NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F005867

Metagenome / Metatranscriptome Family F005867

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F005867
Family Type Metagenome / Metatranscriptome
Number of Sequences 388
Average Sequence Length 40 residues
Representative Sequence LPDAMKPGFHCVRTHWIRGFMAFQLARRTRTVMLMVPE
Number of Associated Samples 222
Number of Associated Scaffolds 388

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 23.62 %
% of genes near scaffold ends (potentially truncated) 57.22 %
% of genes from short scaffolds (< 2000 bps) 86.86 %
Associated GOLD sequencing projects 189
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.825 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.340 % of family members)
Environment Ontology (ENVO) Unclassified
(50.515 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(61.082 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.94%    β-sheet: 0.00%    Coil/Unstructured: 56.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 388 Family Scaffolds
PF08044DUF1707 3.61
PF07729FCD 2.32
PF00589Phage_integrase 2.32
PF00254FKBP_C 1.80
PF05506PLipase_C_C 1.55
PF14226DIOX_N 1.55
PF07690MFS_1 1.55
PF01028Topoisom_I 1.29
PF01047MarR 1.29
PF01063Aminotran_4 1.03
PF00196GerE 1.03
PF13561adh_short_C2 1.03
PF00271Helicase_C 1.03
PF05977MFS_3 1.03
PF06628Catalase-rel 1.03
PF04978DUF664 1.03
PF00561Abhydrolase_1 0.77
PF01557FAA_hydrolase 0.77
PF12697Abhydrolase_6 0.77
PF02899Phage_int_SAM_1 0.77
PF13242Hydrolase_like 0.77
PF11236DUF3037 0.77
PF12802MarR_2 0.77
PF04261Dyp_perox 0.77
PF13419HAD_2 0.77
PF03551PadR 0.52
PF13828DUF4190 0.52
PF01636APH 0.52
PF00005ABC_tran 0.52
PF13005zf-IS66 0.52
PF04266ASCH 0.52
PF04909Amidohydro_2 0.52
PF01872RibD_C 0.52
PF08241Methyltransf_11 0.52
PF08843AbiEii 0.52
PF04542Sigma70_r2 0.52
PF03050DDE_Tnp_IS66 0.52
PF02463SMC_N 0.52
PF01479S4 0.52
PF14833NAD_binding_11 0.52
PF01546Peptidase_M20 0.52
PF14333DUF4389 0.52
PF13649Methyltransf_25 0.52
PF00953Glycos_transf_4 0.52
PF04493Endonuclease_5 0.52
PF00403HMA 0.52
PF07884VKOR 0.52
PF03352Adenine_glyco 0.52
PF12847Methyltransf_18 0.26
PF13672PP2C_2 0.26
PF09678Caa3_CtaG 0.26
PF05995CDO_I 0.26
PF01979Amidohydro_1 0.26
PF12680SnoaL_2 0.26
PF02775TPP_enzyme_C 0.26
PF13602ADH_zinc_N_2 0.26
PF02077SURF4 0.26
PF03640Lipoprotein_15 0.26
PF00580UvrD-helicase 0.26
PF13520AA_permease_2 0.26
PF13147Obsolete Pfam Family 0.26
PF12072RNase_Y_N 0.26
PF09339HTH_IclR 0.26
PF03193RsgA_GTPase 0.26
PF00291PALP 0.26
PF00441Acyl-CoA_dh_1 0.26
PF01544CorA 0.26
PF13193AMP-binding_C 0.26
PF02245Pur_DNA_glyco 0.26
PF04149DUF397 0.26
PF00929RNase_T 0.26
PF13662Toprim_4 0.26
PF00188CAP 0.26
PF01037AsnC_trans_reg 0.26
PF06245DUF1015 0.26
PF14016DUF4232 0.26
PF13474SnoaL_3 0.26
PF08281Sigma70_r4_2 0.26
PF13302Acetyltransf_3 0.26
PF08669GCV_T_C 0.26
PF00378ECH_1 0.26
PF00890FAD_binding_2 0.26
PF02806Alpha-amylase_C 0.26
PF07592DDE_Tnp_ISAZ013 0.26
PF12840HTH_20 0.26
PF02810SEC-C 0.26
PF07311Dodecin 0.26
PF12867DinB_2 0.26
PF104171-cysPrx_C 0.26
PF00924MS_channel 0.26
PF00300His_Phos_1 0.26
PF00584SecE 0.26
PF13191AAA_16 0.26
PF01168Ala_racemase_N 0.26
PF00583Acetyltransf_1 0.26
PF13350Y_phosphatase3 0.26
PF00275EPSP_synthase 0.26
PF00440TetR_N 0.26
PF01193RNA_pol_L 0.26
PF13280WYL 0.26
PF00318Ribosomal_S2 0.26
PF13401AAA_22 0.26
PF13344Hydrolase_6 0.26
PF00498FHA 0.26
PF04672Methyltransf_19 0.26
PF01022HTH_5 0.26
PF00753Lactamase_B 0.26
PF08240ADH_N 0.26
PF02148zf-UBP 0.26
PF04185Phosphoesterase 0.26
PF01263Aldose_epim 0.26
PF14014DUF4230 0.26
PF00795CN_hydrolase 0.26
PF13359DDE_Tnp_4 0.26
PF04338DUF481 0.26
PF00534Glycos_transf_1 0.26
PF00892EamA 0.26
PF01243Putative_PNPOx 0.26
PF14079DUF4260 0.26
PF00135COesterase 0.26
PF00652Ricin_B_lectin 0.26
PF00877NLPC_P60 0.26
PF00248Aldo_ket_red 0.26
PF01613Flavin_Reduct 0.26
PF09206ArabFuran-catal 0.26
PF00376MerR 0.26
PF04545Sigma70_r4 0.26

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 388 Family Scaffolds
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 2.32
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 2.32
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 2.06
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 1.80
COG3569DNA topoisomerase IBReplication, recombination and repair [L] 1.29
COG0753CatalaseInorganic ion transport and metabolism [P] 1.03
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 1.03
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.77
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.77
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 0.77
COG4243Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formationGeneral function prediction only [R] 0.52
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 0.52
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.52
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.52
COG0472UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferaseCell wall/membrane/envelope biogenesis [M] 0.52
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.52
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.52
COG1515Deoxyinosine 3'-endonuclease (endonuclease V)Replication, recombination and repair [L] 0.52
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.52
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.52
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.52
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.52
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.52
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.52
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.52
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 0.52
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 0.52
COG28183-methyladenine DNA glycosylase TagReplication, recombination and repair [L] 0.52
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 0.52
COG3436TransposaseMobilome: prophages, transposons [X] 0.52
COG4198Uncharacterized conserved protein, DUF1015 familyFunction unknown [S] 0.26
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 0.26
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.26
COG5553Predicted metal-dependent enzyme of the double-stranded beta helix superfamilyGeneral function prediction only [R] 0.26
COG0052Ribosomal protein S2Translation, ribosomal structure and biogenesis [J] 0.26
COG0202DNA-directed RNA polymerase, alpha subunit/40 kD subunitTranscription [K] 0.26
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.26
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 0.26
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 0.26
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.26
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.26
COG0676D-hexose-6-phosphate mutarotaseCarbohydrate transport and metabolism [G] 0.26
COG0690Preprotein translocase subunit SecEIntracellular trafficking, secretion, and vesicular transport [U] 0.26
COG0791Cell wall-associated hydrolase, NlpC_P60 familyCell wall/membrane/envelope biogenesis [M] 0.26
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.26
COG1162Ribosome biogenesis GTPase RsgATranslation, ribosomal structure and biogenesis [J] 0.26
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 0.26
COG1761DNA-directed RNA polymerase, subunit L/RPAC2Transcription [K] 0.26
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.26
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.26
COG2017Galactose mutarotase or related enzymeCarbohydrate transport and metabolism [G] 0.26
COG20943-methyladenine DNA glycosylase MpgReplication, recombination and repair [L] 0.26
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.26
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.26
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 0.26
COG2443Preprotein translocase subunit Sss1Intracellular trafficking, secretion, and vesicular transport [U] 0.26
COG3137Putative salt-induced outer membrane protein YdiYCell wall/membrane/envelope biogenesis [M] 0.26
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.26
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 0.26
COG3973DNA helicase IVReplication, recombination and repair [L] 0.26


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.82 %
UnclassifiedrootN/A39.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig06230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia710Open in IMG/M
2124908016|OU_2_1_1_newblercontig117652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii553Open in IMG/M
2170459013|GO6OHWN01AD627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii527Open in IMG/M
2170459019|G14TP7Y01CYB3VAll Organisms → cellular organisms → Bacteria777Open in IMG/M
2170459024|GZTSFBX01D18PINot Available527Open in IMG/M
3300000956|JGI10216J12902_102540973Not Available535Open in IMG/M
3300000956|JGI10216J12902_118667390Not Available553Open in IMG/M
3300001867|JGI12627J18819_10409540Not Available552Open in IMG/M
3300004479|Ga0062595_101545732Not Available615Open in IMG/M
3300005329|Ga0070683_100057551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales3611Open in IMG/M
3300005329|Ga0070683_100342982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1422Open in IMG/M
3300005329|Ga0070683_101348627Not Available685Open in IMG/M
3300005330|Ga0070690_100853122Not Available710Open in IMG/M
3300005331|Ga0070670_100729913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae892Open in IMG/M
3300005332|Ga0066388_100404923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata2009Open in IMG/M
3300005334|Ga0068869_100153896Not Available1785Open in IMG/M
3300005335|Ga0070666_10441725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales939Open in IMG/M
3300005337|Ga0070682_100635869All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300005337|Ga0070682_100688036Not Available818Open in IMG/M
3300005338|Ga0068868_100277919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1416Open in IMG/M
3300005338|Ga0068868_100283295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1403Open in IMG/M
3300005344|Ga0070661_100639734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales863Open in IMG/M
3300005355|Ga0070671_101556478Not Available585Open in IMG/M
3300005356|Ga0070674_100550700Not Available968Open in IMG/M
3300005364|Ga0070673_100340644Not Available1329Open in IMG/M
3300005364|Ga0070673_101021046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.771Open in IMG/M
3300005366|Ga0070659_100132822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2022Open in IMG/M
3300005366|Ga0070659_101414199Not Available618Open in IMG/M
3300005367|Ga0070667_100426400Not Available1210Open in IMG/M
3300005434|Ga0070709_11357524Not Available574Open in IMG/M
3300005434|Ga0070709_11481452Not Available551Open in IMG/M
3300005435|Ga0070714_101039942Not Available797Open in IMG/M
3300005435|Ga0070714_101195990Not Available741Open in IMG/M
3300005435|Ga0070714_101619046Not Available632Open in IMG/M
3300005436|Ga0070713_101737541Not Available606Open in IMG/M
3300005437|Ga0070710_10109935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1654Open in IMG/M
3300005458|Ga0070681_10179692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2037Open in IMG/M
3300005458|Ga0070681_10190805Not Available1968Open in IMG/M
3300005526|Ga0073909_10051196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya → Sporichthya polymorpha1500Open in IMG/M
3300005530|Ga0070679_100389603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1340Open in IMG/M
3300005535|Ga0070684_101772382Not Available583Open in IMG/M
3300005539|Ga0068853_100030701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4540Open in IMG/M
3300005543|Ga0070672_100242916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1515Open in IMG/M
3300005543|Ga0070672_101297007Not Available650Open in IMG/M
3300005545|Ga0070695_100310637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1168Open in IMG/M
3300005545|Ga0070695_101690585Not Available530Open in IMG/M
3300005548|Ga0070665_100347011Not Available1489Open in IMG/M
3300005548|Ga0070665_100386258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1407Open in IMG/M
3300005548|Ga0070665_101332541Not Available727Open in IMG/M
3300005553|Ga0066695_10645424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300005563|Ga0068855_100281549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1846Open in IMG/M
3300005563|Ga0068855_100731533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. C4481056Open in IMG/M
3300005563|Ga0068855_101378011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii727Open in IMG/M
3300005563|Ga0068855_101612915Not Available664Open in IMG/M
3300005563|Ga0068855_102121863Not Available565Open in IMG/M
3300005564|Ga0070664_100059086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3262Open in IMG/M
3300005564|Ga0070664_100109951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2404Open in IMG/M
3300005564|Ga0070664_100149892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2058Open in IMG/M
3300005566|Ga0066693_10084502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea1122Open in IMG/M
3300005614|Ga0068856_101111829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales807Open in IMG/M
3300005614|Ga0068856_101724674Not Available638Open in IMG/M
3300005614|Ga0068856_102177722Not Available563Open in IMG/M
3300005617|Ga0068859_100465861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1359Open in IMG/M
3300005618|Ga0068864_102686903Not Available503Open in IMG/M
3300005718|Ga0068866_10053739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2060Open in IMG/M
3300005718|Ga0068866_10185235Not Available1233Open in IMG/M
3300005719|Ga0068861_100230127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1571Open in IMG/M
3300005834|Ga0068851_10061008All Organisms → cellular organisms → Bacteria → Terrabacteria group1932Open in IMG/M
3300005840|Ga0068870_10378612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales916Open in IMG/M
3300005841|Ga0068863_102676777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii507Open in IMG/M
3300005842|Ga0068858_100389049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1339Open in IMG/M
3300005842|Ga0068858_102236956Not Available540Open in IMG/M
3300005842|Ga0068858_102361366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300006028|Ga0070717_11514681Not Available608Open in IMG/M
3300006163|Ga0070715_10030947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae2168Open in IMG/M
3300006173|Ga0070716_100134391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora1568Open in IMG/M
3300006173|Ga0070716_101692567Not Available521Open in IMG/M
3300006175|Ga0070712_101412293Not Available607Open in IMG/M
3300006237|Ga0097621_100256648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1532Open in IMG/M
3300006358|Ga0068871_102294697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii514Open in IMG/M
3300006755|Ga0079222_10033589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2221Open in IMG/M
3300006755|Ga0079222_10259125Not Available1101Open in IMG/M
3300006755|Ga0079222_10701900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium801Open in IMG/M
3300006804|Ga0079221_10095911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1446Open in IMG/M
3300006804|Ga0079221_10478823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii800Open in IMG/M
3300006804|Ga0079221_11375623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300006806|Ga0079220_10081342All Organisms → cellular organisms → Bacteria1627Open in IMG/M
3300006806|Ga0079220_10166158Not Available1236Open in IMG/M
3300006806|Ga0079220_11046790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium aerolatum654Open in IMG/M
3300006854|Ga0075425_100571628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1301Open in IMG/M
3300006871|Ga0075434_100911832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii893Open in IMG/M
3300006871|Ga0075434_101629632Not Available654Open in IMG/M
3300006871|Ga0075434_102014600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces spectabilis582Open in IMG/M
3300006881|Ga0068865_100185684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1604Open in IMG/M
3300006881|Ga0068865_100451806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1062Open in IMG/M
3300006881|Ga0068865_100465740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1048Open in IMG/M
3300006881|Ga0068865_102133218Not Available510Open in IMG/M
3300006903|Ga0075426_10410709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales999Open in IMG/M
3300006904|Ga0075424_101662551Not Available676Open in IMG/M
3300006914|Ga0075436_101366465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300006954|Ga0079219_11996541Not Available551Open in IMG/M
3300006954|Ga0079219_12029785Not Available548Open in IMG/M
3300009036|Ga0105244_10142366Not Available1152Open in IMG/M
3300009092|Ga0105250_10141056All Organisms → cellular organisms → Bacteria → Terrabacteria group999Open in IMG/M
3300009093|Ga0105240_10459612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae1423Open in IMG/M
3300009093|Ga0105240_11923699Not Available615Open in IMG/M
3300009098|Ga0105245_10102668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2648Open in IMG/M
3300009098|Ga0105245_10912393All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300009098|Ga0105245_11029294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae868Open in IMG/M
3300009098|Ga0105245_11066669Not Available854Open in IMG/M
3300009098|Ga0105245_11117344Not Available835Open in IMG/M
3300009098|Ga0105245_11790406Not Available667Open in IMG/M
3300009098|Ga0105245_12146491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300009101|Ga0105247_10045047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2707Open in IMG/M
3300009101|Ga0105247_10380635Not Available1000Open in IMG/M
3300009101|Ga0105247_10799530Not Available719Open in IMG/M
3300009148|Ga0105243_10154045Not Available1974Open in IMG/M
3300009148|Ga0105243_10182544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1826Open in IMG/M
3300009148|Ga0105243_10202698Not Available1741Open in IMG/M
3300009148|Ga0105243_10643598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1026Open in IMG/M
3300009148|Ga0105243_12361361Not Available570Open in IMG/M
3300009162|Ga0075423_10645825Not Available1116Open in IMG/M
3300009162|Ga0075423_11274358Not Available785Open in IMG/M
3300009174|Ga0105241_10806429Not Available865Open in IMG/M
3300009176|Ga0105242_10034042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales4083Open in IMG/M
3300009177|Ga0105248_10376728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Krasilnikovia → Krasilnikovia cinnamomea1598Open in IMG/M
3300009177|Ga0105248_12666958Not Available570Open in IMG/M
3300009545|Ga0105237_10494102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1230Open in IMG/M
3300009545|Ga0105237_10684744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1032Open in IMG/M
3300009545|Ga0105237_11198277Not Available766Open in IMG/M
3300009545|Ga0105237_11516756Not Available677Open in IMG/M
3300009545|Ga0105237_11583999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300009551|Ga0105238_10513359Not Available1200Open in IMG/M
3300009551|Ga0105238_11170963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora793Open in IMG/M
3300009551|Ga0105238_11681534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia666Open in IMG/M
3300009553|Ga0105249_10132391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2382Open in IMG/M
3300009553|Ga0105249_10145076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2279Open in IMG/M
3300009553|Ga0105249_11248113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia814Open in IMG/M
3300009553|Ga0105249_11771420Not Available690Open in IMG/M
3300009553|Ga0105249_13480223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300009792|Ga0126374_10148449Not Available1416Open in IMG/M
3300009792|Ga0126374_10367509Not Available993Open in IMG/M
3300009792|Ga0126374_11330876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria582Open in IMG/M
3300010043|Ga0126380_10063393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2061Open in IMG/M
3300010046|Ga0126384_11125551Not Available721Open in IMG/M
3300010046|Ga0126384_11584081Not Available616Open in IMG/M
3300010046|Ga0126384_12163916Not Available535Open in IMG/M
3300010047|Ga0126382_11018610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2568727Open in IMG/M
3300010333|Ga0134080_10550022Not Available555Open in IMG/M
3300010358|Ga0126370_10088753Not Available2103Open in IMG/M
3300010359|Ga0126376_11112133Not Available799Open in IMG/M
3300010360|Ga0126372_10605490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1052Open in IMG/M
3300010362|Ga0126377_12889130Not Available554Open in IMG/M
3300010371|Ga0134125_10400602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1522Open in IMG/M
3300010371|Ga0134125_10510574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1331Open in IMG/M
3300010371|Ga0134125_11295988Not Available795Open in IMG/M
3300010371|Ga0134125_11296979Not Available795Open in IMG/M
3300010371|Ga0134125_11566892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300010371|Ga0134125_12559073Not Available555Open in IMG/M
3300010373|Ga0134128_10369950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1601Open in IMG/M
3300010373|Ga0134128_10522009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1324Open in IMG/M
3300010373|Ga0134128_12809819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300010375|Ga0105239_10985588Not Available969Open in IMG/M
3300010375|Ga0105239_11184491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia880Open in IMG/M
3300010375|Ga0105239_12083454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300010396|Ga0134126_12166813Not Available607Open in IMG/M
3300010397|Ga0134124_10250510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1629Open in IMG/M
3300010399|Ga0134127_10022522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4915Open in IMG/M
3300010400|Ga0134122_10091230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2398Open in IMG/M
3300010400|Ga0134122_10199906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1657Open in IMG/M
3300010400|Ga0134122_10344068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1296Open in IMG/M
3300010401|Ga0134121_10068505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2932Open in IMG/M
3300010401|Ga0134121_10292080All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300010401|Ga0134121_13228966Not Available504Open in IMG/M
3300010403|Ga0134123_10132473All Organisms → cellular organisms → Bacteria2035Open in IMG/M
3300010403|Ga0134123_10414144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora1240Open in IMG/M
3300010403|Ga0134123_12984878Not Available542Open in IMG/M
3300011119|Ga0105246_10026051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3816Open in IMG/M
3300012206|Ga0137380_10461660All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300012208|Ga0137376_10603220Not Available950Open in IMG/M
3300012209|Ga0137379_10005338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia12116Open in IMG/M
3300012209|Ga0137379_10135683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2364Open in IMG/M
3300012349|Ga0137387_11085578All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300012351|Ga0137386_10584008Not Available804Open in IMG/M
3300012473|Ga0157340_1003350Not Available874Open in IMG/M
3300012498|Ga0157345_1010858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300012951|Ga0164300_10063664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1506Open in IMG/M
3300012955|Ga0164298_10055006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1931Open in IMG/M
3300012955|Ga0164298_10664408All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300012957|Ga0164303_10058410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1746Open in IMG/M
3300012957|Ga0164303_10090708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1486Open in IMG/M
3300012957|Ga0164303_11096799Not Available574Open in IMG/M
3300012960|Ga0164301_10021442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2902Open in IMG/M
3300012961|Ga0164302_10003736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5294Open in IMG/M
3300012984|Ga0164309_10915518All Organisms → cellular organisms → Bacteria → Terrabacteria group716Open in IMG/M
3300012984|Ga0164309_11089264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii664Open in IMG/M
3300012985|Ga0164308_10477377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1038Open in IMG/M
3300012985|Ga0164308_10608914All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300012985|Ga0164308_12051656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300012986|Ga0164304_11349604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300012986|Ga0164304_11416332Not Available571Open in IMG/M
3300012987|Ga0164307_11550254Not Available560Open in IMG/M
3300012988|Ga0164306_10040269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2756Open in IMG/M
3300012988|Ga0164306_11271855Not Available620Open in IMG/M
3300012989|Ga0164305_10066759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2181Open in IMG/M
3300013100|Ga0157373_10179400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1491Open in IMG/M
3300013100|Ga0157373_10204126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium1393Open in IMG/M
3300013100|Ga0157373_10248805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1257Open in IMG/M
3300013102|Ga0157371_10508313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria890Open in IMG/M
3300013104|Ga0157370_11485926Not Available609Open in IMG/M
3300013104|Ga0157370_11968566Not Available524Open in IMG/M
3300013105|Ga0157369_10888103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria914Open in IMG/M
3300013105|Ga0157369_11423270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia706Open in IMG/M
3300013105|Ga0157369_11626082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300013105|Ga0157369_11696698Not Available642Open in IMG/M
3300013296|Ga0157374_10601288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium1110Open in IMG/M
3300013296|Ga0157374_11042074Not Available838Open in IMG/M
3300013296|Ga0157374_11210698Not Available777Open in IMG/M
3300013296|Ga0157374_11658915Not Available664Open in IMG/M
3300013296|Ga0157374_12948305Not Available503Open in IMG/M
3300013297|Ga0157378_10726040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300013306|Ga0163162_10502897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1342Open in IMG/M
3300013306|Ga0163162_12487720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300013307|Ga0157372_11332408Not Available828Open in IMG/M
3300013307|Ga0157372_11537003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300013307|Ga0157372_11556686All Organisms → cellular organisms → Bacteria → Terrabacteria group761Open in IMG/M
3300013307|Ga0157372_11607459Not Available748Open in IMG/M
3300013307|Ga0157372_12000422Not Available666Open in IMG/M
3300013307|Ga0157372_13382972All Organisms → cellular organisms → Bacteria → Terrabacteria group508Open in IMG/M
3300013308|Ga0157375_10436483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora1475Open in IMG/M
3300013308|Ga0157375_12336882Not Available638Open in IMG/M
3300013308|Ga0157375_12719336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300013308|Ga0157375_13769915All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300014326|Ga0157380_11636968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia700Open in IMG/M
3300014745|Ga0157377_10086451All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300014745|Ga0157377_10702987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora734Open in IMG/M
3300014968|Ga0157379_10370419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300014968|Ga0157379_10779990Not Available901Open in IMG/M
3300014969|Ga0157376_10567360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1125Open in IMG/M
3300015242|Ga0137412_10519759All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300015372|Ga0132256_100372645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1525Open in IMG/M
3300017792|Ga0163161_10123694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ungokensis1946Open in IMG/M
3300017792|Ga0163161_11005144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii712Open in IMG/M
3300017792|Ga0163161_11299537Not Available632Open in IMG/M
3300017792|Ga0163161_11716750Not Available556Open in IMG/M
3300018482|Ga0066669_11044004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia738Open in IMG/M
3300019877|Ga0193722_1028878Not Available1436Open in IMG/M
3300019877|Ga0193722_1114546Not Available630Open in IMG/M
3300020002|Ga0193730_1135469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300020002|Ga0193730_1151048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii614Open in IMG/M
3300020069|Ga0197907_11400620Not Available568Open in IMG/M
3300020070|Ga0206356_10808002All Organisms → cellular organisms → Bacteria → Proteobacteria748Open in IMG/M
3300020082|Ga0206353_11641085Not Available612Open in IMG/M
3300021401|Ga0210393_10868722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → unclassified Frankiales → Frankineae bacterium MT45733Open in IMG/M
3300021403|Ga0210397_10155688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1600Open in IMG/M
3300021404|Ga0210389_10304868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces gilvigriseus1248Open in IMG/M
3300021475|Ga0210392_10234928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1293Open in IMG/M
3300021475|Ga0210392_10631894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300022756|Ga0222622_10136703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1563Open in IMG/M
3300024232|Ga0247664_1099898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300024254|Ga0247661_1026436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1028Open in IMG/M
3300024254|Ga0247661_1079194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300024331|Ga0247668_1070902All Organisms → cellular organisms → Bacteria → Terrabacteria group704Open in IMG/M
3300024331|Ga0247668_1090600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300025885|Ga0207653_10018902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2170Open in IMG/M
3300025885|Ga0207653_10039312All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300025885|Ga0207653_10123989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii932Open in IMG/M
3300025900|Ga0207710_10166968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces angustmyceticus1075Open in IMG/M
3300025900|Ga0207710_10248034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii890Open in IMG/M
3300025900|Ga0207710_10481817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora643Open in IMG/M
3300025903|Ga0207680_10213869Not Available1319Open in IMG/M
3300025905|Ga0207685_10014405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2475Open in IMG/M
3300025905|Ga0207685_10125687Not Available1132Open in IMG/M
3300025905|Ga0207685_10126864All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300025906|Ga0207699_10342659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M
3300025908|Ga0207643_10231086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1134Open in IMG/M
3300025909|Ga0207705_10242046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1374Open in IMG/M
3300025911|Ga0207654_10168371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1421Open in IMG/M
3300025914|Ga0207671_11015848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300025916|Ga0207663_11268686All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii593Open in IMG/M
3300025916|Ga0207663_11472404Not Available548Open in IMG/M
3300025917|Ga0207660_10157915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1747Open in IMG/M
3300025917|Ga0207660_10498194All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300025918|Ga0207662_10021450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales3692Open in IMG/M
3300025921|Ga0207652_10200296Not Available1797Open in IMG/M
3300025921|Ga0207652_10650743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Catellatospora942Open in IMG/M
3300025924|Ga0207694_11238628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300025926|Ga0207659_11629636Not Available550Open in IMG/M
3300025927|Ga0207687_10961882Not Available732Open in IMG/M
3300025928|Ga0207700_11903717Not Available521Open in IMG/M
3300025929|Ga0207664_11175853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii684Open in IMG/M
3300025929|Ga0207664_11349314Not Available633Open in IMG/M
3300025935|Ga0207709_10795917Not Available763Open in IMG/M
3300025936|Ga0207670_10640996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora875Open in IMG/M
3300025938|Ga0207704_10414556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1066Open in IMG/M
3300025938|Ga0207704_10775489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium799Open in IMG/M
3300025940|Ga0207691_10056849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3563Open in IMG/M
3300025940|Ga0207691_10496214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1037Open in IMG/M
3300025941|Ga0207711_10777253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora892Open in IMG/M
3300025942|Ga0207689_10020732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae5527Open in IMG/M
3300025942|Ga0207689_11749100Not Available514Open in IMG/M
3300025944|Ga0207661_10534585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora1073Open in IMG/M
3300025945|Ga0207679_11506810Not Available617Open in IMG/M
3300025949|Ga0207667_11082439Not Available785Open in IMG/M
3300025960|Ga0207651_11399454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300025960|Ga0207651_11791743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii553Open in IMG/M
3300025961|Ga0207712_10326614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1268Open in IMG/M
3300025972|Ga0207668_10099390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2159Open in IMG/M
3300026023|Ga0207677_11774855Not Available572Open in IMG/M
3300026035|Ga0207703_10270701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1539Open in IMG/M
3300026041|Ga0207639_10116633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2186Open in IMG/M
3300026041|Ga0207639_10129299Not Available2088Open in IMG/M
3300026041|Ga0207639_11737816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300026075|Ga0207708_10919067All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300026078|Ga0207702_11072948All Organisms → cellular organisms → Bacteria → Terrabacteria group799Open in IMG/M
3300026116|Ga0207674_10027718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5987Open in IMG/M
3300026116|Ga0207674_10065383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3666Open in IMG/M
3300026118|Ga0207675_100021016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura6085Open in IMG/M
3300026118|Ga0207675_102206188All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300026121|Ga0207683_10015016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6591Open in IMG/M
3300026121|Ga0207683_10237800All Organisms → cellular organisms → Bacteria → Terrabacteria group1661Open in IMG/M
3300027002|Ga0209110_1012673All Organisms → cellular organisms → Bacteria → Proteobacteria964Open in IMG/M
3300027050|Ga0209325_1005979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1293Open in IMG/M
3300027100|Ga0208862_103578Not Available572Open in IMG/M
3300027725|Ga0209178_1388085Not Available528Open in IMG/M
3300027765|Ga0209073_10337588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium aerolatum605Open in IMG/M
3300027775|Ga0209177_10127518Not Available839Open in IMG/M
3300028072|Ga0247675_1013338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1163Open in IMG/M
3300028072|Ga0247675_1018811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora989Open in IMG/M
3300028146|Ga0247682_1054365Not Available724Open in IMG/M
3300028146|Ga0247682_1057719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora703Open in IMG/M
3300028379|Ga0268266_11201897All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300028379|Ga0268266_11402894Not Available674Open in IMG/M
3300028379|Ga0268266_11936079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii563Open in IMG/M
3300028381|Ga0268264_12402569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia533Open in IMG/M
3300028709|Ga0307279_10087352Not Available564Open in IMG/M
3300028720|Ga0307317_10220013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300028768|Ga0307280_10085127Not Available1034Open in IMG/M
3300028768|Ga0307280_10300956Not Available585Open in IMG/M
3300028784|Ga0307282_10123675All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300028784|Ga0307282_10147895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1111Open in IMG/M
3300028784|Ga0307282_10486226Not Available599Open in IMG/M
3300028787|Ga0307323_10057459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1376Open in IMG/M
3300028791|Ga0307290_10167144Not Available806Open in IMG/M
3300028791|Ga0307290_10383409Not Available514Open in IMG/M
3300028793|Ga0307299_10204992Not Available742Open in IMG/M
3300028793|Ga0307299_10374985Not Available533Open in IMG/M
3300028799|Ga0307284_10429153Not Available539Open in IMG/M
3300028807|Ga0307305_10136961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1130Open in IMG/M
3300028819|Ga0307296_10842683Not Available500Open in IMG/M
3300028828|Ga0307312_10032369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3055Open in IMG/M
3300028828|Ga0307312_10600224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia728Open in IMG/M
3300028828|Ga0307312_11121384Not Available520Open in IMG/M
3300028884|Ga0307308_10028670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2581Open in IMG/M
3300031421|Ga0308194_10329874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300031720|Ga0307469_11453628Not Available655Open in IMG/M
3300031720|Ga0307469_11621614Not Available622Open in IMG/M
3300031720|Ga0307469_12437251Not Available511Open in IMG/M
3300031740|Ga0307468_100519603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria950Open in IMG/M
3300031820|Ga0307473_11536213Not Available506Open in IMG/M
3300031996|Ga0308176_11223671Not Available797Open in IMG/M
3300032074|Ga0308173_10617019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia984Open in IMG/M
3300032174|Ga0307470_10952859Not Available679Open in IMG/M
3300032174|Ga0307470_11518242Not Available557Open in IMG/M
3300032180|Ga0307471_100265278Not Available1781Open in IMG/M
3300032180|Ga0307471_100666351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1204Open in IMG/M
3300032180|Ga0307471_101820939All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300032205|Ga0307472_100179242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1585Open in IMG/M
3300032205|Ga0307472_100462969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora1081Open in IMG/M
3300032205|Ga0307472_102426607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300032783|Ga0335079_10023468All Organisms → cellular organisms → Bacteria → Terrabacteria group7065Open in IMG/M
3300032896|Ga0335075_10821558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces867Open in IMG/M
3300032898|Ga0335072_10517490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1230Open in IMG/M
3300033004|Ga0335084_11293263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii726Open in IMG/M
3300033412|Ga0310810_11328602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300034817|Ga0373948_0106278Not Available666Open in IMG/M
3300034818|Ga0373950_0094102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis639Open in IMG/M
3300034818|Ga0373950_0111174Not Available598Open in IMG/M
3300034819|Ga0373958_0132229Not Available612Open in IMG/M
3300034820|Ga0373959_0070960Not Available787Open in IMG/M
3300034820|Ga0373959_0141411Not Available603Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.41%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.12%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.12%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.35%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.55%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.03%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.52%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.26%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.26%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.26%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.26%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.26%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.26%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012473Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610Host-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027002Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027100Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF025 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028146Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_018999502124908016WHRVALDPGFHCVTTHSNWGFMGFQPVRRTRTVMLMVLT
OU_001919402124908016PDAMKPGIHGVRTRWIRGFMAFQLARRTRAVRLMVPE
N57_017233302170459013Grass SoilMKIGPLPDALKPGFQCARTHWNRGFMAFRLVRRTRAAVLTVPM
4MG_052747902170459019Switchgrass, Maize And Mischanthus LitterMKPGIHCVRTHWILGFIAFQLARRARTLMLMIPGWPSLD
FD1_000953702170459024Grass SoilMEPGFHCVTTHWIRDFMAFQLARRTRTAMLMVPVCPESV
JGI10216J12902_10254097313300000956SoilMEPGFHCVRTHWIRGFMAFRLAGRTRTVLLMVPV*
JGI10216J12902_11866739023300000956SoilMTIRLLPDALEPGFHCVRTRWIWGFTTLQLARRTRTVLLVVLV*
JGI12627J18819_1040954023300001867Forest SoilPDALDSGFHCVRTPWIRGFMAFRLARSTRTAMLMVPV*
Ga0062595_10154573213300004479SoilMLFSAPLKLIMKIGPLPDALKPDIHCVRTQWIRGFIAFLLARRTETLMLMVPV*
Ga0070683_10005755123300005329Corn RhizosphereVLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRNEP*
Ga0070683_10034298213300005329Corn RhizosphereMPDAMESDIHGVRTHWIRGFMAFQLARCIRTVVLTVPVWPESGF
Ga0070683_10134862713300005329Corn RhizosphereMAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTVLLMVPM*
Ga0070690_10085312213300005330Switchgrass RhizosphereGRLPDAVEPGYHGVRTRWIRGFMTFHLARRTQTVRLTVPV*
Ga0070670_10072991333300005331Switchgrass RhizosphereMKPDIHGVGTHWIRGFMAFRLARRTRTVMLMVPVCPESVF*
Ga0066388_10040492333300005332Tropical Forest SoilIMKIGPLPDAVKPGFHCVRTHWIGGFTAFRLARRSRTVVLVMSA*
Ga0068869_10015389613300005334Miscanthus RhizosphereIGLLPDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT*
Ga0070666_1044172533300005335Switchgrass RhizosphereIMTIGPLPDAMDPGFHGARTHWIRGFMTFRLVRRTRAVR*
Ga0070682_10063586923300005337Corn RhizosphereMKIGPLPDVMDSGFHGVRTPWIRGFMAFRLARRTQTAMLMVPA*
Ga0070682_10068803613300005337Corn RhizosphereLIMAIGLRSDALKRDIHCVRTHWIRGFMTFELARRTRIVLLMVPM*
Ga0068868_10027791933300005338Miscanthus RhizosphereVDHEDRPAAGRLPDALEPGIHGVGTRWIRGFMAFQLARYTRTALLTVPE*
Ga0068868_10028329513300005338Miscanthus RhizosphereIGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA*
Ga0070660_10103378113300005339Corn RhizosphereRRWPRPDALKPDIHGVRTHWIPGFMAFQLARRSRSVVLTVLAVA*
Ga0070661_10063973413300005344Corn RhizosphereRPPDALDPGFHGVRTPWIRGFMAFQAGRRTRTVMLVVPT*
Ga0070671_10083222613300005355Switchgrass RhizosphereANVDHEDRPAAGRLPDALEPGIHGVGTRWIRGFMAFQLARYTRTALLTVPE*
Ga0070671_10155647813300005355Switchgrass RhizosphereMAIGLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVP
Ga0070674_10055070013300005356Miscanthus RhizosphereMPAARLKPDIHCVRTHWIRGFIAFQLARRTQNVLLMVPVA*
Ga0070673_10034064423300005364Switchgrass RhizosphereSAAGRLPDAVEPGFHGVGTRWIRGFMTFQLTRRTQTVGLTVPV*
Ga0070673_10102104613300005364Switchgrass RhizosphereLQLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA*
Ga0070659_10013282213300005366Corn RhizosphereMKPGFHCVRTHWIRGFMAFQLVRRARTVMLMVSMCPESGF
Ga0070659_10141419923300005366Corn RhizosphereVLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT*
Ga0070667_10042640013300005367Switchgrass RhizosphereVDHEDRPAAGRLPDALEPGIHGVGTHWIRGFMAFQLARYTRTVLLTVPE*
Ga0070709_1135752413300005434Corn, Switchgrass And Miscanthus RhizosphereNALDPGFHCVRTHWIRGFMAFDLARRIRTVMLMVPVCPESGL*
Ga0070709_1148145213300005434Corn, Switchgrass And Miscanthus RhizospherePRPDALKPGFHGVRTHWIRGFMAFELARRTWIALLMVPV*
Ga0070714_10103994213300005435Agricultural SoilMKIGPLPDVMDSGFHGVRTHWIRGFMAFRLARRTRTAMLMVPV*
Ga0070714_10119599023300005435Agricultural SoilMAIGLPGRTNALKPCIHGVRAHWIRGFMAFQMTRRTRTVVLMVPM*
Ga0070714_10161904613300005435Agricultural SoilMAIGLRPDALKPYIHCVRAPRGFMAFQMARRTRTVVLMVPM*
Ga0070713_10173754113300005436Corn, Switchgrass And Miscanthus RhizosphereMAIGLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVPM*
Ga0070710_1010993523300005437Corn, Switchgrass And Miscanthus RhizosphereMKIGPLPDALDPGFHGVNAVNPGFMAFQMRWRTRIVRRMVLE*
Ga0070681_1017969213300005458Corn RhizosphereVLKPGIHGVRTRWIRGFMAFRLVRRTRIVMLMVPACPESG
Ga0070681_1019080533300005458Corn RhizosphereMAIGLRPDALKPYIHCVRAPRGFMAFQMARRTRTVVLMVPM
Ga0073909_1005119633300005526Surface SoilMKPGIHCVRTRWIRGFMAFELARSRQTVMLMVPV*
Ga0070679_10038960313300005530Corn RhizosphereRPPDALDPGFHGVRTPWIRGFTASKLARRTRTVMLVVPT*
Ga0070684_10177238213300005535Corn RhizosphereGRLPDAVEPGFHGVRTRWIRGFMTFHLARRTQTVRLTVPV*
Ga0068853_10003070113300005539Corn RhizosphereMAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTGLLMVPV*
Ga0070672_10024291613300005543Miscanthus RhizospherePDAMKPGFHGVGTHWIRGFMAFRLVRRTRTKTPMVPV*
Ga0070672_10129700713300005543Miscanthus RhizospherePDALEPGIHGVGTRWIRGFMAFQLARYTRTVLLTVPE*
Ga0070695_10031063733300005545Corn, Switchgrass And Miscanthus RhizosphereSAACRTHQPAAGRTPDALNPDIDGVLTHWIRGFMPFQLARYTRSVMPMVPV*
Ga0070695_10169058513300005545Corn, Switchgrass And Miscanthus RhizosphereMATGLRSEALKRDIHCVRTHWIRGFMTFELARRTRIVLLMVPM*
Ga0070665_10034701113300005548Switchgrass RhizosphereLPDAVEPGFHGVGTRWIRGFMTFQLTRRTQTVGLTVPV*
Ga0070665_10038625823300005548Switchgrass RhizosphereMEPDIHGVRTHWIRGFMAFWLARRTRIVRLVVSA*
Ga0070665_10133254123300005548Switchgrass RhizosphereMKPGFHGVGTHWIRGFMAFWLARRTRTKMPMVPV*
Ga0066695_1064542423300005553SoilPDGLDPAFHCVSLVRTRWIRGFIAFRLAQRTRTVMLMVPV*
Ga0068855_10028154923300005563Corn RhizosphereMDSGFHGVRTDWIRSFMPFHLVRHARTVMLMVPA*
Ga0068855_10073153313300005563Corn RhizosphereMKPGFHCVRTHWIRGFMAFQRARRTRIVLLAVPV*
Ga0068855_10137801113300005563Corn RhizosphereRWPRPDALKPDIHGVRTHWIPGFMAFQLARRGRSVVLTVLVWA*
Ga0068855_10161291523300005563Corn RhizosphereLIMAIGLRSDALKPDIHCVRTHWIRGVMTFELARRTRIVLLMVPM*
Ga0068855_10212186313300005563Corn RhizosphereLIVTIGPLPDAMEPGFHGLRTPWIRGFMPFQLAPRARIVMLMV*
Ga0070664_10005908653300005564Corn RhizosphereVKPGVQCVKTHWIRGFIAFRLARHTRTVMLMVPV*
Ga0070664_10010995113300005564Corn RhizosphereGRLPDAVEPGFHGVGTRWIRGFMTFQLTRRTQTVGLTVPV*
Ga0070664_10014989233300005564Corn RhizospherePDVLKPDIQCVRTHWIRGFMAFRVARRTRIVVLIGSV*
Ga0066693_1008450223300005566SoilMTIGLPPDALDPVFHGLRTRWNRDFMAFQLARRTRTVMLMTAV*
Ga0068856_10111182923300005614Corn RhizosphereMEPGIHGVRTQWIRGFMAFRLVRRIRTVMLMVLV*
Ga0068856_10172467423300005614Corn RhizosphereLIVTIGPLPDAMEPGFHGVRTPWIRRFMPFQLAPRARIVMLMV*
Ga0068856_10217772213300005614Corn RhizosphereVPNALDSGIHGARTHWIRGFMPFRLARRTQIVRLMVLA*
Ga0068859_10046586123300005617Switchgrass RhizosphereMKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTRAVMLMVSVS*
Ga0068864_10268690313300005618Switchgrass RhizospherePDALDPGFHCVRTPWIRGFMAFRLARRTRIVLLMVPM*
Ga0068866_1005373933300005718Miscanthus RhizosphereMEPGFHCVRTHWIRGFMAFQLARRVRVVVLEIREWLL
Ga0068866_1018523513300005718Miscanthus RhizosphereVDAVKSGFHCLIAHWIRGFMTFQLAWRTRIVLLMVSV*
Ga0068861_10023012713300005719Switchgrass RhizosphereALNPGFHGVRTPWIQGFMAFQLVRCARIVRLMVPA*
Ga0068851_1006100833300005834Corn RhizosphereMAIGLRSDALKRDIHCVRTHWIRGVMTFELARRTRIVLLMVPM*
Ga0068870_1037861223300005840Miscanthus RhizosphereMDPGFHGVRTHWIRGFMAFRSDRRARMVMLTVPV*
Ga0068863_10267677723300005841Switchgrass RhizosphereLKPDIQCVRTHWIRGFMAFQLARRTRIVVLMGSV*
Ga0068858_10038904913300005842Switchgrass RhizosphereLKPDIQCVRTHWIRGFMAFQLARHTRIVMLMGSA*
Ga0068858_10223695613300005842Switchgrass RhizosphereLIMMIGPLPDAMKPGFHCVRTHWIRGFIAFRLVRRTSTVVLMVPA*
Ga0068858_10236136623300005842Switchgrass RhizosphereMKPGFHCVRTHWIRGFTTFQLARRTWTVILTVLV*
Ga0070717_1024418813300006028Corn, Switchgrass And Miscanthus RhizosphereMKPRIHGVGTHWIPGFMAFQSTRRTRIAMLMVPV*
Ga0070717_1151468133300006028Corn, Switchgrass And Miscanthus RhizosphereMEPGIHCVRTHWIRGFMAFQLGPGRRIVRLMVLV*
Ga0070715_1003094723300006163Corn, Switchgrass And Miscanthus RhizosphereMDPGFHGVRTPWIRGFMAFRLARRTRTAMLMVPA*
Ga0070716_10013439133300006173Corn, Switchgrass And Miscanthus RhizosphereMKPGFHGVGTHWIRGFMAFRLVRRTRTKTPMVPV*
Ga0070716_10169256723300006173Corn, Switchgrass And Miscanthus RhizosphereMLIMTIDLLLDALELGFHCARTHWIRGFMAFLLARRTRTAMLMVSV*
Ga0070712_10129670913300006175Corn, Switchgrass And Miscanthus RhizosphereAGRLPDGVKPGFHGARTHWIRGFMAFRPARSTRVVMLVVPV*
Ga0070712_10141229323300006175Corn, Switchgrass And Miscanthus RhizosphereALKPDIHCVRAHWIRGFMAFQMARRTRTVLLMVPM*
Ga0097621_10025664813300006237Miscanthus RhizosphereDALKPDIHGVRTPWIRGFMAFQLARRRRSVVLTVLAVA*
Ga0068871_10229469713300006358Miscanthus RhizosphereDVLKPDIQCVRTHWIRGFMAFRVARRTRIVVLIGSV*
Ga0079222_1003358923300006755Agricultural SoilMEPGFHGARTPWIRGFMAFQLARRARIVMLMVPT*
Ga0079222_1025912523300006755Agricultural SoilVESGIHGVRTPWIRGFMTFQMARRTQTVLLVVPV*
Ga0079222_1070190013300006755Agricultural SoilRPPDVLKPGIHGVRTHWIRGFMAFRLVRRTRAVRLTVPP*
Ga0079221_1009591123300006804Agricultural SoilMEPGFHGARTPWIRGFMAFHLARRARIVMLMVPT*
Ga0079221_1047882323300006804Agricultural SoilLPDALDPRFHRVRTPWIRGFMAFRLARRIRIVMLMIPV*
Ga0079221_1137562313300006804Agricultural SoilMKPDIHGVRAHWIRGFMAFQLARRTRPAVLMVSAWLTRIL
Ga0079220_1008134233300006806Agricultural SoilMKPGIHCARTHWIRGFIAFRLVRRIRIVMLTMLA*
Ga0079220_1016615833300006806Agricultural SoilMLNMTIGLLPDAMKPGIHCVTTHWIRGFMAFQLAKCTRTVVLTVPV*
Ga0079220_1104679023300006806Agricultural SoilMAIGLWPDALKLDIHCVRAHWIRGFSAFQLARRTRIVLLMVPV*
Ga0075425_10057162823300006854Populus RhizosphereMEPDIHGVRTHWILGFMAFLAARRTGIVRLMVSA*
Ga0075434_10091183213300006871Populus RhizosphereLKPDIQCVRTHWIRGFMAFQLARTTRIVVLMGSA*
Ga0075434_10162963223300006871Populus RhizosphereLIMTIRLLPDALEPGFHCVRTRWIRGFMTFQRAPRTRITMLMVPV*
Ga0075434_10201460013300006871Populus RhizospherePLSDALDPGLHCVRTHWTRGFMTFRPARRTRIVLLMVPV*
Ga0068865_10018568413300006881Miscanthus RhizosphereMAIGLRSDALKRDIHCVRTHWIRGFMTFELARRTRIVLLMVPM*
Ga0068865_10045180613300006881Miscanthus RhizosphereIGPLPDAMDPGIHGVRTPWIRGSMTFQLARRTRIVRLTVPA*
Ga0068865_10046574033300006881Miscanthus RhizosphereLKPDIQCARTHWIRGFIAFQLARRTRTVLLMVPM*
Ga0068865_10213321813300006881Miscanthus RhizosphereLPDAVEPGFHGVRTRWIRGFMTFHLARRTQTVRLTVPV*
Ga0075426_1041070923300006903Populus RhizosphereMEPGIHGVRTQWIRGFMAFRLVRRIRTVMLMVLM*
Ga0075424_10166255113300006904Populus RhizosphereMMTGPLPDAMKPGTHCVLTHWIRGFIAFQLTRRTRTVLLAVLV*
Ga0075436_10136646513300006914Populus RhizosphereMPDAVDSGFHCARTQWIRAFMLFRLVRRIRTVMLMV
Ga0079219_1017041313300006954Agricultural SoilVLIMTIGLLPDVLKPGIHCARTHWIRGFTTFQLARRTRTVMLMVPV*
Ga0079219_1199654113300006954Agricultural SoilPNALDPGFHWVRAHWIRGFMAFQLARHTRIVILAVPV*
Ga0079219_1202978523300006954Agricultural SoilLPHTSGVAPDALDRGFHCAGTHWIRGFMAFPMVRPIRTVMLTVPV*
Ga0105244_1014236613300009036Miscanthus RhizosphereDAVDQGFHCARTQWIRGFMLFRLVRRIRTMMLMVPV*
Ga0105244_1051404313300009036Miscanthus RhizosphereMDPGFHGVRTPWIRGFMAFRLARRTRTAMLMVPVEPESVSEIVPPAR
Ga0105250_1014105613300009092Switchgrass RhizosphereMKPGFHCVRTHWIRGFIAFRLVRRTSTVVLMVPA*
Ga0105240_1045961223300009093Corn RhizosphereMEPGFHCVRAHWIRGFIAFQLARRTRTVMLMVLA*
Ga0105240_1192369913300009093Corn RhizosphereMDPGFHSARTRWARGFMTFQLARRTRIVMLMVPA*
Ga0105245_1010266823300009098Miscanthus RhizosphereVNAALGPLPNALDPGFQCVRTHWIRGFMAFRLARRTRTVMLTVPE*
Ga0105245_1091239313300009098Miscanthus RhizosphereMDPGFHGVRTPWIRGFMAFRLARRTQTAMLMVPT*
Ga0105245_1102929423300009098Miscanthus RhizosphereMPDVMKPDIHCVRTHWIRGFMAFQMARRTPVVMLMVPV*
Ga0105245_1106666913300009098Miscanthus RhizosphereMPRGLLPDALKPGFQCARTQWIRGFMAFQLARRTRTVMLMVPM*
Ga0105245_1111734413300009098Miscanthus RhizosphereGPPDALEPGFHCVRAHWIRGFMAFELARRTRTVRLMMSA*
Ga0105245_1179040613300009098Miscanthus RhizosphereLPDVMKPGFHCVRTQWIRGFIAFQLARRIRIVMLMMPV*
Ga0105245_1214649123300009098Miscanthus RhizosphereMKPGIHCARTHWIRGFMAFQLARRTRILMLMVPV*
Ga0105247_1004504713300009101Switchgrass RhizosphereMKPGIRGVRTRWIRGFMAFQLARRTRAVRLMVAEWLVLLAGLLR
Ga0105247_1038063533300009101Switchgrass RhizospherePNALDSGIHGARTHWIRGFMPFRLARRTQIVRLMVLA*
Ga0105247_1079953013300009101Switchgrass RhizosphereLIVTIGPLPDAMEPGFHGVRTPWIRGFMPFQLAPRARIVMLMV*
Ga0105243_1015404513300009148Miscanthus RhizosphereKLGFHCVRAHWIRGFMAFHLVRRTRIVMLMMPVCP*
Ga0105243_1018254413300009148Miscanthus RhizosphereGRLPDVMPDVMKPDIHCVRTRWIRGFMAFQMARRTPVVMLVVLM*
Ga0105243_1020269813300009148Miscanthus RhizosphereLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT*
Ga0105243_1064359823300009148Miscanthus RhizosphereLKPRIHGLRTPWIRGFMTFQLVRRTRIAMLMVPV*
Ga0105243_1236136123300009148Miscanthus RhizosphereMAIGLRSDALKPDIHCVRTHWIRGVMTFELARRTRIVLLMVPM*
Ga0075423_1064582513300009162Populus RhizosphereMDPGIHGVRTPWIQGFMTFQLARRVRVVILEIREWLLG
Ga0075423_1127435823300009162Populus RhizosphereRLPDALEPGIHGAGTHWIRGFMAFQLARYTRTVLLTVPE*
Ga0105241_1080642913300009174Corn RhizosphereLPDAVKPGIQCVRTPWIRGFMTFLRARHARIVMLMVPAWSGGV*
Ga0105242_1003404223300009176Miscanthus RhizosphereMKPGFHGVRTHWIRGFMAFQLARRTPVAMLMVPV*
Ga0105248_1037672813300009177Switchgrass RhizosphereMAIGLRPDALKPDIHCVRTHWIRGLMRFELARRTRIVLLMVPM*
Ga0105248_1266695813300009177Switchgrass RhizosphereDAVKLGFHCARTHWIRGFMAFQLAQRTRTVRLTVPM*
Ga0105237_1049410213300009545Corn RhizosphereVLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQPPRRTRAVMLMV
Ga0105237_1068474413300009545Corn RhizosphereRTAMEPGIHCVRAHWIPGFMTFRRVRHARTVMLMVPA*
Ga0105237_1119827723300009545Corn RhizosphereMKPGFHCVRTYWIRGFMAFQRARRTRIVLLAVPV*
Ga0105237_1151675623300009545Corn RhizosphereMEPGIHCVTAHWNRGFIAFQLARRTRIVMLMVPM*
Ga0105237_1158399913300009545Corn RhizosphereMPAGRLPDALKPDIQCARTHWIRGFIAFQLARSTRTVLLMVPM*
Ga0105238_1051335913300009551Corn RhizosphereMEPAFHCARTHWIRGFMAFLLARRTLTAMLMVSV*
Ga0105238_1117096323300009551Corn RhizosphereMKPGFHGVGTHWIRGFMAFRLARRTRTKMPMVPV*
Ga0105238_1168153433300009551Corn RhizosphereMDPGFHGVGTHWIRGFMAFRSDRRARMVMLTVPV*
Ga0105249_1013239123300009553Switchgrass RhizosphereMKPGFRGVGTHWIRGFMAFWLARRTRTKMPMVPV*
Ga0105249_1014507643300009553Switchgrass RhizosphereMEPGFHCVGTHWIQGFFTFRLVMRTRIVMLMVPV*
Ga0105249_1124811313300009553Switchgrass RhizospherePDAMEPDIHGVRTHWIRGFMAFWLARRTRIVRLVVSA*
Ga0105249_1177142013300009553Switchgrass RhizosphereLRPQPDALDPGFHGARTHWIRGFMTFKLARRTRIVMLMVPA*
Ga0105249_1348022313300009553Switchgrass RhizosphereLIMAIGLRSDALKPDIQCARTHWIRGFIAFQLARSTRTVLLMVPM*
Ga0126374_1014844913300009792Tropical Forest SoilMKPGIHYARTQCIPGFMTFLLARRVRIVMLMVPV*
Ga0126374_1036750913300009792Tropical Forest SoilASNARPNALDPGFHYVRAHWIRGFMPFQLARRTPIARLTVLA*
Ga0126374_1133087613300009792Tropical Forest SoilVKPDIHRVSTHWIRDFITIHLAPRTRNVMLMVPA*
Ga0126380_1006339333300010043Tropical Forest SoilMHWNRVFIAFGPLPDAVKPGFHCARTHWIRGFIAFQLARGTRIVRLMVPV*
Ga0126384_1112555113300010046Tropical Forest SoilMSVMTIDLLTAAVKPGFHCVGTHWIRGFMAFQPARRTRIVVLMVSVRP*
Ga0126384_1158408113300010046Tropical Forest SoilMLIMKMGPPPNAMKPGFHCVRAHWIRGFITFQLARRTRTVLLVVPA*
Ga0126384_1216391613300010046Tropical Forest SoilMKPGFHCVRTHWIWGFIAFQLARRTRIVMLTILA*
Ga0126382_1101861023300010047Tropical Forest SoilNALNPGFHCARTHWIRDFTAFRLARRTRTMLLMVPV*
Ga0134080_1055002213300010333Grasslands SoilLPDAMKPGFHCVRTHWIRGFMTFQLVRRTRSVMLMVPE*
Ga0126370_1008875323300010358Tropical Forest SoilMDSGFHCVRTHWIRGFITIHLAPRTRNVMLMVPA*
Ga0126376_1111213313300010359Tropical Forest SoilMKPGIHYARTQCIPGFMTFLLARRARIVMLMVPV*
Ga0126372_1060549023300010360Tropical Forest SoilMPDAMKPDIHCVRTHWIRGFITIHLAPRTRNVMLMVSA*
Ga0126377_1288913013300010362Tropical Forest SoilMKPDFQCVRTHWNRDFMTFQVVQRTRITVLMVPT*
Ga0134125_1040060213300010371Terrestrial SoilMKPGFHCVRTNWIRGFIVFRRVRHIGTVMLVVVP*
Ga0134125_1051057423300010371Terrestrial SoilMKPGIHCARTHWIRGFIAFQLARRTRTAMLMVPV*
Ga0134125_1129598813300010371Terrestrial SoilPRTVPNALDSGIHGARTHWIRGFMPFRLARRTQIVRLMVLA*
Ga0134125_1129697923300010371Terrestrial SoilGVVKPGFHGVRTHWIRGSMTFQLVRRTQIALLMVPV*
Ga0134125_1156689223300010371Terrestrial SoilMDPGIHGVRTPWIRGFKTFQLARRTRIVRLMVPV*
Ga0134125_1255907313300010371Terrestrial SoilMKPGFHCVRTHWIRGFIAFRLVRRTSIVVLMVPT*
Ga0134128_1036995023300010373Terrestrial SoilMDSGFHGVRTDWIRGFMPFHLVRHARTVMLMVPA*
Ga0134128_1052200913300010373Terrestrial SoilMKPGIHCARTHWIRGFIAFQRARRIRIVMLMVPV*
Ga0134128_1280981923300010373Terrestrial SoilDALDPGFHGVRTPWIRGFMAFQLARRTRIVRLMVPV*
Ga0105239_1098558823300010375Corn RhizosphereMKPGIHCVRTHWIRGFMAFLLARRTLTAMLMVSV*
Ga0105239_1118449113300010375Corn RhizosphereLLPDAMEPAFHCARTHWIRGFMAFLLARRTRTAMLMVPV*
Ga0105239_1208345413300010375Corn RhizosphereNAMKLGFHGVRTPWIRGFMAFRLARSTRTAMLMVPV*
Ga0134126_1216681313300010396Terrestrial SoilVLKPGIHGVRTRWIRGFMAFRLVRRTRIVMLMVPA
Ga0134124_1025051013300010397Terrestrial SoilMKIGPLPEALDPGFHCVRAHWIRGFMAFRLVRRTRIVTLMVPV*
Ga0134127_1002252253300010399Terrestrial SoilMKIGPLPDVMDSWFHGVRTHWIRGFMAFRLARRTRTAMLMVPA*
Ga0134122_1009123013300010400Terrestrial SoilMKPEIQCARTHWIRGFMPFRLVRRTLTVMPMVPT*
Ga0134122_1019990633300010400Terrestrial SoilMEPGIHCVTAHWNRGFIAFQLARRTRIVMLMIPV*
Ga0134122_1034406813300010400Terrestrial SoilVDHEDRPSAGRLPDALEPGIHGVGTQWIRGFMAFQLARYTRTVLLTVPE*
Ga0134121_1006850533300010401Terrestrial SoilMDSGSHGVRTDWIRGFMPFHLVRHARTVMLMVPA*
Ga0134121_1029208023300010401Terrestrial SoilLIMKIGPLPDVMDSGFHGVRTHWIRGFMAFRLARRTRTAMLMVPV*
Ga0134121_1322896613300010401Terrestrial SoilAVDPGFHGVGTHWIWGFMAFQLACHARSMMLMVPM*
Ga0134123_1013247313300010403Terrestrial SoilLPDALDPGFHGVRTPWIRGFMAFQLARRTRTVMLMAPVCP*
Ga0134123_1041414423300010403Terrestrial SoilMKIGLLPDAMKPGIHRVGTHWIRGFMTFQPVRRIPTVRLMVPE*
Ga0134123_1298487813300010403Terrestrial SoilMAIGLRSDALKPDIHCVRTHWIRGFMTFELARRTRIVLLMVPM*
Ga0105246_1002605133300011119Miscanthus RhizosphereMKPGIHCVRTPWIPGFMAFQMAARTRTVMLTVPV*
Ga0137380_1046166033300012206Vadose Zone SoilMELGFHCVRTHWIRGFTAFQLARRTRTVLLAVLA*
Ga0137376_1060322023300012208Vadose Zone SoilLPDVLEPDIHCVRTHWNRGFMTFQLARRTRIVMLMGPV*
Ga0137379_1000533883300012209Vadose Zone SoilMKIGHPPDALEPGFHCVRTQWNRGFMAFQLVRRTRIMMLMVPA*
Ga0137379_1013568353300012209Vadose Zone SoilMEPGFHCVRTHWIRGFMAFRLARRIGTVMLMVPA*
Ga0137387_1108557823300012349Vadose Zone SoilMKIGPLPDALEPGVHCVKTCWIRGFMAFRLARRTRSVMLTVP
Ga0137386_1058400813300012351Vadose Zone SoilGRLPDVMKPGIHCVRTHWIRGFMAFHRIRRTRAVMLMVPV*
Ga0157340_100335013300012473Arabidopsis RhizosphereMEPGIHGARTHWIRGFMAFQLARYTRTVLLTVPE*
Ga0157345_101085823300012498Arabidopsis RhizosphereMKPDFQCVRTHWNRGFMTFQLARQTRTVMLMVSK*
Ga0164300_1006366413300012951SoilPAAGRLPDALEPGIHGVGTRWIRGFMAFQLARRTRTKMPMVRV*
Ga0164298_1005500633300012955SoilAGRLPDALEPGIHGVGTRWIRGFMAFQLARYTRTVLLTVPE*
Ga0164298_1066440823300012955SoilQPDVLEPEFHGARTHWIRGFTAFRLDRRARVVMLTVPV*
Ga0164303_1005841033300012957SoilMDPGIYGVRTPWIRGFMTFQLGRRTRIVRLTVPA*
Ga0164303_1009070823300012957SoilMKPEFHGVGTHWIRGFMAFRLARRTRTKMPMVPMVPV*
Ga0164303_1109679913300012957SoilPDAVKPEFHGVGTHWIRGFMAFRLARRIRTVMLMVPT*
Ga0164301_1002144223300012960SoilMKPEFHGVGTHWIRGFMAFHLARRTRTKMPMVPMVPV*
Ga0164302_1000373623300012961SoilMDPGIHGVRTPWIRGFMTFQLGRRTRIVRLTVPA*
Ga0164309_1091551823300012984SoilNAMKPYIHGVRAHWIRGFMAFQMARRTRTVVLMVPM*
Ga0164309_1108926423300012984SoilVDAVKPGFHGVRAHWIRGFMAFQRARSTRTMLLMVPV*
Ga0164308_1047737733300012985SoilMKPDIHGVRTRWIRGFMAFQLARRTRPAVLMVPAWLTRIL
Ga0164308_1060891413300012985SoilMDPGIHGVRTPWIRGFMTFQLGRRTRIVGLTVPA*
Ga0164308_1205165623300012985SoilACRTHRPAAGRIGPLPDAMDPGIHGVRKPWIRGFMTFQLGRRTRIVRLTVPA*
Ga0164304_1134960423300012986SoilGPLPDAMDPGIHGVRTPWIRGFMTFQLGRRTRIVGLTVPA*
Ga0164304_1141633213300012986SoilDAMDPGIHGARTHWIRGFMAFQLARRTWAVMLMVPT*
Ga0164307_1155025413300012987SoilLPDAVEPGFHGVRTRWIRGFMAFRLAQRIRTVRLTVPM*
Ga0164306_1004026913300012988SoilLPDALDPRFHRVRTPWIRGFMAFRLARRIRIVMLMVLRVT*
Ga0164306_1127185523300012988SoilPDALDPGFHCVRTPWIRGFMAFRSARRTRIVLLMVPM*
Ga0164305_1006675943300012989SoilMKPYIHGVRAHWIRGFMAFQMTRRTRTVVLMVPM*
Ga0157373_1017940043300013100Corn RhizosphereIGLRPDALKPYIHCVRAPRGFMAFQMARRTRTVVLMVPM*
Ga0157373_1020412623300013100Corn RhizosphereMDSGFHGVRTPWIQGFMAFRLARRTRTAMLIVPV*
Ga0157373_1024880523300013100Corn RhizosphereMEPGIHGVRTQWFRGFMAFRLVRRIRTVMLMVLV*
Ga0157371_1050831323300013102Corn RhizosphereMKPGIHRVGTHWIRRFMAFKLARRIRDVRLMVPA*
Ga0157370_1148592613300013104Corn RhizosphereMELGFHCVQAHWIRGFMAFRLVRRTRTVMLMMSVGP
Ga0157370_1196856623300013104Corn RhizosphereRRPVPDALDPGFHCGRTPWIRGFMAFRLARRTRIVLLMVPM*
Ga0157369_1088810323300013105Corn RhizosphereMKPDIHCVRTHWIRGFIAFHSAQRTWAMMLMVPM*
Ga0157369_1142327023300013105Corn RhizosphereRPVPLPHALKPGFHCARTHWIRGFMAFELARPTRIVLLMVPV*
Ga0157369_1162608213300013105Corn RhizosphereMMIGPLPDAMKPGFHCVRTHWIRGFIAFRLVRRTSTVVLMVPA*
Ga0157369_1169669813300013105Corn RhizosphereMLLMTIDLLPDAMKPGFQCVRAHWIRGFMGFQLVRRRRSV
Ga0157374_1060128813300013296Miscanthus RhizosphereNLSRLPDAMEPRFHCVRTQWIRGFMAFQLARRAQYVMLMMPV*
Ga0157374_1104207423300013296Miscanthus RhizosphereMPDAMKSDIHGVRTHWIRGFMAFQLARCIRTVVLTVPV*
Ga0157374_1121069823300013296Miscanthus RhizosphereMPRGLLPDALKPGFQYARTQWIRGFMAFQLARRTRTVMLMVPM*
Ga0157374_1165891523300013296Miscanthus RhizosphereMAIGLRPDALKPDIHCVRTHWIRGFMAFQMARRTRTGLLMV
Ga0157374_1294830523300013296Miscanthus RhizosphereLIMAIGLRSDALKPDIHCVRTHWIRGVMTFELARGSRIVRLMGPI*
Ga0157378_1072604023300013297Miscanthus RhizosphereMYPGFHGVRTHWIRGFMAFRSDRRARMVMLTVPV*
Ga0163162_1050289723300013306Switchgrass RhizosphereMKPGFHGVGTHWIRGFMAFRLVRRTRTKMPMVPV*
Ga0163162_1248772013300013306Switchgrass RhizosphereMIMTIGPLPDAMKPGIHCVRTQWIWGFMAFQLVRCTRTVRLMVLM
Ga0157372_1133240813300013307Corn RhizosphereSAWCLTAMEPGIHCVRAHWIPGFMTFHPVRHARTVMLMVPT*
Ga0157372_1153700323300013307Corn RhizosphereMNSAYHCVRTHWIRGFMAFQLARHARTVMLMVLAWE*
Ga0157372_1155668623300013307Corn RhizosphereGALEPRIHGVRTHWIRGFMAFQLGRRTRNVVLMVSA*
Ga0157372_1160745923300013307Corn RhizosphereMKPGFHCVRTNWIRGFIVFGRVRHIGTVMLVVVP*
Ga0157372_1200042223300013307Corn RhizosphereDAVKPGIQCVRTPWIRGFMTFLRARHARIVMLMVPAWSGGV*
Ga0157372_1338297213300013307Corn RhizosphereLKPDIQCARTHWIRGFIAFQLARSTRTVLLMVPM*
Ga0157375_1043648323300013308Miscanthus RhizosphereMKPGFHVVGTHWIRGFMAFRLVRRTRTKTPMVPV*
Ga0157375_1233688223300013308Miscanthus RhizosphereMEPGIHGVTTHWIRGFMAFRLVRRTRIVMLMVPACPE
Ga0157375_1271933623300013308Miscanthus RhizosphereDAMKPGIHCARTHWIRGFMAFQLARRTRILMLMVPV*
Ga0157375_1376991523300013308Miscanthus RhizosphereMKIGPLPDVMDSGFHGVRTHWIRGFMAFRLARRTRTAMLIVPV*
Ga0157380_1163696813300014326Switchgrass RhizosphereMKPDIRGVRTRWIRGFMAFQLARYTRTALLTVPE*
Ga0157377_1008645133300014745Miscanthus RhizosphereMKPGIHGDRTYWIWGFMAFWLALRTRTAMLMVPE*
Ga0157377_1070298713300014745Miscanthus RhizosphereMKIGLLPDAMKPGIHGVGTHWIRGFMAFQPPRRTRAVMLMVPM
Ga0157379_1037041933300014968Switchgrass RhizospherePHALKPGFHCARTHWIRGFMAFELALRTRIVMLMVPV*
Ga0157379_1077999023300014968Switchgrass RhizosphereSVCCWTLPDAVEPGFHGVGTRWIRGFMTFQLARRTQTVRLTVPV*
Ga0157376_1056736033300014969Miscanthus RhizosphereMEPGFHCVGTHWILGFMAFQLVRHVRTVMLMVPACPESGSLR
Ga0137412_1051975923300015242Vadose Zone SoilMDPGFHCVRAHWIWGFMAFERARPTRIVRLMVLVGSESGFRD
Ga0132256_10037264533300015372Arabidopsis RhizosphereMKPGIHCVSTRWIRGFMAFQLVRYARIVMLTVLA*
Ga0163161_1012369413300017792Switchgrass RhizosphereALDPGFQCVRTHWIRGFMAFQLARRTRIVMLMVPV
Ga0163161_1100514423300017792Switchgrass RhizosphereMPDVMKPDIHCVRTRWIRGFMAFQMARRTPVVMLVVLM
Ga0163161_1129953713300017792Switchgrass RhizosphereMAIGLRSDALKPDIHCVRTHWIRGLMRFELARRTRIVLLMVPM
Ga0163161_1171675023300017792Switchgrass RhizosphereMPRGLLPDALKPGFQCARTQWIRGFMAFQLARRTRTVMLMVPM
Ga0066669_1104400423300018482Grasslands SoilALDSGFHRVRTHWIPGFMAFQLARSTRTVMLTVPV
Ga0193722_102887823300019877SoilDVMKPGFHCVRTHWIRGFMAFQMARRTPVLMLMVPV
Ga0193722_111454623300019877SoilDAMKPGFHCVRTHWIRGFIAFQLARCTRTVMLMMPA
Ga0193730_113546913300020002SoilGAMEPGVHCVRTHWIRGFMAFQLARRTRTAMLMVPV
Ga0193730_115104823300020002SoilLPDAMKPGFHCVRTHWIRGFMAFQLARRTRTVMLMVPE
Ga0197907_1140062023300020069Corn, Switchgrass And Miscanthus RhizospherePLPDAMEPGFHGVRTPWIRRFMPFQLAPRARIVMLMV
Ga0206356_1080800213300020070Corn, Switchgrass And Miscanthus RhizospherePDAMKPGIHGDRTHWIRGFMTFQQPGAPGTVMLMVPE
Ga0206353_1164108513300020082Corn, Switchgrass And Miscanthus RhizospherePGAMPDAVDQGFHCARTQWIRGFMLFRLVRRIRTMMLMVPV
Ga0210393_1086872213300021401SoilMKPGIHGVRAHWIRGFMAFRRGRRIRIVMLMGSMGPES
Ga0210397_1015568823300021403SoilMKIGPLPDAMKPRFHGVGTHWIQGFMAFQSTRRTRITMLMVPV
Ga0210389_1030486833300021404SoilMKIGPLPDAMKPRFHGVGTHWIQGFMAFQSTRRTRIAMLMVPV
Ga0210392_1023492813300021475SoilVVDGLDPGIHGARTRWIRGFMAFQLAWRIRIVMLMVPV
Ga0210392_1063189413300021475SoilPRTRPSPLPGDLKPDIHCVRTHWIRGFMPFQLTRRTRTVVPM
Ga0222622_1013670313300022756Groundwater SedimentGLRDPMKPDVHCVRTHWIRGFIAFHSAQRTWAVMLMVPM
Ga0247665_107313013300024219SoilAAGRLPDAMDPGFHGARTHWIRGFMTFRLVRRTRAVR
Ga0247664_109989823300024232SoilPTPAGRIGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA
Ga0247661_102643633300024254SoilGRLLDAMDPGFHGARTHWIRGFMTFRLVRRTRAVR
Ga0247661_107919413300024254SoilDCEARPRPYAMEPDIHGVRTHWIRGFMAFWLARRTRIVRLMVPA
Ga0247668_107090213300024331SoilCRIPGPDALKPYIHCVRAPRGFMAFQMARRTRTVVLMVPM
Ga0247668_109060013300024331SoilGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA
Ga0207653_1001890213300025885Corn, Switchgrass And Miscanthus RhizosphereALEPGFHCVGTHWIRGFMAFRLVRRTRAVMLVVPT
Ga0207653_1003931213300025885Corn, Switchgrass And Miscanthus RhizosphereMKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTRAVMLMVSMCPES
Ga0207653_1012398933300025885Corn, Switchgrass And Miscanthus RhizosphereVPLPHALKPGFHCARTHWIRGFMAFELARPTRIVLLMVPM
Ga0207710_1016696823300025900Switchgrass RhizosphereLIVTIGPLPDAMEPGFHGVRTPWIRRFMPFQLAPRARIVMLMV
Ga0207710_1024803413300025900Switchgrass RhizosphereQPNAMDSGSHGVRTDWIRGFMPFHLVRHARTVMLMVPA
Ga0207710_1048181723300025900Switchgrass RhizosphereMKIGLLPDAMKPGIHGVGTHWIRGFMAFQPPRRARAVMLMVPM
Ga0207680_1021386913300025903Switchgrass RhizosphereTGLPPNALDSGFHGVRTPWIRGFMAFQRARRTRTMRLTVPV
Ga0207685_1001440543300025905Corn, Switchgrass And Miscanthus RhizospherePDAMEPDIHGVRAHWIRGFMAFWLARRTRIVRLVVSA
Ga0207685_1012568723300025905Corn, Switchgrass And Miscanthus RhizosphereMAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTVLLMVPM
Ga0207685_1012686413300025905Corn, Switchgrass And Miscanthus RhizosphereGADRAAMKPGIHGDRTHWIRGFMAFWLARRTRTAMLMGSA
Ga0207699_1034265923300025906Corn, Switchgrass And Miscanthus RhizosphereVPNALDSGIHGARTHWIRGFMPFRLARRTQIVRLMVLA
Ga0207643_1023108613300025908Miscanthus RhizospherePLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA
Ga0207705_1024204613300025909Corn RhizosphereVLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMV
Ga0207654_1016837113300025911Corn RhizosphereMAIGLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVPM
Ga0207671_1101584823300025914Corn RhizosphereHALKPGFHGARTHWIRGFMAFELARRTWIVMLMVPV
Ga0207663_1126868623300025916Corn, Switchgrass And Miscanthus RhizosphereVNAALGPLPNALDPGFQCVRTHWIRGFMAFRLARRTRTVMLTVPE
Ga0207663_1147240413300025916Corn, Switchgrass And Miscanthus RhizosphereGGHEVPQWGFHGVRTPWIRGFMAFRLARRTRTAMLMVPA
Ga0207660_1015791513300025917Corn RhizosphereDAMDPGFHGVRTHWIRGFMAFRSDRRARMVMLTVPV
Ga0207660_1049819423300025917Corn RhizosphereYPGPGADRDAMKPGIHGDRTHWIRGFMAFWLARRTRTAMLMVPE
Ga0207662_1002145053300025918Switchgrass RhizosphereMKIGPLPDVMDSGFHGVRTPWIRGFMAFRLARRTRTAMLMGG
Ga0207652_1020029613300025921Corn RhizosphereSIAAGVGPDAVDPGFHGVGTHWIRGFMAFRLACHARSVMLMVPM
Ga0207652_1065074313300025921Corn RhizosphereTPPGRPPDAMKPGFHGVGTHWIRGFMAFRLARRTRTKMPMVPV
Ga0207694_1123862813300025924Corn RhizospherePDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA
Ga0207659_1162963613300025926Miscanthus RhizosphereLPDAPPDALDSGFHRVRTHWIRGFMAFRLVQRIRIVMLMVPV
Ga0207687_1096188213300025927Miscanthus RhizosphereLIMAIGLRSDALKPDIHCVRTHWIRGVMTFELARLTRIVLLMVPM
Ga0207700_1190371713300025928Corn, Switchgrass And Miscanthus RhizosphereIAAEAGPDAVDPGFHGVGTHWIWGFMAFQLACHARSMMLMVPM
Ga0207664_1117585323300025929Agricultural SoilRRFLRPDAVKPAFHGVRTRWIRGFMAFQRARSTRIMLLMVPV
Ga0207664_1134931423300025929Agricultural SoilPVPDALDPGFHCVRTPWIRGFMAFRLARRTRIVLLMVPM
Ga0207709_1079591713300025935Miscanthus RhizosphereLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT
Ga0207670_1064099613300025936Switchgrass RhizosphereMKIGLLPDAMKPGIHGVGTHWIRGFMAFQPPRRTRAVMLMV
Ga0207704_1041455623300025938Miscanthus RhizosphereMKPGIHCVRTHWIRGFMAFQLAERARAVMLMVPVCPEC
Ga0207704_1077548913300025938Miscanthus RhizosphereSRSRPGRLDIAMEPGIHGVRTQWIRGFMAFRLVRRIRTVMLMVLV
Ga0207691_1005684943300025940Miscanthus RhizosphereVSADVLDPGFHGARTRWNRGFMTFQLVRRTQIAMLMVPV
Ga0207691_1049621423300025940Miscanthus RhizosphereVLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAV
Ga0207711_1077725313300025941Switchgrass RhizosphereMKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTLVVMLMVPMCPESG
Ga0207689_1002073263300025942Miscanthus RhizosphereLIMAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTGLLMVPV
Ga0207689_1174910023300025942Miscanthus RhizosphereSDGLKPGIHCARTHWIRGFIAFRLARRTRIVMLMVPA
Ga0207661_1053458513300025944Corn RhizosphereVPQWGFHGARAPWIRGFMAFQLARRARIVRLMVPA
Ga0207679_1150681013300025945Corn RhizosphereAPPVLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT
Ga0207667_1108243923300025949Corn RhizosphereMAIGLRSDALKRDIHCVRTHWIRGFMTFELARRTRIVLLMVPM
Ga0207651_1139945423300025960Switchgrass RhizosphereRIGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA
Ga0207651_1179174313300025960Switchgrass RhizosphereAPACLPDALDPGFHGVRTPWIRGFMAFQPARRTRIVRLMVPV
Ga0207712_1032661423300025961Switchgrass RhizosphereMPAGRLPDALKPDIQCARTHWIRGFIAFQLARRTRTVLLMVPM
Ga0207668_1009939023300025972Switchgrass RhizosphereVNAALGPLPNALEPGFQCVRTHWIRGFMAFRLARRTRTVMLTVPE
Ga0207677_1177485513300026023Miscanthus RhizosphereVPTPAERRPDAVKPGFHCARTHWIPGFMAFRLARRTRLVMLMVPV
Ga0207703_1027070113300026035Switchgrass RhizosphereMPRGLLSYALKPGFQCARTQWIRGFMAFQLARRTRTVMLMVPM
Ga0207639_1011663333300026041Corn RhizosphereGAMPDAVDQGFHCARTQWIRGFMLFRLVRRIRTMMLMVPV
Ga0207639_1012929913300026041Corn RhizosphereMAIGLRPDALKPDIHCVRAHWIRGFMAFQMARRTRTGLLMVPV
Ga0207639_1173781613300026041Corn RhizosphereAGRIGPLPDAMDPGIHGVRTPWIRGSMTFQLARRTRIVRLTVPA
Ga0207708_1091906733300026075Corn, Switchgrass And Miscanthus RhizosphereGLPDAMKLGFHCVRAHWIRGFMAFHLVRRTRIVMLMMPVCP
Ga0207702_1107294833300026078Corn RhizosphereLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVPM
Ga0207674_1002771853300026116Corn RhizosphereMATGLRPDALKPDIHCVRAHWIRGFMAFQKARRTRTVLLMVPM
Ga0207674_1006538343300026116Corn RhizosphereVLKPYCIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLM
Ga0207675_10002101683300026118Switchgrass RhizosphereDALDPGFHCVRTRWIRGFMAFQLARRTRTAMLMVPV
Ga0207675_10220618823300026118Switchgrass RhizospherePDAMNSAYHCVRTHWIRGFMAFQLARHARTVMLMVLAWE
Ga0207683_1001501613300026121Miscanthus RhizosphereMPDAMKPDIHGVRTHWIRGFMAFQPARRTRTLVLTVPVWPESGF
Ga0207683_1023780013300026121Miscanthus RhizosphereSGALEPRIHGVRTHWIRGFMAFQLGRRTRNVVLMVPA
Ga0209110_101267323300027002Forest SoilASDPGIHGVRTPWIRGFRTFQLGRRTRIVRLTVPA
Ga0209325_100597923300027050Forest SoilARAPPDVLKPDIQCVRTHWIRGFMAFQLARRTRIVVLMGSV
Ga0208862_10357823300027100Forest SoilVLLPNAMKPGIHGARTHWIRGFMAFQLARYARTVLLTVP
Ga0209178_138808523300027725Agricultural SoilPLPDALDPGFHCVRTPWIRGFMAFQLARRTRIVLLMVPM
Ga0209073_1033758813300027765Agricultural SoilMAIGLWPDALKLDIHCVRAHWIRGFSAFQLARRTRIVLLMVPV
Ga0209177_1012751823300027775Agricultural SoilRPDAVDPGFHGVRAHWIQGFTAFQLTRHGPRVMLMTPV
Ga0247675_101333813300028072SoilGRIGPLPDAMDPGIHGVRTPWIRGFMTFQLARRTRIVRLTVPA
Ga0247675_101881113300028072SoilMKIGLLPDAMKPGIHGVGTHWIRGFMAFQPPRRARAV
Ga0247682_105436523300028146SoilVLKPYCIGLLPDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT
Ga0247682_105771913300028146SoilMKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTRAVMLMV
Ga0268266_1120189723300028379Switchgrass RhizosphereMNSAYHCVRTHWIRGFMAFQLARHARTVMLMVLAWE
Ga0268266_1140289413300028379Switchgrass RhizosphereEVPQWGFHGVRTPWIRGFMAFRLARRTRTAMLMVPA
Ga0268266_1193607923300028379Switchgrass RhizosphereALKPDIQCVRTHWIRGFMAFQLARHTRIVVLMGSA
Ga0268264_1240256923300028381Switchgrass RhizosphereHEARPRPDAMEPDIHGVRTHWIRGFMAFWLARRTRIVRLVVSA
Ga0307279_1008735213300028709SoilMRLGPLPDDLKPDIHCVTTHWNRGFMGFQLAQLTRTVMPMVPM
Ga0307317_1022001323300028720SoilDAMKPGFHCVRTHWIRGFIAFRLVRRTSTVVLMVPA
Ga0307280_1008512723300028768SoilMPLIMTIGPLPNALDPGFHCVRTHWIRGFMAFQLARHTRIVMLAVPV
Ga0307280_1030095613300028768SoilMKPGIHCTRTHWIRGFMTFQLVRHAPTVMLTVPACPE
Ga0307282_1012367523300028784SoilMGPGFHCVGTYWIRGFMAFQLARRARFVMLMMPVGPESDLR
Ga0307282_1014789523300028784SoilGYPRPGFHCVRTHWIRGFMAFQMARRTPVLMLMVPV
Ga0307282_1048622623300028784SoilSGYPGPGFHCVTTHWIRGFMAFQLARRTRTVMLMVSV
Ga0307323_1005745933300028787SoilCVGTYWIRGFMAFQLARRARLVMLMMPVGPESDLR
Ga0307290_1016714413300028791SoilMEPGFHFDRAHWIRGFMTFQRVRRTSTVMLMVPVGPVSNPLD
Ga0307290_1038340913300028791SoilVVDARPDALDPGFHCARTHWIRGFMTFQLVRRIRTVMLM
Ga0307299_1020499213300028793SoilVPLPHALKPGFHCARTHWIRGFMAFELARRTWIVMLMVPV
Ga0307299_1037498523300028793SoilRRSRLRQNALDPGFHCVRTHWIRGFMALQLARRTRTVLLMVPV
Ga0307284_1042915313300028799SoilTIGPPPNALDPGFHCVRTHWIRGFMAFQLARHTRIVMLAVPV
Ga0307305_1013696113300028807SoilATPVPGGLRDPMKPDIHRVRTHWIRGFRAFHSAQRTWEVMLMVPM
Ga0307296_1084268313300028819SoilDADALEPGFHCVRTHWIRGSMAFQLVRRTRTVMLMVSV
Ga0307312_1003236953300028828SoilVPQWGFHCVRTHWIRGSMAFRLARCTRIVLLVVPV
Ga0307312_1060022413300028828SoilPRSRIPDAMESGFHCVRMHWIRGFMAFRLARRTQT
Ga0307312_1112138423300028828SoilPGGVFSVWSLPDALKPGFQCVRTQWIRGFIAFQLARRIRTVVLMVPV
Ga0307308_1002867013300028884SoilMPLIMTIGPLPNALDPGFRCVTTHWIRGFMAFQLARHTRIVMLAVPV
Ga0308194_1032987423300031421SoilGIHCVRTHWIRGFMAFQLVRRIRIVMLMVPVCPEFGFL
Ga0307469_1145362813300031720Hardwood Forest SoilPGALDSGFHCARTHWIRGFMAFQLVRRTRIVRLMVSV
Ga0307469_1162161423300031720Hardwood Forest SoilLIMAIGLWPDALKPDIHCVRAHWIRGFMAFQTARRTRIVLLMVPV
Ga0307469_1243725113300031720Hardwood Forest SoilMAIGLRSDALKPEIHCVRTHWIRGFMTFELARRTRIVLLMVPM
Ga0307468_10051960333300031740Hardwood Forest SoilLLPDALKPDIHCVRAHWIRGFMAFQTARRTRIVLLMVPV
Ga0307473_1153621313300031820Hardwood Forest SoilGPAGSGPPDALEPGFHCVRAHWIRGFMAFELARRTRTVRLMMSA
Ga0308176_1122367113300031996SoilACRTPAGRLPDALEPGIQCVRTHWIRGFMAFRLARHTRNVMLMVPT
Ga0308173_1061701913300032074SoilMLIMKLGPAAGRLPDALKPGFHCARTHWIRGFIVFRPARLTRIVRLMV
Ga0307470_1095285923300032174Hardwood Forest SoilLPNAMKPGFHRVRTHWIRGFMAFQRARCTRIVLLAVPV
Ga0307470_1151824213300032174Hardwood Forest SoilPEPPPDALKPDFQCVRTHWIRGFMAFQLVWRTRIVMLMVLK
Ga0307471_10026527823300032180Hardwood Forest SoilPDAMEPDIHGVRTHWIRGFMAFWLARRTRIVRLVVSA
Ga0307471_10066635113300032180Hardwood Forest SoilLPDAMEPGFHCVRAHWIWGFIAFQLARRTRTVMLMVLA
Ga0307471_10182093913300032180Hardwood Forest SoilPAPGPGLHGALDPGFHCARTHWARGFMTFQLARRTRIVMLMVSV
Ga0307472_10017924243300032205Hardwood Forest SoilLIMAIGLRSDALKPDIHCVRTHWIRGLMRFELARRTRIVLLMVPM
Ga0307472_10046296913300032205Hardwood Forest SoilMKIGLLPDAMKPGIHGVGTHWIRGFMAFQLPRRTRAVMLMVS
Ga0307472_10242660713300032205Hardwood Forest SoilVPLPHALKPGFHCARTHWIRGFMAFELARPTRIVLLMVPV
Ga0335079_1002346883300032783SoilMVAGPVPDSVEPGFHCVRTRWIRGFIASRLARRTHGLMLMVPA
Ga0335075_1082155823300032896SoilVDPADAVDPDIHGVGTHWIRAFMAFWLARRTRIVRLMVSA
Ga0335072_1051749013300032898SoilPKPGPNALNPRIHCARAHWIRGFMTFRLARRTRTAVLMVPT
Ga0335084_1129326323300033004SoilPDAMEPGFHCVGTHRIRGFMAFQSDRRTRTVMLMMPT
Ga0310810_1132860213300033412SoilNALEPGVHCVRTHWIRGFMAFRRVRRTSTAMLMVPV
Ga0373948_0106278_541_6663300034817Rhizosphere SoilIGLLLDAMKPGIHCVGTHWIRGFMAFQLVQRIRAVRLMVPT
Ga0373950_0094102_3_1163300034818Rhizosphere SoilPDALKPRIHGLRTPWIRGFMTFQLVRRTQIAMLMVPV
Ga0373950_0111174_2_1363300034818Rhizosphere SoilRPAAGRLPDALEPGIHGVGTHWIRGFMAFQLARYTRTVLLTVPE
Ga0373958_0132229_1_1293300034819Rhizosphere SoilMPAGRLLDAMEPGFHCARTPWIRGFMALQLTRRGRTVRLIVPV
Ga0373959_0070960_3_1253300034820Rhizosphere SoilGRLPDAVEPGFHGVGTRWIRGFMTFQLTRRTQTVGLTVPV
Ga0373959_0141411_2_1123300034820Rhizosphere SoilMRHYALDSGFQCVRTHWIRGSTACQLARRLPAGMLMV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.