |
Ga0062387_1002798173 | 3300004091 | Bog Forest Soil | MSKHNSVTKRNRRPKSDKRADYTARTMAAVKELEQAAKLKVK*ILPAVA* |
Ga0062387_1017195511 | 3300004091 | Bog Forest Soil | MSKHDTPTKRHRRPKSGKRVDYTARTMAALKELRQAAKVNTK* |
Ga0062389_1028293021 | 3300004092 | Bog Forest Soil | MSKHDTATKRHRRPKSGKRIDYTARTMAALKALEVAAKKKSKTA* |
Ga0058882_18109511 | 3300004121 | Forest Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELRQAAKET |
Ga0062386_1000775411 | 3300004152 | Bog Forest Soil | MSKHDTATKRHRRPKSGKRVDYTARTMAALKELTQAAKLRNKAG |
Ga0068931_12907061 | 3300004469 | Peatlands Soil | MSKHDSVTKRNRRPKSEKRVDYTARTMAALKELEQAAKLKV |
Ga0068966_14840661 | 3300004476 | Peatlands Soil | MSKHDSVTKRNRRPKSGKRVDCTARTMAAVKQLEQAAKLKVK* |
Ga0068971_15567012 | 3300004477 | Peatlands Soil | MSKHNSVTKRHRRPKSDKRSDYTARTMAAVKELEQATKLKVK* |
Ga0068972_14724311 | 3300004478 | Peatlands Soil | MSKHNSVTKRHRRPRSGKRVDYTARTMAAVKELEQPAKLKVK* |
Ga0058899_100135491 | 3300004631 | Forest Soil | MSKHDTATKRHRRPKSGKRIDYTASTMAALKALEQAAKKKAKSA* |
Ga0058899_121874732 | 3300004631 | Forest Soil | MSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKK* |
Ga0058899_122762292 | 3300004631 | Forest Soil | MSKHDTATKRHRRPKSGKRVDYTARTMAALKELAQAAKARTK* |
Ga0058899_122796122 | 3300004631 | Forest Soil | MSKHDSVTKRKRRPKSDKRIDYTARTMAIVKQLSEAAKVK* |
Ga0062388_1005606251 | 3300004635 | Bog Forest Soil | MSKHDTPTKRHRRPKSGKRIDYTARTMAALKELEKAAKLRTKPA* |
Ga0066672_102841893 | 3300005167 | Soil | MSKQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKK* |
Ga0066680_101086762 | 3300005174 | Soil | MSKEEPMSKQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKK* |
Ga0066679_100026119 | 3300005176 | Soil | MSNNHSVTKRHRRPKSVKRTDYTARTMAAVKQLELAAKPKGK* |
Ga0070689_1011216181 | 3300005340 | Switchgrass Rhizosphere | LSKHDTATKRHTRPKSKKRIDYTARTMAILKKLKEAAKAS* |
Ga0070671_1007857542 | 3300005355 | Switchgrass Rhizosphere | LSKHDTATKRHTRPKSKKRIDYTARTMAILKKLKEAEKAS* |
Ga0070713_1000830625 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNNHSVTKRHRRPKSVKRTDYTARTMAAVKQLELAAKPKAK* |
Ga0070708_1002577002 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLEQAAKLKAK* |
Ga0070708_1003034043 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKHDSVTKRNRRPKSGKRVDYTARTMAAVKQLEQAAKLKK* |
Ga0066686_102001762 | 3300005446 | Soil | MSKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLELAAKLKG* |
Ga0070706_1000781703 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHNSVTKRKRRPKSDKRADYTARTMAAVKELEQAAKLKVKAAGTAVSM* |
Ga0070706_1001924985 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHNSLTKRKRRPKSDKRADYTARTMVAVKELEQQAKLKVKLILPAVA* |
Ga0070706_1017379962 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHNSVTKRKRRPKSDKRADYTARTMAAVKELEQQAKLKVKLILPAVA* |
Ga0070707_1001408193 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RRPKSDKRADYTARTMAAVKELEQAAKLKVKAAGTAVSM* |
Ga0070707_1007752462 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKQHSATKRHRRPKSEKRIDYTALTMAAVKQLEQAAKLKVK* |
Ga0070707_1008257812 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLELAAKLKAK* |
Ga0070698_1010666472 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHNSVTKRKRRPKSDKRADYTARTMVAVKELEQQAKLKVKLILPAVA* |
Ga0070699_1007828903 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EKSMSKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLELAAKLKAK* |
Ga0070741_100489685 | 3300005529 | Surface Soil | MSKHDSVTKRNRRPKSAKRIDYTARTMAAVRQLEQAAKLKMK* |
Ga0070697_1017901392 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHDSVTKRHRRPKSDKRIDYTARTMAAVKQLELAAKLKTK* |
Ga0070730_104390261 | 3300005537 | Surface Soil | MSKHDTATKRHRRPKSDKRIDYTARTMAALKELKQAAKAKAKTA* |
Ga0070731_101869202 | 3300005538 | Surface Soil | MSKHDTATKRHRRPKSAKRKDYTARTMAALKELEKAAKLRAKPA* |
Ga0070733_100077812 | 3300005541 | Surface Soil | MSKHDEPTKRHRRPKSGKRTDYTARTMAALKELEKAEKLKAKTA* |
Ga0070733_101159782 | 3300005541 | Surface Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRSKPA* |
Ga0070733_101708131 | 3300005541 | Surface Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELRQAAKETTK* |
Ga0070732_107522291 | 3300005542 | Surface Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRMKPA* |
Ga0066661_104117753 | 3300005554 | Soil | MSKHDSVTKRKRRPKSDKRVDYTARTMAIVKQLSEAAKVK* |
Ga0066703_101013423 | 3300005568 | Soil | MSKHDSVTKRSRRPKSDRRVDYTARTMAAVKKLEQAARLKAK* |
Ga0066691_100296373 | 3300005586 | Soil | MSKEEPMSKQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQATKLKK* |
Ga0070761_103812182 | 3300005591 | Soil | MSKHDTPTKRHRRPKSSKRVDYTARTMAALKELRQAAKQTTK* |
Ga0070762_100100954 | 3300005602 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELKNAAKLKAKPA* |
Ga0070762_100152357 | 3300005602 | Soil | MSKHDTPTKRHRRPKSAKRIDYTARTMAALKELEKAAKLRAKPA* |
Ga0070763_102250842 | 3300005610 | Soil | MSKHDTATKRHRRPKSAKRIDYTARTMAALKKLKEADKQKAKTA* |
Ga0070764_100409223 | 3300005712 | Soil | MSKHDEPTKRHRRPKSGKRTDYTARTMAALKELEKAAKLKAKTA* |
Ga0070764_103874661 | 3300005712 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA* |
Ga0068860_1012149822 | 3300005843 | Switchgrass Rhizosphere | RTQLSKHDTATKRHTRPKSKKRIDYTARTMAILKKLKEAAKAS* |
Ga0066795_100114535 | 3300005938 | Soil | MSKHNSVTKRNRRPKSDKRADYTARTMAAVKELEQAAKLKVK* |
Ga0066795_100219043 | 3300005938 | Soil | MAKHDSVTKRHRRPKSAKRADYTARTMAAVKALEQAAKLKGK* |
Ga0066794_100018731 | 3300005947 | Soil | MSKQHSVTKRNRRPKSQKRADSTARTMAAVKQLEQAAKLRVK* |
Ga0080026_101235411 | 3300005952 | Permafrost Soil | MSNQHSVTKRHRRPKSEKRVDYTARTMAAVKQLEQAAKPKAK* |
Ga0070717_112696482 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNNHSVTKRHRRPKSVKRTDYTARTMAAVKKLELAAQPKAK* |
Ga0075023_1000500843 | 3300006041 | Watersheds | MSKHDSVTKRNRRPKSDKRMDYTARTMAAVKQLERAAKLKK* |
Ga0075023_1003161212 | 3300006041 | Watersheds | MSKHDSVTKRNRRPKSDRRVDYTARTMAAVKKLEQAAKLKK* |
Ga0075028_1001916082 | 3300006050 | Watersheds | MSKHDTATKRHRRPKSKKRVDYTARTMAALRELEKAAKLRAKPA* |
Ga0075029_1000700314 | 3300006052 | Watersheds | MSKKHSLTKRHRRPKSGKRVDSTARTMAAVKELELASSPKAK* |
Ga0075029_1004029842 | 3300006052 | Watersheds | MSKHDSVTKRNRRPKSDRRVDYTARTMAAVKKLEQAAKPKK* |
Ga0075029_1009286282 | 3300006052 | Watersheds | MSKKHSLTKRHRRPKSGKRMDSTARTMAAVKELEQAARLKAK* |
Ga0075017_1011040072 | 3300006059 | Watersheds | MSKHDSVTKRHSRPKSGKRQDYTARTMAAVKQLEQAAKPKVK* |
Ga0075017_1012103792 | 3300006059 | Watersheds | MSMHDSVTKRHSRPKSGKRVDYTARTMAAVKQLEQAAKPKVK* |
Ga0075017_1015363791 | 3300006059 | Watersheds | MSKHNSVTKRNRRPKSGKRADYTARTMAAVKELEQAANLKVK* |
Ga0075015_1000026054 | 3300006102 | Watersheds | MSKHDSVTKRNRRPKSDKRVDYTARTMAAVKQLEQAAKLKK* |
Ga0075030_1013546661 | 3300006162 | Watersheds | MSKHDTATKRHRRPKSKKRVDYTARTMAALRELEQAAKLKN* |
Ga0075030_1015717041 | 3300006162 | Watersheds | HDSVTKRNRRPKSDRRVDYTARTMAAVKKLEQAAKLKK* |
Ga0075014_1002218153 | 3300006174 | Watersheds | MSKHDSVTKRHSRPKSGKRVDYTARTMAAVKKLEQ |
Ga0075014_1002896901 | 3300006174 | Watersheds | SLTKRHRRPKSGKRADSTARTMAAVKELEQAARLKVKAV* |
Ga0070712_1013798361 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKHDSVTKRKRRPKSDKRVDYTARTMAVLKQHSEA |
Ga0070765_1000650851 | 3300006176 | Soil | SKHDEPTKRHSRPKSGKRTDYTARTMAALKELEKAQKLRTKPA* |
Ga0070765_1010038922 | 3300006176 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELRRAAKETTK* |
Ga0075021_110980882 | 3300006354 | Watersheds | MSKHDSVTKRNRRPKSGKRTDYTARTMAAVKRLELAEKPKK* |
Ga0075521_101022802 | 3300006642 | Arctic Peat Soil | MSNQHSVTKRHRRPKSVKRVDYTARTMAAVKQLEQAAKPKAK* |
Ga0073928_104261722 | 3300006893 | Iron-Sulfur Acid Spring | MSKHNSVTKQKRRPKSDKRIDYTARTMAVLKQLSQAAESK* |
Ga0073928_104490881 | 3300006893 | Iron-Sulfur Acid Spring | TKRHRRPKSEKRVDYTARTMAAVKQLEQAAKPKTK* |
Ga0099793_100164942 | 3300007258 | Vadose Zone Soil | MSKHDSVTKRNRRPKSDRREDYTARTMAAVKKLEQAAKIKK* |
Ga0103640_10018842 | 3300008787 | Wetland Soil | MSKHDSVTKRHRRPKSAKRADYTARTMAAVKELEQAAKLKGK* |
Ga0099830_104130574 | 3300009088 | Vadose Zone Soil | MSKHNSVTKRNRRPKSDKRADYTASTMAAVKELEQAAQLIVKLETH* |
Ga0099828_100267964 | 3300009089 | Vadose Zone Soil | MSKQHSATKRHRRPKSEKRADYTARTMAAVKQLERAAKLRVK* |
Ga0116108_10832281 | 3300009519 | Peatland | PMSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKLKVKAA* |
Ga0116214_10124723 | 3300009520 | Peatlands Soil | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKLKVKAA* |
Ga0116214_12641562 | 3300009520 | Peatlands Soil | DTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA* |
Ga0116214_14016693 | 3300009520 | Peatlands Soil | MSKHDSVTKRNRRPKSGKRVDYTARTMAALKELEQAAKLKIK |
Ga0116222_14206511 | 3300009521 | Peatlands Soil | MSKHDSVTKRNRRPKSGKRVDCTARTMAAVKQLEQAAKLK |
Ga0116225_11916811 | 3300009524 | Peatlands Soil | MSKHNSVTKRKRRPKSDKRADYTARTMAAVKELEQAAELKVKLILPAVA* |
Ga0116225_14440103 | 3300009524 | Peatlands Soil | MSKHDTPTKPHRRPKSGKRVDYTARTMAALKQLAQDAKAS |
Ga0116111_10695802 | 3300009616 | Peatland | MSKHDSVTKRHRRPKSEKRADYTARTMAAVKALEQAAKLKVK* |
Ga0116133_10989202 | 3300009623 | Peatland | MSKHDTVTKRNRRPKSAKRVDYTARTMAAVKQLEQAAKLKDKSA* |
Ga0116133_11368702 | 3300009623 | Peatland | MSSKHSFTKRHRRPKSGKRIDPTARTMAAVNVLEQAARL |
Ga0116115_11747421 | 3300009631 | Peatland | MSKHDSVTKRNRRPKSEKRIDYTARTMAAIKQLEQAAKLKVKDA* |
Ga0116102_10100188 | 3300009632 | Peatland | MSRHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAELKVKAA* |
Ga0116102_11487641 | 3300009632 | Peatland | EPMSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKPKVKAT* |
Ga0116129_11311771 | 3300009633 | Peatland | HEDTMSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA* |
Ga0116121_11541723 | 3300009644 | Peatland | QQEEPMSKHDSVTKRNRRPKSAKRVDYTARTMAAVRQLEQAAKLKVKAA* |
Ga0116106_11317632 | 3300009645 | Peatland | EEPMSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKPKVKAT* |
Ga0116135_12643952 | 3300009665 | Peatland | HDTVTKRNRRPKSAKRVDYTARTMAAVKQLEQAAKLKDKSA* |
Ga0116224_105246031 | 3300009683 | Peatlands Soil | MSKHNSVTKRNRRPKSGKRADYTARTMAAVKELEQAAKLKVKLILPAVA* |
Ga0116216_103023702 | 3300009698 | Peatlands Soil | MSKHDTATKRHRRPKSGKREDYTARTMAALKELRQAEKAKTK* |
Ga0116216_105795661 | 3300009698 | Peatlands Soil | TMSKHDSVTKRNRRPKSGKRVECTARTMAAVKQLEQAAKLKVK* |
Ga0116217_103658811 | 3300009700 | Peatlands Soil | EEPMSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKLKVKAA* |
Ga0116101_10247521 | 3300009759 | Peatland | VLRQQQENAMSSKHSLTKRHRGPKSGKRIDPTARTMAAVKVLEQAAGLKAK* |
Ga0116134_10117743 | 3300009764 | Peatland | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKELEQAAKLKLKGK* |
Ga0116134_11704471 | 3300009764 | Peatland | MSNQHSVTKRHRRQKSVKRVDYSAQTMAAVKQLELAENLKASKEAKK* |
Ga0116219_102423771 | 3300009824 | Peatlands Soil | HRRPKSAKRVDYTARTMAALKELEKAAKLRMKPA* |
Ga0116219_105437711 | 3300009824 | Peatlands Soil | MSKHDSVTKRNRRPKSGKRVDYTARTMAALKELEQAAKLKIKAA* |
Ga0074046_100824052 | 3300010339 | Bog Forest Soil | MSNQHSVTKRHRRPKSEKRADYTARTMAAVKQLEQAAKLKVK* |
Ga0074045_100126713 | 3300010341 | Bog Forest Soil | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKRKVKAA* |
Ga0074045_100290786 | 3300010341 | Bog Forest Soil | MSKQHSATKRHRRPKSEKRADYTARTMAAVKELEQAAKLRVSECFPAVA* |
Ga0074045_100631371 | 3300010341 | Bog Forest Soil | EPMSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKLKVKAA* |
Ga0074045_101112563 | 3300010341 | Bog Forest Soil | MSKHDTATKRHRRPKSGKRVDYTARTMAALKELTQAAKLRNKAG* |
Ga0074045_103319613 | 3300010341 | Bog Forest Soil | MSKQHSATKRHRRPKSDKRLDCTARTMAAVKKLEQAAKLKVK* |
Ga0074044_1000108527 | 3300010343 | Bog Forest Soil | MSKHDSVTKRHRRPRSGKRLDYTARTMAAVKQLEQAAKLKVKAA* |
Ga0074044_102803962 | 3300010343 | Bog Forest Soil | MSKHNSVTKRHRRPKSEKRADYTARTMAAVKELELAAKLKVK* |
Ga0074044_107008942 | 3300010343 | Bog Forest Soil | CKQQQEEPMSKQHSATKRHRRPKSGKRADYTARTMAAVKELEQAAKLKAK* |
Ga0136449_10000864233 | 3300010379 | Peatlands Soil | MSKHDTPTKPHRRPKSKKRVDYTARTMAALRELKEAAKVKS* |
Ga0136449_1001878142 | 3300010379 | Peatlands Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALRELEKADKQKPKTA* |
Ga0136449_1031293911 | 3300010379 | Peatlands Soil | KHDSVTKRNRRPKSGKRVDCTARTMAAVKQLEQAAKLKVK* |
Ga0138581_10784801 | 3300011085 | Peatlands Soil | MSKHDSVTKRNRRPKSGKRVECTARTMAAVKQLEQAAKLRAKAA |
Ga0150983_128357542 | 3300011120 | Forest Soil | MMSKHDTATKRHRRPKSGKRIDYTASTMAALKALEQAAKKKS* |
Ga0150983_136638471 | 3300011120 | Forest Soil | IMSKHDTATKRHRRPKSAKRVDYTARTMAALRELEKAAKLRTKPA* |
Ga0150983_149614782 | 3300011120 | Forest Soil | SKHDTPTKRHRRPKSAKRIDYTARTMAALKELEKAAKLRAKPA* |
Ga0137392_100510197 | 3300011269 | Vadose Zone Soil | MSKHDSVTKRKRRPKSDKRLDYTARTMAIVKQLSEAAKVK* |
Ga0137392_102256392 | 3300011269 | Vadose Zone Soil | SATKRHRRPKSEKRADYTARTMAAVKQLERAAKLRVK* |
Ga0137391_102486494 | 3300011270 | Vadose Zone Soil | MSKHNSVTKRNRRPKSDKRADYTARTMAAVKELEEAAKLKVKLETH* |
Ga0137391_104256951 | 3300011270 | Vadose Zone Soil | MSKHDSVTKRKRRPKSDKRLDYTARTMAIVKQLSE |
Ga0137393_103609662 | 3300011271 | Vadose Zone Soil | SKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLEQAAKLKAK* |
Ga0137393_105584601 | 3300011271 | Vadose Zone Soil | MSNQHSVTKRHRRPKSPKRADYTARTMAAVKQLEQAAKLKK* |
Ga0137382_101940662 | 3300012200 | Vadose Zone Soil | MSKHDSVTKRNRRPKSDRRVDYTARTIAAVKKLEPAAKLKAK* |
Ga0137363_102955361 | 3300012202 | Vadose Zone Soil | KRNRRPKSDRRVDYTARTIAAVKKLEQAANLKAK* |
Ga0137399_101874343 | 3300012203 | Vadose Zone Soil | MSNQHSVTKRHRRPKSDKRADYTARTMAAVKQLEKAAKEKTK* |
Ga0137362_100171146 | 3300012205 | Vadose Zone Soil | MSKHDSVTKRHRRPKSDKRVDYTARTMAAVKELELAAKLKAK* |
Ga0137362_103411883 | 3300012205 | Vadose Zone Soil | MSKHDSVTKRNRRPKSDRRVDYTARTMAAVKKLEQAAKLKAK* |
Ga0137378_101616163 | 3300012210 | Vadose Zone Soil | SKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLELAAKLKG* |
Ga0137378_114530541 | 3300012210 | Vadose Zone Soil | MSKHDSVTKRHRRPKSDKRIDYTARTMAAVKQLELAAKLKAK* |
Ga0137360_106835851 | 3300012361 | Vadose Zone Soil | QEKSMSKHDSVTKRHRRPKSDKRVDYTARTMAAVKELELAAKLKAK* |
Ga0137360_115113151 | 3300012361 | Vadose Zone Soil | KHNSVTKRNRRPKSDKRADYTARTMAAVKELEQAAKLKVK* |
Ga0137361_105150681 | 3300012362 | Vadose Zone Soil | KRNRRPKSDRRVDYTARTMAAVKKLEQAAKLKAK* |
Ga0137361_105370441 | 3300012362 | Vadose Zone Soil | MSKEEPMSKQHSVTKRHRRPKSAKRADYTARTMAA |
Ga0137361_118246831 | 3300012362 | Vadose Zone Soil | KHNSVTKRNRRPKSDKRADYTARTMAALKELEQAAKLKVK* |
Ga0137397_100597484 | 3300012685 | Vadose Zone Soil | MSKHDSVTKRNRRPKSDRRVDYTARTMAAVKKLEQAAKLKSK* |
Ga0137395_102686674 | 3300012917 | Vadose Zone Soil | MSKHNSVTKRNRRPKSDKRADYTTRTMAAVKELEQAAKLKVKLETH* |
Ga0137395_106580791 | 3300012917 | Vadose Zone Soil | MSKHDSVTKRKRRPKSDKRVDYTARTMAIVKRLSEAAKVK* |
Ga0137416_105582061 | 3300012927 | Vadose Zone Soil | VSKHDSVTKRKRRPKSPKRVDYTARTMAVLKQLSQAA |
Ga0181533_10150185 | 3300014152 | Bog | MSKQHSATKRHRRPKSEKRIDYTARTMAAVKELEQAAKLKVK* |
Ga0181524_100341575 | 3300014155 | Bog | MSNQHSVTKRHRRPKSVKRADYSARTMAAVKELELAAKPKAK* |
Ga0181524_100547043 | 3300014155 | Bog | MSNQHSVTKRHRRQKSVKRVDYSAQTMAAVKQLEEAAKPKKSASLAAS* |
Ga0181530_101159661 | 3300014159 | Bog | EPMSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKRKVKAA* |
Ga0181529_105368182 | 3300014161 | Bog | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAA |
Ga0181538_100440754 | 3300014162 | Bog | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAK |
Ga0181538_104455122 | 3300014162 | Bog | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKKLEQAAKLKDK* |
Ga0181532_100027505 | 3300014164 | Bog | MSKHNSVTKRNRRPKSEKRADYTARTMAAVKELEQAAKLKVK* |
Ga0181526_103827161 | 3300014200 | Bog | HDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA* |
Ga0182018_1000043850 | 3300014489 | Palsa | MSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEEAAKKKDK* |
Ga0182010_100016972 | 3300014490 | Fen | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKELEQAAKRKGK* |
Ga0182010_102419602 | 3300014490 | Fen | MSKHDSVTKRNRRPKSGKRADCTARTMAAVKQLEQAAKLKGK* |
Ga0182015_1000449610 | 3300014495 | Palsa | MSKHDTPTKPHRRPKSAKRVDYTARTMAALKQLAHEAKLRE |
Ga0182019_100304462 | 3300014498 | Fen | MSNQHSVTKRHRRPKSEKRKDYTARTMAAVKQLELAAKPKTKSA* |
Ga0182021_103031392 | 3300014502 | Fen | MSNQHSVTKRHRRPKSEKRTDYTARTMAAVKQLELAAKPKTKSA* |
Ga0182021_115927591 | 3300014502 | Fen | MSNRHSATKRHRRVKSEKRSDCTARTMAAVKQLEE |
Ga0181536_100383595 | 3300014638 | Bog | MSKHDSVTKRNRRPKSEKRIDYTARTMAAIKQLEQAAKLKVK |
Ga0181536_105410511 | 3300014638 | Bog | ERPMSNQHSVTKRHRRQKSVKRVDYSAQTMAAVKQLELAENLKASKEAKK* |
Ga0182030_101829432 | 3300014838 | Bog | MSKHDTVTKRNRRPKSAKRVDYTARTMAAVKQLEQAAKLKVKSA* |
Ga0182030_108701183 | 3300014838 | Bog | EEPMSKHNSVTKRNRRPKSEKRADYTARTMAAVKELEQAAKLKVK* |
Ga0167668_10010005 | 3300015193 | Glacier Forefield Soil | MSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKKSSEH* |
Ga0137403_100875662 | 3300015264 | Vadose Zone Soil | MSKHDSVTKRHRRPKSDRRIDYTARTMAAVKQLELAAKLKAK* |
Ga0187818_102006162 | 3300017823 | Freshwater Sediment | MSKHNFVTKRNRRPKSGKRADYTVRTMAAVKELEQAAKLKVK |
Ga0187818_102244893 | 3300017823 | Freshwater Sediment | MSKRHSATKRHRRPKSEKRTDYTAGTMAAVKQLEQAA |
Ga0187818_102907631 | 3300017823 | Freshwater Sediment | MSKHDSVTKRHSRPKSGKRQDYTARTMAAVKQLEQAAKLRK |
Ga0187814_100268141 | 3300017932 | Freshwater Sediment | MSKHDSVTKRHSRPKSGKRQDYTARTMAAVKQLEQAAKPKVK |
Ga0187801_100881242 | 3300017933 | Freshwater Sediment | MSKHDTPTKPHRRPKLAKRVDYTARTMAALKQLAHEAKLRE |
Ga0187803_100914142 | 3300017934 | Freshwater Sediment | MSKHDSVTKRNRRPKSGKRADYTARTMAVVKELEQAAKLRVKAA |
Ga0187848_103593282 | 3300017935 | Peatland | MSKHNSVTKRNRRPKSEKRADYTARTMAAVKELEQAAKLKVK |
Ga0187854_100220324 | 3300017938 | Peatland | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKLKVKAA |
Ga0187854_100674691 | 3300017938 | Peatland | EPMSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKPKVKAT |
Ga0187854_101579271 | 3300017938 | Peatland | EPMSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKLKVKAA |
Ga0187819_100041903 | 3300017943 | Freshwater Sediment | MAKHDSVTKRHRRPKSAKRADYTARTMAAVKELEQAAKLKGK |
Ga0187819_100111712 | 3300017943 | Freshwater Sediment | MSKQHSATKRHRRPKSKKRTDFTARTMATVKQLEQAAKLKAKAA |
Ga0187879_100583781 | 3300017946 | Peatland | MSKHDSVTKRNRRTKSAKRVDYTARTMAAVRQLEQAAKLKVKAA |
Ga0187879_102384002 | 3300017946 | Peatland | MSKHDTVTKRNRRPKSAKRVDYTARTMAAVKQLEQAAKLKDKSA |
Ga0187847_104114011 | 3300017948 | Peatland | MGKHDTVTKRHRRPKSAKRIDYTATTMAALKKLEQAEKLKTKSS |
Ga0181520_100746173 | 3300017988 | Bog | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKQRTKPA |
Ga0187816_100340904 | 3300017995 | Freshwater Sediment | MSKRHSATKRHRRPKSEKRTDYTARTMAAVKQLEQAAKPKATAA |
Ga0187816_101379403 | 3300017995 | Freshwater Sediment | MSKHDSVTKRNRRPKSKKRTDFTARTMAAVKELEQAAKLRVKAA |
Ga0187816_103868382 | 3300017995 | Freshwater Sediment | MSKHDSVTKRHSRPKSGKRQDYTARTMAAVKQLEQAAKPKAK |
Ga0187891_100218513 | 3300017996 | Peatland | MSKQHSSTKRHRRPKSDKRLDCTARTMAAVKELEQAAKLKVKGILPAVA |
Ga0187876_12039612 | 3300018003 | Peatland | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKELEQAAKLKLKGK |
Ga0187804_103991152 | 3300018006 | Freshwater Sediment | MSKHDSVTKRKRRPKSDKRVDYTARTMAVIKQHSEAAKLNNP |
Ga0187880_11455443 | 3300018016 | Peatland | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAA |
Ga0187880_12099891 | 3300018016 | Peatland | MSKHDSVTKRHRRPKSEKRADYTARTMAAVKALEQAAKLKVK |
Ga0187861_1000157320 | 3300018020 | Peatland | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKPKVKAT |
Ga0187864_1000343315 | 3300018022 | Peatland | MSKHDSVTKRNRRPKSEKRIDYTARTMAAIKQLEQAAKLKVKDA |
Ga0187889_101660063 | 3300018023 | Peatland | SKHDSVTKRNRRPKSAKRVDYTARTMAAVRQLEQAAKLKVKAA |
Ga0187881_100331054 | 3300018024 | Peatland | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEHAAKLKVKAA |
Ga0187881_103195972 | 3300018024 | Peatland | MSKQHSATKRHRRPKSDKRLDCTARTMAAVKQLEQTAKLKVKAV |
Ga0187867_103425762 | 3300018033 | Peatland | VLQQQEEPMSKHDSVTKRNRRPKSAKRVDYTARTMAAVRQLEQAAKLKVKAA |
Ga0187863_100749002 | 3300018034 | Peatland | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA |
Ga0187875_100143945 | 3300018035 | Peatland | QQEEPMSKHDSVTKRNRRPKSAKRVDYTARTMAAVRQLEQAAKLKVKAA |
Ga0187862_1000355510 | 3300018040 | Peatland | MSKQHSATKRHRRPKSDKRLDCTARTMAAVKQLEQTAKLKVKAVIAV |
Ga0187871_100575163 | 3300018042 | Peatland | MSKHDEPTKRHRRPKSGKRIDYTARTMAALRELEKAAKAKTKTA |
Ga0187890_100153711 | 3300018044 | Peatland | KRNRRPKSAKRVDYTARTMAAVRQLEQAAKLKVKAA |
Ga0066662_110143251 | 3300018468 | Grasslands Soil | MSKEEPMSKQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKK |
Ga0066662_125136942 | 3300018468 | Grasslands Soil | MKQQQEKPMSKHDSVTKRSRRPKSDRRVDYTARTMAAVKKLEQAARLKAK |
Ga0066669_118313211 | 3300018482 | Grasslands Soil | MSKHDSVTKRKRRPKSDKRVDYTARTMAIVKQLSEAAKVK |
Ga0182031_12190805 | 3300019787 | Bog | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKELEQ |
Ga0193751_10122282 | 3300019888 | Soil | MSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKIKK |
Ga0193751_10133216 | 3300019888 | Soil | MSKHDSATKRKRRPKSDKRVDYTASTMAAVKKLEQAAKAS |
Ga0193751_10646282 | 3300019888 | Soil | MSNNHSVTKRHRRPKSVKRTDYTARTMAAVKQLELAAKPKAK |
Ga0179594_103540102 | 3300020170 | Vadose Zone Soil | MSKHDSVTKRNRRPKSDRRVDYTARTMAAVKKLEQAAKLKAK |
Ga0210407_100023868 | 3300020579 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALRELEKAAKLRTKPA |
Ga0210407_102720803 | 3300020579 | Soil | SKHDSVTKRKRRPKSDKRVDYTARTMAIVKQLSEAAKVK |
Ga0210407_106173981 | 3300020579 | Soil | MSKHDTATKRHRRPKSGKRIDYTASTMAALKKLGEAEKQKSKTA |
Ga0210407_107286272 | 3300020579 | Soil | MSKHDTATKRHRRPKSGKRIDYTARTMAALKKLKEADKPKAKTA |
Ga0210403_101711191 | 3300020580 | Soil | MSKHDTATKRHRRPKSAKRIDYTARTMAALKKLKEADKQKSKTA |
Ga0210403_105301492 | 3300020580 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLKTKPA |
Ga0210399_104461111 | 3300020581 | Soil | KRHRRPKSAKRVDYTARTMAALKELEKAAKLRMKPA |
Ga0210395_104382631 | 3300020582 | Soil | MSKHDSVTKRNRRPKSDKRVDYTARTMAAVKQLEQAAKVKK |
Ga0210401_1000415214 | 3300020583 | Soil | MSKHDEPTKRHRRPKSGKRTDYTARTMAALKELEKAEKLKAKTA |
Ga0210401_100077936 | 3300020583 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRSKPA |
Ga0210401_103110862 | 3300020583 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELEKAAKLRMKPA |
Ga0210401_112170412 | 3300020583 | Soil | MMSKHDTATKRHRRPKSGKRIDYTASTMAALKALEQAAKKKAKSA |
Ga0179596_100479085 | 3300021086 | Vadose Zone Soil | MSKHNSVTKRNRRPKSDKRADYTARTMAAVKELEQAAKLKVKLETH |
Ga0210404_106227523 | 3300021088 | Soil | MSKHDTATKRHRRPKSGKRVDYTARTMAALKQLTQDA |
Ga0210406_113628831 | 3300021168 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRMKPA |
Ga0210400_1000015750 | 3300021170 | Soil | MSNQHSVTKRHRRPKSDKRADYTARTMAAVKQLEKAAKEKTK |
Ga0210400_100986492 | 3300021170 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELKNAAKLKAKPA |
Ga0210400_104608372 | 3300021170 | Soil | MSNQHSVTKRHRRPKSEKRVDYTARTMAAVKQLEQAAKPKTK |
Ga0210405_1000166917 | 3300021171 | Soil | MSKHDTATKRHRRPKSGKRVDYTARTMAALKELRQAAKVNTK |
Ga0210405_101442553 | 3300021171 | Soil | MSKHDTATKRQRRPKSRKRIDYTARTMAALKELRQAAKVNTK |
Ga0210405_103842991 | 3300021171 | Soil | SKDEDTMSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRMKPA |
Ga0210405_106745423 | 3300021171 | Soil | DTATKRHRRPKSAKRVDHTARTMAALKELEKAAKLRMKPA |
Ga0210396_101196812 | 3300021180 | Soil | MSKHDTATKRHRRPKSPKRVDYTARTMAALKELEKAAKLRTKPA |
Ga0210396_101902561 | 3300021180 | Soil | MSKHDTATKRHRRPKSAKRIDYTARTMAALKKLEEAANKKSKTA |
Ga0210388_101403474 | 3300021181 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA |
Ga0210388_102731971 | 3300021181 | Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALRELEKAEKAKK |
Ga0210388_105024652 | 3300021181 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELRLAAKETTK |
Ga0210388_117799431 | 3300021181 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKA |
Ga0210385_100391412 | 3300021402 | Soil | MSKHDTPTKRHRRPKSAKRIDYTARTMAALKELEKAAKLRAKPA |
Ga0210385_112478391 | 3300021402 | Soil | MSKHDTATKRHRRPKSGKRVDYTARTMAALKELKQAAKVTE |
Ga0210389_109577452 | 3300021404 | Soil | DTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRMKPA |
Ga0210387_100653473 | 3300021405 | Soil | MSKHDTATKRHRRPKSGKRIDYTASTMAALKALEQAAKKKAKSA |
Ga0210386_104090972 | 3300021406 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEK |
Ga0210383_100049192 | 3300021407 | Soil | MSKHDTPTKRHRRPKSRKRIDYTASTMAALKELEKAAKLKTKPA |
Ga0210383_104637081 | 3300021407 | Soil | EDTMSKHDTPTKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA |
Ga0210383_116492731 | 3300021407 | Soil | TKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA |
Ga0210394_10000053170 | 3300021420 | Soil | MSKHDTATKRHRRPKSGKRIDYTARTMAALKKLGEADKPKAKTA |
Ga0210384_100535241 | 3300021432 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALRELEKAAKLRTKP |
Ga0210391_100352498 | 3300021433 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELKNAAK |
Ga0210391_100853063 | 3300021433 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKSA |
Ga0210391_101387063 | 3300021433 | Soil | MSKHDTATKRHRRPKSAKRIDYTARTMATLKKLKEADKQKAKTA |
Ga0210391_107273191 | 3300021433 | Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAK |
Ga0210391_110294232 | 3300021433 | Soil | MSKHDTPTKPHRRPKSAKRVDYTARTMAALKQLAHEAKL |
Ga0210392_105266102 | 3300021475 | Soil | MSKHDTATKRHRRPKSAKRKDYTARTMAALKELEKAAKLRAKPA |
Ga0210402_103290343 | 3300021478 | Soil | MSKHDTATKRHRRPKSDKRIDYTARTMAALKELKQAAKAKAKTA |
Ga0210402_105397852 | 3300021478 | Soil | MSKHDTATKRHRRPKSGKRIDYTARTMAALKKLEEAAKARSKPA |
Ga0210409_100295448 | 3300021559 | Soil | MSKHDSVTKRKRRPKSDKRIDYTARTMAIVKQLSEAAKVK |
Ga0224541_10141112 | 3300022521 | Soil | MSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEEAAKKKDK |
Ga0212123_1001312813 | 3300022557 | Iron-Sulfur Acid Spring | SVTKRHRRPKSEKRVDYTARTMAAVKQLEQAAKPKTK |
Ga0212123_100420942 | 3300022557 | Iron-Sulfur Acid Spring | MSKHNSVTKQKRRPKSDKRIDYTARTMAVLKQLSQAAESK |
Ga0224545_10233452 | 3300022881 | Soil | MSKHDTVTKRNRRPKSAKRVDYTARTMAAVKQLEQAAKLKVKSA |
Ga0224558_10036073 | 3300023090 | Soil | MSKHDSVTKRNRRPKSEKRIDYTARTMAAIKQLEQAAKLKVKAA |
Ga0224558_10537873 | 3300023090 | Soil | MSKHNSVTKRNRRPKSEKRADYTAHTMAAVKELEQAAKLKVK |
Ga0228598_10025223 | 3300024227 | Rhizosphere | MSKHDTPTKRHRRPKSAKRVDYTARTTAALKELRRAAKETTK |
Ga0208587_10620992 | 3300025484 | Arctic Peat Soil | MAKHDSVTKRHRRPKSAKRADYTARTMAAVKALEQAAKLKGK |
Ga0208188_11001291 | 3300025507 | Peatland | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKPKVK |
Ga0208714_10155452 | 3300025527 | Arctic Peat Soil | MSKQHSVTKRHRRPKSEKREDYTARTMAAVRLLEQAAKLKK |
Ga0207684_100427424 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHNSVTKRKRRPKSDKRADYTARTMAAVKELEQAAKLKVKAAGTAVSM |
Ga0207665_109077382 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNQHSVTKRHRRPKSDKRVDYTARTMAAVKQLELAAKLKTK |
Ga0209840_10056843 | 3300026223 | Soil | MSKHNSVTKRNRRPKSDKRADYTARTMAAVKELEQAAKLKVK |
Ga0209890_1000021912 | 3300026291 | Soil | MSNQHSVTKRHRRPKSEKRVDYTARTMAAVKQLEQAAKPKAK |
Ga0209471_11375661 | 3300026318 | Soil | MSNNHSVTKRHRRPKSVKRTDYTARTMAAVKQLELAAKPKGK |
Ga0209377_10082992 | 3300026334 | Soil | MSKEEPMSKQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQATKLKK |
Ga0257166_10584491 | 3300026358 | Soil | MSKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLEQAAKLKAK |
Ga0257167_10619002 | 3300026376 | Soil | EPMSKHNSVTKRNRRPKSDKRADYTARTMAAVKELEQAAKLKVKLETH |
Ga0257154_10830661 | 3300026467 | Soil | MSKHDSVTKRNRRPKSDKRIDYTARTMAAVKQLEQAAKL |
Ga0247846_10093651 | 3300026474 | Soil | GKQEELMSKHDSVTKRNRRPKSDKRSDYTARTMAAVKELEQAAKRKGK |
Ga0257160_10475841 | 3300026489 | Soil | MSNNHSVTKRHRRPKSVKRTDYTARTMAAVKQLELAAK |
Ga0179587_103445272 | 3300026557 | Vadose Zone Soil | KHDSVTKRNRRPKSAKRVDYTARTMAAVKKLEEAAKAKPK |
Ga0209421_10296202 | 3300027432 | Forest Soil | KRHRRPKSDKRVDYTARTMAALKELKQAAKLKIKTA |
Ga0209332_10031403 | 3300027439 | Forest Soil | MSNNHSVTKRHRRPKSVKRTDHTATTMAAIRKLELAAKPKAK |
Ga0209524_10239882 | 3300027521 | Forest Soil | MSKHDSVTKRKRRPKSDKRVDYTARTMAAVKQLEQAAKLKKRSEH |
Ga0208043_11430002 | 3300027570 | Peatlands Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALRELEKAAKLKSKTA |
Ga0209331_10529002 | 3300027603 | Forest Soil | QQRKKEPMSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKK |
Ga0209329_11456071 | 3300027605 | Forest Soil | MSKHDTPTKPHRRPKSGKRVDYTARTMLALKQLAHEAKLR |
Ga0209117_11852341 | 3300027645 | Forest Soil | MSNQHSVTKRHRRPKSEKRVDYTARTMAAVKQLEQ |
Ga0209420_10372423 | 3300027648 | Forest Soil | DTPTKRHRRPKSSKRIDYTARTMAALKELEKAAKLRTKTA |
Ga0209420_11523232 | 3300027648 | Forest Soil | MSNQHSVTKRHRRPKSPKRLDSTAKTMAAVKELEQAAKKKEK |
Ga0208565_11612252 | 3300027662 | Peatlands Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALKELEKA |
Ga0208565_12085452 | 3300027662 | Peatlands Soil | KRHRRPMSGKRADYTARTMAAVKQLEQAAKLKVKAA |
Ga0209118_1000016117 | 3300027674 | Forest Soil | MSKHDTATKRHRRPKSGKRVDYTARTMAVLKELKQAAKLRNKAG |
Ga0209118_10032709 | 3300027674 | Forest Soil | MSKHDTATKRHRRPKSKKRVDYTARTMAALKELNQAARLRTKAG |
Ga0209118_10179324 | 3300027674 | Forest Soil | MSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKLKK |
Ga0209333_10648822 | 3300027676 | Forest Soil | MSKHDTATKRHRRPKSAKRIDYTARTMAALKKLKEADKQKAKTA |
Ga0208696_10434383 | 3300027696 | Peatlands Soil | SVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKLKVKAA |
Ga0209447_100497161 | 3300027701 | Bog Forest Soil | DTPTKRHRRPKSSKRIDYTARTMAALKELEKAAKLRTKPA |
Ga0208989_100081842 | 3300027738 | Forest Soil | MSQQHSVTKRHRRPKSEKRVDYTARTMAAVKRLEQAAKLKK |
Ga0208989_100638521 | 3300027738 | Forest Soil | KKEPMSNQHSVTKRHRRPKSAKRADYTARTMAAVKQLEQAAKPKK |
Ga0209655_100308914 | 3300027767 | Bog Forest Soil | MSKHDTATKRHRRPKSAKRVDYTARTMAALKELRRAAKETSK |
Ga0209039_100209356 | 3300027825 | Bog Forest Soil | MSKQHSATKRHRRPKSDKRLDCTARTMAAVKQLEQAAKLKVK |
Ga0209039_101660983 | 3300027825 | Bog Forest Soil | MSKHDSVTKRNRRPKSGKRVDCTARTMAAVKQLEQAAKLKTK |
Ga0209773_100281483 | 3300027829 | Bog Forest Soil | MSKHDTPTKRHRRPKSSKRIDYTARTMAALKELEKAAKLRTKPA |
Ga0209180_103484141 | 3300027846 | Vadose Zone Soil | NRRPKSDKRADYTARTMAAVKELEQAAKLKVKLETH |
Ga0209517_100157528 | 3300027854 | Peatlands Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALKELEKAAKLRTKTA |
Ga0209517_100736534 | 3300027854 | Peatlands Soil | MSKHDSVTKRNRRPKSGKRVDCTARTMAAVKQLEQAAKLKVK |
Ga0209517_100913704 | 3300027854 | Peatlands Soil | MSNQHSVTKRHRRPKSEKRADYTARTMAAVKQLEQAAKLKAK |
Ga0209517_101065792 | 3300027854 | Peatlands Soil | MSKHNSVTKRHRRPRSGKRVDYTARTMAAVKELEQPAKLKVK |
Ga0209517_102101713 | 3300027854 | Peatlands Soil | MSKQHSATKRHRRPKSDKRADYTARTMAAVKELEQAAKLKVKLILPAVA |
Ga0209283_100254935 | 3300027875 | Vadose Zone Soil | MSKQHSATKRHRRPKSEKRTDYTARTMAAVKQLEQAAKLKVK |
Ga0209169_100550211 | 3300027879 | Soil | MSKHDTPTKRHRRPKSSKRIDYTARTMAALKELEKAAKLRTKTA |
Ga0209169_100810543 | 3300027879 | Soil | MSKHDEPTKRHRRPKSGKRTDYTARTMAALKELEKAAKLKGKTA |
Ga0209169_100876802 | 3300027879 | Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALRELEKAAKEKSKTA |
Ga0209169_103343312 | 3300027879 | Soil | MSNQHSVTKRHRRPKSAKRADYTAKTMAAIKQLEQAAKPKSNK |
Ga0209275_100076551 | 3300027884 | Soil | MSKHDTATKRHRRPKSAKRVDHTARTMAALKELEKAAKLRMKPA |
Ga0209624_109981951 | 3300027895 | Forest Soil | MSKHDTPTKPHRRPKSRKRVDYTARTMAALKQLAQD |
Ga0209488_100818601 | 3300027903 | Vadose Zone Soil | MSNQHSVTKRHRRPKSAKRADYTARTIAAVQQLEKAAKL |
Ga0209415_100035681 | 3300027905 | Peatlands Soil | KHEDTMSKHDTATKRHRRPKSAKRVDYTARTMAALKELEKAAKLRTKPA |
Ga0209415_100978733 | 3300027905 | Peatlands Soil | MSKHDTPTKPHRRPKSKKRVDYTARTMAALRELKEAAKVKS |
Ga0209415_108533581 | 3300027905 | Peatlands Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALRELEKADKQKPKTA |
Ga0209006_112219232 | 3300027908 | Forest Soil | MSKHDTATKRHRRPKSGKRIDYTARTMAALKELEKAAKLKTKTA |
Ga0209698_100411947 | 3300027911 | Watersheds | MSKHDSVTKRNRRPKSDRRVDYTARTMAAVKKLEQAAKPKK |
Ga0209698_101139705 | 3300027911 | Watersheds | MSKHDSVTKRHSRPKSGKRVDYTARTMAAVKKLEQAAKPKAK |
Ga0209698_101487834 | 3300027911 | Watersheds | MSNKHSLTKRHRRPKSGKRADSTARTMAAVKELEQAARLKVKAV |
Ga0265353_10251611 | 3300028015 | Soil | VSKHDSVTKRKRRPKSDKRVDYTARTMAVLRELAKAAKL |
Ga0268266_104616251 | 3300028379 | Switchgrass Rhizosphere | LSKHDTATKRHTRPKSKKRIDYTARTMAILKKLKE |
Ga0137415_100009607 | 3300028536 | Vadose Zone Soil | MSKHDSVTKRNRRPKSDRRVDYTARTMAAVKKLEQAAKLKSK |
Ga0265326_100490422 | 3300028558 | Rhizosphere | MSNQHSVTKRHRRQKSVKRVDYSAQTMAAVKQLELAENLKTGKEVKK |
Ga0302162_100045692 | 3300028649 | Fen | MSKHDSVTKRNRRPKSGKRADCTARTMAAVKQLEQAAKLKGK |
Ga0308309_103475322 | 3300028906 | Soil | SKHDEPTKRHSRPKSGKRTDYTARTMAALKELEKAQKLRTKPA |
Ga0311334_101634682 | 3300029987 | Fen | MSKHDTVTKRNRRPKSDKRIDYTASTMAALKRLEEAAKAKK |
Ga0302177_103527071 | 3300030053 | Palsa | MSNQHNVTKRHRRPKSAKRSDYTARTMAAVKQLEQAAKKKEK |
Ga0311333_111896851 | 3300030114 | Fen | MSNQHSVTKRHRRPKSEKRTDYTARTMAAVKQLELAAK |
Ga0310038_104509671 | 3300030707 | Peatlands Soil | MSKHNSVTKRNRRPKSGKRADYTARTMAAVKELEQAAKLKVKLILPAVA |
Ga0265740_10036283 | 3300030940 | Soil | VSKHDTVTKRKRRPKSDRRVDYSARTMAALRELEKAAK |
Ga0311366_107156102 | 3300030943 | Fen | NQENSMSKHDTVTKRNRRPKSDKRIDYTASTMAALKRLEEAAKAKK |
Ga0170822_154396161 | 3300031122 | Forest Soil | MSNNHSVTKRHRRPKSVKRTDYTARTMAAVKQLELAAKPKAR |
Ga0265340_100999201 | 3300031247 | Rhizosphere | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKELERAAKLKGK |
Ga0310686_1000445712 | 3300031708 | Soil | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELRRAAKETSK |
Ga0310686_1029106632 | 3300031708 | Soil | GTVSKYEETMSKHDSVTKRNRRPKSGKRVDYTARTMAALKELKQAAKVKIK |
Ga0310686_1046399564 | 3300031708 | Soil | GTVSKYEETMSKHDSVTKRNRRPKSGKRVDYTARTMAALKELEQAAKVKIK |
Ga0310686_1157238771 | 3300031708 | Soil | TVIGYEEIMGKHDTVTKRHRRPKSAKRIDYTARTMATLKKLEQAEKLKSKAS |
Ga0310686_1169493672 | 3300031708 | Soil | MSKHNSLTKQKRRPKSDKRIDYTARTMAVLKQLSQAAESK |
Ga0310686_1189996252 | 3300031708 | Soil | MSKHDSVTKRNRRPKSGKRVDYTARTMAALKELEHAAKLKIK |
Ga0310686_1193182121 | 3300031708 | Soil | MSSQHSVTKRHRRPKSAKRADYTAKTMAAIKQLEQAAKPKSNK |
Ga0310813_102728082 | 3300031716 | Soil | MSKHDSVTKRNRRPKSGKRIDYTARTMAAVRQLEEAAKLKMKRLSQAKSCWL |
Ga0307469_102955504 | 3300031720 | Hardwood Forest Soil | MSKHDSVTKRNRRPKSGKRVDYTARTMAAVKKLEEAAKAKLK |
Ga0307477_100172461 | 3300031753 | Hardwood Forest Soil | SVTKRKRRPKSDKRIDYTARTMAIVKQLSEAAKVK |
Ga0307473_105106752 | 3300031820 | Hardwood Forest Soil | MSNHDSVTKRNRRPKSNKRVDYTARTMAAVKKLEEAAKAKLK |
Ga0311367_113566031 | 3300031918 | Fen | MSKHDTVTKRNRRPKSDKRIDYTASTMAALKRLEEAAKA |
Ga0311301_1000456947 | 3300032160 | Peatlands Soil | MAKHDSVTKRHRRPKSAKREDYTARTMAAVKELEQAAKLKGK |
Ga0311301_106072332 | 3300032160 | Peatlands Soil | MSKHDSVTKRNRRPKSGKRVDYTARTMAALKELEQAAKLKIKAA |
Ga0311301_112819412 | 3300032160 | Peatlands Soil | MSKHNSVTKRKRRPKSDKRADYTARTMAAVKELEQAAELKVKLILPAVA |
Ga0307471_1000018114 | 3300032180 | Hardwood Forest Soil | MSKHDSVTKRNRRPKSDRRVDYAARTMAAVKKLERAAKIRVK |
Ga0307471_1002160732 | 3300032180 | Hardwood Forest Soil | MSKHDSVTKRNRRQKSDRRVDYTARTMAAVKKLEQAAKLKAK |
Ga0307471_1004046632 | 3300032180 | Hardwood Forest Soil | MSKHDTATKRHRRPKSGKRIDYTARTMAALKKLEEAAKLRSKPA |
Ga0307471_1005945403 | 3300032180 | Hardwood Forest Soil | MSKHDSVTKRHRRPKSDKRVDYTARTMAAVKQLELAAKLKAK |
Ga0310812_102644821 | 3300032421 | Soil | VSKHDSVTKRKRRPKSDKRVDYTARTMAAIKQHSEAEK |
Ga0348332_143665013 | 3300032515 | Plant Litter | MSKHDTPTKRHRRPKSAKRVDYTARTMAALKELRRAAKETTK |
Ga0335082_100323127 | 3300032782 | Soil | MSKHDEPTKRHRRPKSGKRIDYTARTMAALRELEKAEKLKTKTA |
Ga0326728_106591041 | 3300033402 | Peat Soil | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKKLEQAAKLKDK |
Ga0310810_111165772 | 3300033412 | Soil | MPKHDSVTKRNRRPKSGKRIDYTARTMAAVRQLEEAAKLKMKRLSQAKSCWL |
Ga0310811_104587411 | 3300033475 | Soil | MSKHDSVTKRNRRPKSGKRIDYTARTIAGVRQLEEAAKLKTK |
Ga0334821_030869_965_1075 | 3300033798 | Soil | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKELEQAA |
Ga0334843_034785_509_643 | 3300033825 | Soil | MSNQHSVTKRHRRPKSEKRKDYTARTMAAVKQLELAAKPKTKSA |
Ga0334792_010322_216_338 | 3300033888 | Soil | MSKHDSVTKRHRRPMSGKRADYTARTMAAVKQLEQAAKPQ |
Ga0326724_0033413_3956_4060 | 3300034091 | Peat Soil | MSKHDSVTKRNRRPKSDKRSDYTARTMAAVKKLEQ |
Ga0370484_0076983_191_325 | 3300034125 | Untreated Peat Soil | MSKHDSVTKRHRRPKSGKREDYTARTMAAVKQLEQAAKLKVKAA |
Ga0370515_0333872_535_639 | 3300034163 | Untreated Peat Soil | MSKHDTVTKRKRRPKSAKRVDYSARTMAALRELEK |
⦗Top⦘ |