Metagenome Family F005944

Basic Information
Family ID	F005944
Family Type	Metagenome
Number of Sequences	385
Average Sequence Length	43 residues
Representative Sequence	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Number of Associated Samples	41
Number of Associated Scaffolds	385

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	6.38 %
% of genes near scaffold ends (potentially truncated)	22.34 %
% of genes from short scaffolds (< 2000 bps)	51.95 %
Associated GOLD sequencing projects	27
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Bacteria (59.481 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (52.987 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 29.41% β-sheet: 0.00% Coil/Unstructured: 70.59%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 385 Family Scaffolds
PF00137	ATP-synt_C	1.04
PF00078	RVT_1	0.52
PF00784	MyTH4	0.52
PF08170	POPLD	0.52
PF16653	Sacchrp_dh_C	0.52
PF12473	DUF3694	0.52
PF00051	Kringle	0.52
PF00241	Cofilin_ADF	0.52
PF00069	Pkinase	0.52
PF00617	RasGEF	0.52
PF07690	MFS_1	0.52
PF00530	SRCR	0.52
PF05303	GSKIP_dom	0.26
PF03028	Dynein_heavy	0.26
PF00001	7tm_1	0.26
PF00651	BTB	0.26
PF03520	KCNQ_channel	0.26
PF00876	Innexin	0.26
PF00307	CH	0.26
PF02709	Glyco_transf_7C	0.26
PF00653	BIR	0.26
PF14670	FXa_inhibition	0.26
PF01593	Amino_oxidase	0.26
PF00011	HSP20	0.26
PF00648	Peptidase_C2	0.26
PF00058	Ldl_recept_b	0.26
PF00250	Forkhead	0.26
PF03166	MH2	0.26
PF05605	zf-Di19	0.26
PF14735	HAUS4	0.26
PF13855	LRR_8	0.26
PF08487	VIT	0.26
PF08969	USP8_dimer	0.26
PF01061	ABC2_membrane	0.26
PF00075	RNase_H	0.26
PF01150	GDA1_CD39	0.26
PF13927	Ig_3	0.26
PF00035	dsrm	0.26
PF00089	Trypsin	0.26
PF07679	I-set	0.26
PF01062	Bestrophin	0.26

COG ID	Name	Functional Category	% Frequency in 385 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.08
COG0636	FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K	Energy production and conversion [C]	1.04
COG5371	Nucleoside diphosphatase, GDA1/CD39 family	Nucleotide transport and metabolism [F]	0.52
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.26

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	74.03 %
Unclassified	root	N/A	25.97 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	74.03 %
Unclassified	root	N/A	25.97 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	59.48 %
Unclassified	root	N/A	25.97 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	14.55 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	59.48 %
Unclassified	root	N/A	25.97 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	13.25 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	59.48 %
Unclassified	root	N/A	25.97 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5.71 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	59.48 %
Unclassified	root	N/A	25.97 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	3.38 %
Porifera	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera	0.52 %

Name	Rank	Taxonomy	Distribution
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	59.48 %
Unclassified	root	N/A	25.97 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	3.12 %
Demospongiae	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae	0.52 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	0.26 %

Name	Rank	Taxonomy	Distribution
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	59.48 %
Unclassified	root	N/A	25.97 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	3.12 %
Heteroscleromorpha	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha	0.52 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.26 %

Name	Rank	Taxonomy	Distribution
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	59.48 %
Unclassified	root	N/A	25.97 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	2.86 %
Haplosclerida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida	0.52 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.26 %
Hexacorallia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	59.48 %
Unclassified	root	N/A	25.97 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	2.86 %
Niphatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae	0.52 %
Scleractinia	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia	0.26 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.26 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	59.48 %
Unclassified	root	N/A	25.97 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	2.34 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Amphimedon	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon	0.52 %
Astrocoeniina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina	0.26 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	1.30 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	1.04 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.26 %
Pocilloporidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	1.04 %
Sedentaria	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.26 %
Pocillopora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	1.04 %
Scolecida	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Crustacea	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	1.04 %
Capitellidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Multicrustacea	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	1.04 %
Capitella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Malacostraca	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Eumalacostraca	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Eucarida	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Decapoda	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Brachyura	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Eubrachyura	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Heterotremata	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portunoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portunidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portuninae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae → Portuninae	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portunus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae → Portuninae → Portunus	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portunus trituberculatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae → Portuninae → Portunus → Portunus trituberculatus	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001742\|JGI24673J20094_10216881	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	554	Open in IMG/M
3300003748\|Ga0049102_10002223	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1966	Open in IMG/M
3300003748\|Ga0049102_10069196	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	664	Open in IMG/M
3300003769\|Ga0049118_10004238	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3008	Open in IMG/M
3300003769\|Ga0049118_10021634	Not Available	1931	Open in IMG/M
3300003769\|Ga0049118_10027701	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1787	Open in IMG/M
3300003769\|Ga0049118_10029910	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae → Portuninae → Portunus → Portunus trituberculatus	1742	Open in IMG/M
3300003769\|Ga0049118_10054588	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1395	Open in IMG/M
3300003769\|Ga0049118_10066397	Not Available	1288	Open in IMG/M
3300003769\|Ga0049118_10079913	Not Available	1188	Open in IMG/M
3300003769\|Ga0049118_10084194	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	1160	Open in IMG/M
3300003769\|Ga0049118_10102036	Not Available	1058	Open in IMG/M
3300003769\|Ga0049118_10114749	Not Available	998	Open in IMG/M
3300003769\|Ga0049118_10131126	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	929	Open in IMG/M
3300003769\|Ga0049118_10132415	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	925	Open in IMG/M
3300003769\|Ga0049118_10141602	Not Available	892	Open in IMG/M
3300003769\|Ga0049118_10205344	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	706	Open in IMG/M
3300003769\|Ga0049118_10219734	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	674	Open in IMG/M
3300003769\|Ga0049118_10239596	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	633	Open in IMG/M
3300003769\|Ga0049118_10289764	Not Available	545	Open in IMG/M
3300003776\|Ga0049101_10138917	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	801	Open in IMG/M
3300003776\|Ga0049101_10176968	Not Available	703	Open in IMG/M
3300003786\|Ga0049116_10024394	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1086	Open in IMG/M
3300003786\|Ga0049116_10027790	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1043	Open in IMG/M
3300003786\|Ga0049116_10031379	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1004	Open in IMG/M
3300003786\|Ga0049116_10055027	Not Available	839	Open in IMG/M
3300003786\|Ga0049116_10079402	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	741	Open in IMG/M
3300003786\|Ga0049116_10124391	Not Available	628	Open in IMG/M
3300003786\|Ga0049116_10139124	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	602	Open in IMG/M
3300003786\|Ga0049116_10145745	Not Available	591	Open in IMG/M
3300003786\|Ga0049116_10182040	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	539	Open in IMG/M
3300003843\|Ga0049117_10007664	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1904	Open in IMG/M
3300003843\|Ga0049117_10041289	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1156	Open in IMG/M
3300003843\|Ga0049117_10049993	Not Available	1087	Open in IMG/M
3300003843\|Ga0049117_10067364	Not Available	983	Open in IMG/M
3300003843\|Ga0049117_10069734	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	971	Open in IMG/M
3300003843\|Ga0049117_10106119	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	827	Open in IMG/M
3300003843\|Ga0049117_10159227	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	693	Open in IMG/M
3300003843\|Ga0049117_10179523	Not Available	654	Open in IMG/M
3300003843\|Ga0049117_10184542	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	645	Open in IMG/M
3300003843\|Ga0049117_10207515	Not Available	608	Open in IMG/M
3300003843\|Ga0049117_10250722	Not Available	548	Open in IMG/M
3300003843\|Ga0049117_10280491	Not Available	513	Open in IMG/M
3300003904\|JGI26658J51805_10051931	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	730	Open in IMG/M
3300003905\|JGI26657J51804_10296475	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	527	Open in IMG/M
3300003906\|JGI26667J51740_10003525	Not Available	1983	Open in IMG/M
3300003906\|JGI26667J51740_10217847	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	562	Open in IMG/M
3300003944\|Ga0049119_1005964	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	4408	Open in IMG/M
3300003944\|Ga0049119_1012313	Not Available	3488	Open in IMG/M
3300003944\|Ga0049119_1013714	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3359	Open in IMG/M
3300003944\|Ga0049119_1032265	Not Available	2391	Open in IMG/M
3300003944\|Ga0049119_1046782	Not Available	1997	Open in IMG/M
3300003944\|Ga0049119_1076910	Not Available	1494	Open in IMG/M
3300003944\|Ga0049119_1094096	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1298	Open in IMG/M
3300003944\|Ga0049119_1122134	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1052	Open in IMG/M
3300003944\|Ga0049119_1135741	Not Available	955	Open in IMG/M
3300003944\|Ga0049119_1148177	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	877	Open in IMG/M
3300003944\|Ga0049119_1176885	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	723	Open in IMG/M
3300003944\|Ga0049119_1199370	Not Available	624	Open in IMG/M
3300003944\|Ga0049119_1221542	Not Available	540	Open in IMG/M
3300004085\|Ga0066187_1065463	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1639	Open in IMG/M
3300004094\|Ga0066192_1000554	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	8824	Open in IMG/M
3300004094\|Ga0066192_1008671	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4245	Open in IMG/M
3300004094\|Ga0066192_1015926	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3432	Open in IMG/M
3300004094\|Ga0066192_1016184	Not Available	3412	Open in IMG/M
3300004094\|Ga0066192_1032892	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2549	Open in IMG/M
3300004094\|Ga0066192_1035512	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2459	Open in IMG/M
3300004094\|Ga0066192_1098029	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1406	Open in IMG/M
3300004094\|Ga0066192_1109235	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1309	Open in IMG/M
3300004094\|Ga0066192_1112113	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1286	Open in IMG/M
3300004094\|Ga0066192_1112778	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1280	Open in IMG/M
3300004094\|Ga0066192_1115947	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1256	Open in IMG/M
3300004094\|Ga0066192_1124428	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1197	Open in IMG/M
3300004094\|Ga0066192_1154616	Not Available	1023	Open in IMG/M
3300004094\|Ga0066192_1175443	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	929	Open in IMG/M
3300004094\|Ga0066192_1197115	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	847	Open in IMG/M
3300004094\|Ga0066192_1202378	Not Available	829	Open in IMG/M
3300004094\|Ga0066192_1206115	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	817	Open in IMG/M
3300004094\|Ga0066192_1221602	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	770	Open in IMG/M
3300004094\|Ga0066192_1282050	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	626	Open in IMG/M
3300004094\|Ga0066192_1316055	Not Available	565	Open in IMG/M
3300004094\|Ga0066192_1346342	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	519	Open in IMG/M
3300004626\|Ga0066188_1002304	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3141	Open in IMG/M
3300004626\|Ga0066188_1003672	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2785	Open in IMG/M
3300004626\|Ga0066188_1003788	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2761	Open in IMG/M
3300004626\|Ga0066188_1004459	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2651	Open in IMG/M
3300004626\|Ga0066188_1021785	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1759	Open in IMG/M
3300004626\|Ga0066188_1027845	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1633	Open in IMG/M
3300004626\|Ga0066188_1033047	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1546	Open in IMG/M
3300004626\|Ga0066188_1052621	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1319	Open in IMG/M
3300004626\|Ga0066188_1057078	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1280	Open in IMG/M
3300004626\|Ga0066188_1083621	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1101	Open in IMG/M
3300004626\|Ga0066188_1095447	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1041	Open in IMG/M
3300004626\|Ga0066188_1137841	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	874	Open in IMG/M
3300004626\|Ga0066188_1141039	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	864	Open in IMG/M
3300004626\|Ga0066188_1173573	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	771	Open in IMG/M
3300004626\|Ga0066188_1195406	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	719	Open in IMG/M
3300004626\|Ga0066188_1219719	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	669	Open in IMG/M
3300004626\|Ga0066188_1243293	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	626	Open in IMG/M
3300004626\|Ga0066188_1263701	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	593	Open in IMG/M
3300004626\|Ga0066188_1302076	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	537	Open in IMG/M
3300004630\|Ga0049105_1057817	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2844	Open in IMG/M
3300004630\|Ga0049105_1077611	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2402	Open in IMG/M
3300004630\|Ga0049105_1160054	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1413	Open in IMG/M
3300005170\|Ga0071327_1017738	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4559	Open in IMG/M
3300005170\|Ga0071327_1124098	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1636	Open in IMG/M
3300005649\|Ga0056116_1021200	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3865	Open in IMG/M
3300005652\|Ga0056135_10109962	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1562	Open in IMG/M
3300005967\|Ga0056128_1000245	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	42204	Open in IMG/M
3300005967\|Ga0056128_1001518	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	26066	Open in IMG/M
3300005967\|Ga0056128_1003778	Not Available	18760	Open in IMG/M
3300005967\|Ga0056128_1003960	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	18438	Open in IMG/M
3300005967\|Ga0056128_1003992	All Organisms → cellular organisms → Eukaryota → Opisthokonta	18371	Open in IMG/M
3300005967\|Ga0056128_1004767	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	17006	Open in IMG/M
3300005967\|Ga0056128_1005021	All Organisms → cellular organisms → Eukaryota → Opisthokonta	16609	Open in IMG/M
3300005967\|Ga0056128_1006187	Not Available	15107	Open in IMG/M
3300005967\|Ga0056128_1008442	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	12979	Open in IMG/M
3300005967\|Ga0056128_1009021	Not Available	12552	Open in IMG/M
3300005967\|Ga0056128_1009464	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	12230	Open in IMG/M
3300005967\|Ga0056128_1010508	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11536	Open in IMG/M
3300005967\|Ga0056128_1012743	Not Available	10244	Open in IMG/M
3300005967\|Ga0056128_1014656	All Organisms → cellular organisms → Eukaryota → Opisthokonta	9332	Open in IMG/M
3300005967\|Ga0056128_1016663	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8450	Open in IMG/M
3300005967\|Ga0056128_1016960	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	8350	Open in IMG/M
3300005967\|Ga0056128_1036334	Not Available	3773	Open in IMG/M
3300005967\|Ga0056128_1050546	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2120	Open in IMG/M
3300005967\|Ga0056128_1059022	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1478	Open in IMG/M
3300005967\|Ga0056128_1062143	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1290	Open in IMG/M
3300005968\|Ga0056130_1025733	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2569	Open in IMG/M
3300005968\|Ga0056130_1038484	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2204	Open in IMG/M
3300005968\|Ga0056130_1039659	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2177	Open in IMG/M
3300005968\|Ga0056130_1044125	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2080	Open in IMG/M
3300005968\|Ga0056130_1048637	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1994	Open in IMG/M
3300005968\|Ga0056130_1052589	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1926	Open in IMG/M
3300005968\|Ga0056130_1052795	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1922	Open in IMG/M
3300005968\|Ga0056130_1053973	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1904	Open in IMG/M
3300005968\|Ga0056130_1062067	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1785	Open in IMG/M
3300005968\|Ga0056130_1062957	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1773	Open in IMG/M
3300005968\|Ga0056130_1073591	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1640	Open in IMG/M
3300005968\|Ga0056130_1083208	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1540	Open in IMG/M
3300005968\|Ga0056130_1087207	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1500	Open in IMG/M
3300005968\|Ga0056130_1109644	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1314	Open in IMG/M
3300005968\|Ga0056130_1112358	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1294	Open in IMG/M
3300005968\|Ga0056130_1121892	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1229	Open in IMG/M
3300005968\|Ga0056130_1130504	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1176	Open in IMG/M
3300005968\|Ga0056130_1131110	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1173	Open in IMG/M
3300005968\|Ga0056130_1153469	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1052	Open in IMG/M
3300005968\|Ga0056130_1171427	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	967	Open in IMG/M
3300005968\|Ga0056130_1180231	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	930	Open in IMG/M
3300005968\|Ga0056130_1200618	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	852	Open in IMG/M
3300005968\|Ga0056130_1213358	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	807	Open in IMG/M
3300005968\|Ga0056130_1286543	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	608	Open in IMG/M
3300005968\|Ga0056130_1337725	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	509	Open in IMG/M
3300005978\|Ga0056129_1007323	All Organisms → cellular organisms → Eukaryota	5311	Open in IMG/M
3300005978\|Ga0056129_1008297	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5107	Open in IMG/M
3300005978\|Ga0056129_1028782	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3257	Open in IMG/M
3300005978\|Ga0056129_1049735	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2523	Open in IMG/M
3300005978\|Ga0056129_1053436	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2429	Open in IMG/M
3300005978\|Ga0056129_1057396	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2339	Open in IMG/M
3300005978\|Ga0056129_1066256	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2155	Open in IMG/M
3300005978\|Ga0056129_1088011	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1806	Open in IMG/M
3300005978\|Ga0056129_1110247	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1540	Open in IMG/M
3300005978\|Ga0056129_1120397	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1441	Open in IMG/M
3300005978\|Ga0056129_1144502	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1237	Open in IMG/M
3300005978\|Ga0056129_1171132	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1062	Open in IMG/M
3300005978\|Ga0056129_1184823	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	983	Open in IMG/M
3300005978\|Ga0056129_1214635	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	840	Open in IMG/M
3300005978\|Ga0056129_1269928	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	642	Open in IMG/M
3300005978\|Ga0056129_1285257	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	600	Open in IMG/M
3300005978\|Ga0056129_1285910	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	598	Open in IMG/M
3300006912\|Ga0056114_1007668	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6830	Open in IMG/M
3300006912\|Ga0056114_1012948	Not Available	5715	Open in IMG/M
3300006912\|Ga0056114_1019958	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4811	Open in IMG/M
3300006912\|Ga0056114_1021628	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4644	Open in IMG/M
3300006912\|Ga0056114_1036079	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3622	Open in IMG/M
3300006912\|Ga0056114_1040036	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3422	Open in IMG/M
3300006912\|Ga0056114_1041953	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3334	Open in IMG/M
3300006912\|Ga0056114_1043323	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3277	Open in IMG/M
3300006912\|Ga0056114_1049443	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3032	Open in IMG/M
3300006912\|Ga0056114_1054296	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2859	Open in IMG/M
3300006912\|Ga0056114_1057132	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2765	Open in IMG/M
3300006912\|Ga0056114_1065437	Not Available	2521	Open in IMG/M
3300006912\|Ga0056114_1068531	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2439	Open in IMG/M
3300006912\|Ga0056114_1077015	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2240	Open in IMG/M
3300006912\|Ga0056114_1102278	Not Available	1765	Open in IMG/M
3300006912\|Ga0056114_1120042	Not Available	1514	Open in IMG/M
3300006912\|Ga0056114_1120651	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1507	Open in IMG/M
3300006912\|Ga0056114_1139266	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1294	Open in IMG/M
3300006912\|Ga0056114_1140460	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1282	Open in IMG/M
3300006912\|Ga0056114_1147886	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1210	Open in IMG/M
3300006912\|Ga0056114_1151851	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1173	Open in IMG/M
3300006912\|Ga0056114_1152267	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1169	Open in IMG/M
3300006912\|Ga0056114_1161754	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1088	Open in IMG/M
3300006912\|Ga0056114_1162179	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1084	Open in IMG/M
3300006912\|Ga0056114_1184487	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	922	Open in IMG/M
3300006912\|Ga0056114_1204407	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	804	Open in IMG/M
3300006912\|Ga0056114_1237343	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	656	Open in IMG/M
3300006912\|Ga0056114_1242901	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	636	Open in IMG/M
3300006912\|Ga0056114_1256048	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	593	Open in IMG/M
3300006912\|Ga0056114_1260275	Not Available	580	Open in IMG/M
3300006912\|Ga0056114_1283882	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	521	Open in IMG/M
3300008214\|Ga0056111_1022628	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	551	Open in IMG/M
3300008215\|Ga0056108_1143898	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1534	Open in IMG/M
3300027098\|Ga0209367_1000177	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	50966	Open in IMG/M
3300027098\|Ga0209367_1000272	All Organisms → cellular organisms → Eukaryota → Opisthokonta	45521	Open in IMG/M
3300027098\|Ga0209367_1000358	All Organisms → cellular organisms → Eukaryota	42698	Open in IMG/M
3300027098\|Ga0209367_1001152	Not Available	31337	Open in IMG/M
3300027098\|Ga0209367_1001425	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	29304	Open in IMG/M
3300027098\|Ga0209367_1001782	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	27362	Open in IMG/M
3300027098\|Ga0209367_1001993	All Organisms → cellular organisms → Eukaryota	26307	Open in IMG/M
3300027098\|Ga0209367_1002106	All Organisms → cellular organisms → Eukaryota → Opisthokonta	25826	Open in IMG/M
3300027098\|Ga0209367_1003297	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	21914	Open in IMG/M
3300027098\|Ga0209367_1004028	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	20144	Open in IMG/M
3300027098\|Ga0209367_1004790	Not Available	18774	Open in IMG/M
3300027098\|Ga0209367_1005019	All Organisms → cellular organisms → Eukaryota → Opisthokonta	18351	Open in IMG/M
3300027098\|Ga0209367_1005203	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	18032	Open in IMG/M
3300027098\|Ga0209367_1006518	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	16132	Open in IMG/M
3300027098\|Ga0209367_1007057	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	15504	Open in IMG/M
3300027098\|Ga0209367_1007590	All Organisms → cellular organisms → Eukaryota → Opisthokonta	14918	Open in IMG/M
3300027098\|Ga0209367_1008519	All Organisms → cellular organisms → Eukaryota → Opisthokonta	14020	Open in IMG/M
3300027098\|Ga0209367_1008875	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	13709	Open in IMG/M
3300027098\|Ga0209367_1010631	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	12315	Open in IMG/M
3300027098\|Ga0209367_1012699	All Organisms → cellular organisms → Eukaryota → Opisthokonta	10956	Open in IMG/M
3300027098\|Ga0209367_1013702	Not Available	10398	Open in IMG/M
3300027098\|Ga0209367_1015805	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	9357	Open in IMG/M
3300027098\|Ga0209367_1016110	All Organisms → cellular organisms → Eukaryota → Opisthokonta	9214	Open in IMG/M
3300027098\|Ga0209367_1017414	All Organisms → cellular organisms → Eukaryota	8624	Open in IMG/M
3300027098\|Ga0209367_1017811	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8454	Open in IMG/M
3300027098\|Ga0209367_1017858	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	8435	Open in IMG/M
3300027098\|Ga0209367_1019140	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	7914	Open in IMG/M
3300027098\|Ga0209367_1023651	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6402	Open in IMG/M
3300027098\|Ga0209367_1023813	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6361	Open in IMG/M
3300027098\|Ga0209367_1026486	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5622	Open in IMG/M
3300027098\|Ga0209367_1035866	Not Available	3663	Open in IMG/M
3300027118\|Ga0209454_1000421	Not Available	22429	Open in IMG/M
3300027118\|Ga0209454_1000730	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	18105	Open in IMG/M
3300027118\|Ga0209454_1002220	All Organisms → cellular organisms → Eukaryota → Opisthokonta	13019	Open in IMG/M
3300027118\|Ga0209454_1019086	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5750	Open in IMG/M
3300027118\|Ga0209454_1026802	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4734	Open in IMG/M
3300027118\|Ga0209454_1029899	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	4405	Open in IMG/M
3300027118\|Ga0209454_1042194	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3396	Open in IMG/M
3300027118\|Ga0209454_1135506	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	525	Open in IMG/M
3300027175\|Ga0209146_1011899	Not Available	4229	Open in IMG/M
3300027175\|Ga0209146_1121891	Not Available	1114	Open in IMG/M
3300027175\|Ga0209146_1178344	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	690	Open in IMG/M
3300027175\|Ga0209146_1213496	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	520	Open in IMG/M
3300027208\|Ga0209671_1001107	All Organisms → cellular organisms → Eukaryota → Opisthokonta	21360	Open in IMG/M
3300027208\|Ga0209671_1012138	Not Available	9080	Open in IMG/M
3300027208\|Ga0209671_1027639	Not Available	5355	Open in IMG/M
3300027208\|Ga0209671_1044903	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3305	Open in IMG/M
3300027208\|Ga0209671_1057350	Not Available	2349	Open in IMG/M
3300027208\|Ga0209671_1067261	Not Available	1761	Open in IMG/M
3300027208\|Ga0209671_1078581	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1203	Open in IMG/M
3300027208\|Ga0209671_1088292	Not Available	859	Open in IMG/M
3300027208\|Ga0209671_1099782	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	565	Open in IMG/M
3300027289\|Ga0209787_1002585	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4104	Open in IMG/M
3300027289\|Ga0209787_1021219	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	2284	Open in IMG/M
3300027289\|Ga0209787_1023214	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2215	Open in IMG/M
3300027289\|Ga0209787_1052150	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1629	Open in IMG/M
3300027289\|Ga0209787_1074469	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1375	Open in IMG/M
3300027289\|Ga0209787_1088648	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1255	Open in IMG/M
3300027289\|Ga0209787_1096588	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1197	Open in IMG/M
3300027289\|Ga0209787_1112141	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1099	Open in IMG/M
3300027289\|Ga0209787_1129053	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1007	Open in IMG/M
3300027289\|Ga0209787_1135420	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	977	Open in IMG/M
3300027289\|Ga0209787_1136223	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	973	Open in IMG/M
3300027289\|Ga0209787_1136928	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	970	Open in IMG/M
3300027289\|Ga0209787_1152592	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	901	Open in IMG/M
3300027289\|Ga0209787_1163556	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	858	Open in IMG/M
3300027289\|Ga0209787_1219870	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	664	Open in IMG/M
3300027289\|Ga0209787_1234551	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	625	Open in IMG/M
3300027289\|Ga0209787_1272150	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	533	Open in IMG/M
3300027347\|Ga0209366_1010115	Not Available	4018	Open in IMG/M
3300027347\|Ga0209366_1026551	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2775	Open in IMG/M
3300027347\|Ga0209366_1063760	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1798	Open in IMG/M
3300027347\|Ga0209366_1077690	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1597	Open in IMG/M
3300027347\|Ga0209366_1100125	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1339	Open in IMG/M
3300027347\|Ga0209366_1123688	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1138	Open in IMG/M
3300027347\|Ga0209366_1133992	Not Available	1066	Open in IMG/M
3300027347\|Ga0209366_1148556	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	974	Open in IMG/M
3300027347\|Ga0209366_1200642	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	711	Open in IMG/M
3300027377\|Ga0209363_1004433	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	8143	Open in IMG/M
3300027392\|Ga0209680_1003971	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6026	Open in IMG/M
3300027392\|Ga0209680_1007733	All Organisms → cellular organisms → Eukaryota	4925	Open in IMG/M
3300027392\|Ga0209680_1008826	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4715	Open in IMG/M
3300027392\|Ga0209680_1008886	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4705	Open in IMG/M
3300027392\|Ga0209680_1023788	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3301	Open in IMG/M
3300027392\|Ga0209680_1027370	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3115	Open in IMG/M
3300027392\|Ga0209680_1030254	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2984	Open in IMG/M
3300027392\|Ga0209680_1059968	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2139	Open in IMG/M
3300027392\|Ga0209680_1077344	Not Available	1846	Open in IMG/M
3300027392\|Ga0209680_1131567	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1249	Open in IMG/M
3300027392\|Ga0209680_1142110	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1166	Open in IMG/M
3300027392\|Ga0209680_1145200	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1142	Open in IMG/M
3300027392\|Ga0209680_1179918	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	927	Open in IMG/M
3300027392\|Ga0209680_1186630	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	891	Open in IMG/M
3300027392\|Ga0209680_1199630	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	822	Open in IMG/M
3300027392\|Ga0209680_1209670	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	772	Open in IMG/M
3300027392\|Ga0209680_1237481	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	651	Open in IMG/M
3300027392\|Ga0209680_1277901	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	510	Open in IMG/M
3300027398\|Ga0209782_1006349	Not Available	7431	Open in IMG/M
3300027398\|Ga0209782_1008964	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6489	Open in IMG/M
3300027398\|Ga0209782_1010862	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	5992	Open in IMG/M
3300027398\|Ga0209782_1014394	Not Available	5301	Open in IMG/M
3300027404\|Ga0209049_1109634	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	768	Open in IMG/M
3300027519\|Ga0209562_1001163	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	9923	Open in IMG/M
3300027519\|Ga0209562_1003594	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	7088	Open in IMG/M
3300027519\|Ga0209562_1004424	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6647	Open in IMG/M
3300027519\|Ga0209562_1011983	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4787	Open in IMG/M
3300027519\|Ga0209562_1014524	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4471	Open in IMG/M
3300027519\|Ga0209562_1027426	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3445	Open in IMG/M
3300027519\|Ga0209562_1028729	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	3371	Open in IMG/M
3300027519\|Ga0209562_1029941	Not Available	3306	Open in IMG/M
3300027519\|Ga0209562_1032531	Not Available	3180	Open in IMG/M
3300027519\|Ga0209562_1039310	Not Available	2898	Open in IMG/M
3300027519\|Ga0209562_1046591	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2649	Open in IMG/M
3300027519\|Ga0209562_1049042	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2575	Open in IMG/M
3300027519\|Ga0209562_1055272	Not Available	2410	Open in IMG/M
3300027519\|Ga0209562_1057127	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2362	Open in IMG/M
3300027519\|Ga0209562_1059634	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2303	Open in IMG/M
3300027519\|Ga0209562_1066906	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2150	Open in IMG/M
3300027519\|Ga0209562_1068481	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2118	Open in IMG/M
3300027519\|Ga0209562_1079471	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1926	Open in IMG/M
3300027519\|Ga0209562_1082658	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1877	Open in IMG/M
3300027519\|Ga0209562_1089465	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1777	Open in IMG/M
3300027519\|Ga0209562_1094484	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1709	Open in IMG/M
3300027519\|Ga0209562_1111901	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1500	Open in IMG/M
3300027519\|Ga0209562_1211961	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	822	Open in IMG/M
3300027519\|Ga0209562_1232872	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	734	Open in IMG/M
3300027519\|Ga0209562_1247799	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	680	Open in IMG/M
3300027519\|Ga0209562_1256440	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	651	Open in IMG/M
3300027519\|Ga0209562_1259091	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	642	Open in IMG/M
3300027544\|Ga0209568_1012503	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4592	Open in IMG/M
3300027550\|Ga0209255_1000819	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	8300	Open in IMG/M
3300027550\|Ga0209255_1013941	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3546	Open in IMG/M
3300027550\|Ga0209255_1216338	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	954	Open in IMG/M
3300027557\|Ga0209679_1253709	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	719	Open in IMG/M
3300027569\|Ga0209364_1100035	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1541	Open in IMG/M
3300027569\|Ga0209364_1131337	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1310	Open in IMG/M
3300027569\|Ga0209364_1188283	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1020	Open in IMG/M
3300027602\|Ga0209781_1150499	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1325	Open in IMG/M
3300027602\|Ga0209781_1153111	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1308	Open in IMG/M
3300027602\|Ga0209781_1166461	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1224	Open in IMG/M
3300027602\|Ga0209781_1242335	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	877	Open in IMG/M
3300027658\|Ga0209259_1013346	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4090	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24673J20094_102168812	3300001742	Marine Gutless Worms Symbiont	MFNVSALLLDDARKPATPLTNGAINETLRQFAPLSDDRLLQ
Ga0049102_100022231	3300003748	Marine Gutless Worms Symbiont	MFSVSTLLLDRAFKPATPLTNGVINETLRQFAPLSDISQGSVA
Ga0049102_100068453	3300003748	Marine Gutless Worms Symbiont	MFNVSTLLLDDTFNPATPLTNGVISEALQQLATLSDISQ*
Ga0049102_100691961	3300003748	Marine Gutless Worms Symbiont	MFNVSTLLLDDAFKPLTPLTNGVINETLRQFFPLSDISR*
Ga0049102_100771642	3300003748	Marine Gutless Worms Symbiont	MFNVSALLLDDTFNRTTPLTNGVINEMLRQFAPLSDFTK*
Ga0049118_100042381	3300003769	Marine Gutless Worms Symbiont	MFYVSALLLDDASKTATPLSNGAINQTLRQFAPLSDDRLL*
Ga0049118_100216341	3300003769	Marine Gutless Worms Symbiont	MFNVSGLLLDDALKHMTPLTSGAINQTLRQFAPLSDDRLLQLADCRKCRR*
Ga0049118_100277011	3300003769	Marine Gutless Worms Symbiont	SHQMFDVSAFLPDDALKPSTPLTNGAINQTLRQFASLSDDCLLQLVNCR*
Ga0049118_100299102	3300003769	Marine Gutless Worms Symbiont	MFNVSAVLLDDALKPATPLTNGAISQTLWRFAPLSGNHLLQLVD*
Ga0049118_100514832	3300003769	Marine Gutless Worms Symbiont	MFSVSALLLDDTLKPETLLTNGAINETLLQFAPLSASAG*
Ga0049118_100545883	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNATPLTNSAINQMLRHFAPLSDNRFLQLVDCRE*
Ga0049118_100663971	3300003769	Marine Gutless Worms Symbiont	MFNASTLLLDDALKPVTPLTNGTINQMLQQFTPLDDCLLQLVDCHE
Ga0049118_100799131	3300003769	Marine Gutless Worms Symbiont	MFNVPALLLDDASKTVTPLTSGAINQTLRQLAPLSDDRLLQLVDCCESN*
Ga0049118_100841942	3300003769	Marine Gutless Worms Symbiont	MFNVFALLLDDARKPATPLTNGAISQKLRQFAPLSDNHLLQLVD*
Ga0049118_101020361	3300003769	Marine Gutless Worms Symbiont	FSHQIFNVFALLLYDASKPATPLTKGAINQTLRHFAPLSDNSFL*
Ga0049118_101147491	3300003769	Marine Gutless Worms Symbiont	MFNVSLLLLDDASKLATPLTNGAISQTLWHFAPLSDIGFL*
Ga0049118_101311262	3300003769	Marine Gutless Worms Symbiont	MFNVFALLLDDALKPVTPLTNGTINQTLRQFAPLNDNLLL*
Ga0049118_101324152	3300003769	Marine Gutless Worms Symbiont	FNVSALLLDVASKPATPLTNXAINQTLRQFAPLSDNGFL*
Ga0049118_101416022	3300003769	Marine Gutless Worms Symbiont	MFNESALLLDHASKNGTPLTNGANQMLRQFAPLSDNRLLQLVDCRELSK*
Ga0049118_101534141	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINQTLQQFAPLSAPELS*
Ga0049118_102053442	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTATPLTNGAINQTLRHFASLTDNGFL*
Ga0049118_102197341	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNHLLQLVD*
Ga0049118_102197991	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLEDALKPATPLTNGAINQTLRQFAPLGASAG*
Ga0049118_102395961	3300003769	Marine Gutless Worms Symbiont	MVNVSALLLKDALKTATPLTNGAINQTLWQFSPLIDDRLL*
Ga0049118_102897642	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNVTPLTNSAINQTLQQFAPLSDDRLLQLV
Ga0049118_103181392	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDTSKTATLLTNGVINQMLRQFAPLSDNRLLQWLPVVNRQH*
Ga0049101_101349961	3300003776	Marine Gutless Worms Symbiont	MFKVSTLLLDDKFKPAMPLTNCMIMINEMLRQFAPLGDIS*
Ga0049101_101389171	3300003776	Marine Gutless Worms Symbiont	MFKVYTLLLDDALKLVTPLTNGVINETLRQFAPFSDISQLTR*
Ga0049101_101451592	3300003776	Marine Gutless Worms Symbiont	MFNVLALLLDDALKPATPMTNGVINKTLRSFAPLSDTSQG
Ga0049101_101769681	3300003776	Marine Gutless Worms Symbiont	MFNAFALLLDDAFKPATPLTNGVINETLRQFASLNNISKGSVV*
Ga0049101_102144031	3300003776	Marine Gutless Worms Symbiont	MFNVSAFLLDDAFKPATPLTNGVINDTMRQFATLSDISQGSVA
Ga0049116_100243941	3300003786	Marine Gutless Worms Symbiont	MFNLSALLLDDALKPATPLTNGAINETLRQFAPLSDDTLEM
Ga0049116_100277901	3300003786	Marine Gutless Worms Symbiont	MFNVSALLLDNALKPATPLANGAISETLRQFVPLSDDTLEVWWDL*
Ga0049116_100313791	3300003786	Marine Gutless Worms Symbiont	MFSVSTLLLDEALKPVTPLTNGAINETLREFAPLSDDTLEVWWNL*
Ga0049116_100550271	3300003786	Marine Gutless Worms Symbiont	MQFLHLMFNASALLRDDQLKPVTPLTNGAIDETLQQFAALSDDCLL*
Ga0049116_100794021	3300003786	Marine Gutless Worms Symbiont	MFIVSALLLDDALKPTTPLTNGAINETLRQFAPLSDDTLEVWLDL*
Ga0049116_101243911	3300003786	Marine Gutless Worms Symbiont	MLQFSHQMFNVSALLLDDALKPATLLTNGAINETLRQFAPLSDDTLEVRWDL*
Ga0049116_101391242	3300003786	Marine Gutless Worms Symbiont	FSVSALLPDDALKPATPQINGVINEMLPQFVPLSDNTLEVWWDL*
Ga0049116_101457452	3300003786	Marine Gutless Worms Symbiont	MFNLIALLQDDPLKPVTPLTNGTIDETLQQFASLSDDCLL*
Ga0049116_101820401	3300003786	Marine Gutless Worms Symbiont	SHAADLHQMFNLFALLLDDPLKPATPLTNGAINETLQQFAPLSDDCLL*
Ga0049116_102102812	3300003786	Marine Gutless Worms Symbiont	MFSLFALLRDDPLKPATPLTNGAIDETLQWFAALSDDCLLQLVD*
Ga0049117_100076643	3300003843	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLNNSAINQTLPQFAPLSAPELS*
Ga0049117_100412892	3300003843	Marine Gutless Worms Symbiont	FNVSALLLDDASKNATPLTNSAINQMLRHFAPLSDNRFLQLVDCRE*
Ga0049117_100499933	3300003843	Marine Gutless Worms Symbiont	MFNVSALLLDNALKPATPLTSGAINQMLRQFAPLSDDRLH
Ga0049117_100673642	3300003843	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNATPLTNSAINQMLRQFAPLSDNRLL*
Ga0049117_100697341	3300003843	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTSGAISQTLWQFAPLSDNHLLQLVN*
Ga0049117_101061192	3300003843	Marine Gutless Worms Symbiont	MFNMSALLLDDALKPSMPLTNGAINQTLRQFAPISDDRLLVDCH*
Ga0049117_101592271	3300003843	Marine Gutless Worms Symbiont	MFNIFALLLDDASKTATPLTNGAVNQTPRQFAPLNDDRLL*
Ga0049117_101795231	3300003843	Marine Gutless Worms Symbiont	MLNVSALLLDDASKTATPLTNGAINQTLRQFAPLSDNGFL*
Ga0049117_101845421	3300003843	Marine Gutless Worms Symbiont	MFNVSALLLNDAPKPATPLTNGAISQTLRQFAPLSDNSFL*
Ga0049117_102014431	3300003843	Marine Gutless Worms Symbiont	ACNISQFSHQMFNVSALLLEDALKPATPLTNGAINQTLRQFAPLGASAG*
Ga0049117_102075151	3300003843	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLTNSAIKQTLRQFAPLSAPKLS*
Ga0049117_102414291	3300003843	Marine Gutless Worms Symbiont	MFSVSALLLDDAFKPSTPLTNGAINQTLQQFAPLSAPELS*
Ga0049117_102507221	3300003843	Marine Gutless Worms Symbiont	MFNVFALLVDDASKTPTPLTNGAINQTLWLRQSAPLSDDRLL*
Ga0049117_102804911	3300003843	Marine Gutless Worms Symbiont	ISQFSHQMFNVSAVLLDDALKPATPLTNGAISQTLWRFAPLSGNHLLQLVD*
JGI26658J51805_100519311	3300003904	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFVPLSDNRLLQLIDCRESF*
JGI26657J51804_102964752	3300003905	Marine Gutless Worms Symbiont	MFMSALLLDDALKPTTPLTNGGINEMLRQFSPLSDVTIACFS*
JGI26667J51740_100035254	3300003906	Marine Gutless Worms Symbiont	MLQFLHQMFNVSVLHALKPATPLTIGAINVTLRQFVPLSDDTLEMWWDL*
JGI26667J51740_102178471	3300003906	Marine Gutless Worms Symbiont	MFNVSLLLLDDAVKPATPLTNGAIDETLRQFAPLSDDRLLQLVD*
Ga0049119_10059645	3300003944	Marine Gutless Worms Symbiont	MSALLLDDASKSATPLTSGAINQTLRQFAPLSDNGFFLAG*
Ga0049119_10123134	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINLILRQFAPLSAPELS*
Ga0049119_10137141	3300003944	Marine Gutless Worms Symbiont	QFLHQMFNVSALLLDDASKTATPLTNGAINQTLRHFASLTDNGFL*
Ga0049119_10322654	3300003944	Marine Gutless Worms Symbiont	MFNVCTLLLDDASKTATPLTNGANQLLRQFAPLSDNRLLQLVDCR
Ga0049119_10467821	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDVASKTATPLTSGAINQTLQQFAPLSDDRLL
Ga0049119_10529091	3300003944	Marine Gutless Worms Symbiont	MSALLLDDASKSATSLTNGAINQTLRQFAPLSDNRLLQLVDCR
Ga0049119_10769101	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDGTSKTATLLTNGGINQTLRQFAPLSDSRLLQL
Ga0049119_10940962	3300003944	Marine Gutless Worms Symbiont	QFSHQMFNVSALLLDDASKPATPLTNGAINQTLRHIAPLSDNGFLAG*
Ga0049119_11221341	3300003944	Marine Gutless Worms Symbiont	MFNVSAVLLDDALKPATPLTNGAISQTLWQFAPLSGNHLLQLVD*
Ga0049119_11357411	3300003944	Marine Gutless Worms Symbiont	MFNMSALLLDDTSKMAMPLTNGTINQTLWQFAPLSDDHLLQLTVVNHQH*
Ga0049119_11481771	3300003944	Marine Gutless Worms Symbiont	FNVSALLLDDAPKPATPLTSGAISQTLWQFAPLSDNHLLQLVN*
Ga0049119_11768852	3300003944	Marine Gutless Worms Symbiont	MFNVFALLLDDALKPVTPLTNGTINQTLQQFAPLNDNLLL*
Ga0049119_11993702	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTATPLTNGAKQMLRQFASLGDNRLL*
Ga0049119_12215421	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNATPLTNSAINQMLRQFAPLSDNRLLQLVD
Ga0066187_10654631	3300004085	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPMTNGAINEMLRQFAPLSDDRLLLIVVNH*
Ga0066192_10005545	3300004094	Marine Gutless Worms Symbiont	MFNASALLQLDHALKPATPLTSGVISETLRQFAPLSDDTHEVWWDL*
Ga0066192_10086719	3300004094	Marine Gutless Worms Symbiont	MQFLHQMFNMSALLLDDALKPATPLTNSAINETLRQFALPLSDDTLEVWWDLL*
Ga0066192_10159261	3300004094	Marine Gutless Worms Symbiont	MFNVSTLLQGDALKPATPLTNGVMNETLRQFAPLSDDTLEMWWDL*
Ga0066192_10161841	3300004094	Marine Gutless Worms Symbiont	ILQFLHQMFNVSALLLDDALKPTTPLTNGAINETLRHTLDI*
Ga0066192_10328921	3300004094	Marine Gutless Worms Symbiont	CHILQFLHQMFNLFALLLDNALKPATPLTNGTINETLRQFAPLIDDTLKVCWDL*
Ga0066192_10355123	3300004094	Marine Gutless Worms Symbiont	MFTVSALLPDDALKSATPLTNGAINKTLRQFAPLSDDRLLQLVDC
Ga0066192_10980292	3300004094	Marine Gutless Worms Symbiont	MFNVSTLLLDDALKPATPLTNGAINETLRQFAPLSHDTPEV*
Ga0066192_11092351	3300004094	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFVPLSDDILEVW*
Ga0066192_11121132	3300004094	Marine Gutless Worms Symbiont	LHQMFNVSTLLLDDALKPATPLTNGAINETLRQFAPLSDDTLAVW*
Ga0066192_11127783	3300004094	Marine Gutless Worms Symbiont	MFNVSTLLLDDALRPATPLTNDAINEMLRQFATLSDDTLEVWWDL*
Ga0066192_11159473	3300004094	Marine Gutless Worms Symbiont	QMFNVSALLLDDALKPATPLTNVAINETLRQFSPLSDDTL*
Ga0066192_11244281	3300004094	Marine Gutless Worms Symbiont	MFYLSVSALLLDDALKPATPLTNGVFNETLRQFAPLSDDTLEVWWDL*
Ga0066192_11546164	3300004094	Marine Gutless Worms Symbiont	MFNLFALLPDDPLKLATPQTNGAIDETLQQFAPLSDDCLL
Ga0066192_11734963	3300004094	Marine Gutless Worms Symbiont	HILQFLHQMFNVSALLLDDAAGDATDNGAFNETLRQFASLSDDTLEVW*
Ga0066192_11754432	3300004094	Marine Gutless Worms Symbiont	MFNVSALLLDDARKPATPLTNGVINETLRQFAPLSDDRLLQLVDC
Ga0066192_11971152	3300004094	Marine Gutless Worms Symbiont	MCPPCLLLDDALKLATPLTNGAINETLRQFAPLSDDTLEV*
Ga0066192_12023781	3300004094	Marine Gutless Worms Symbiont	MLQFLHQMFNLFALVRDDPLKPVTTLTNGAIDEKLQQFAPLSDDCLLQLVDFLES
Ga0066192_12061151	3300004094	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPVTPLTNGAINESLRQFAPLSDDTLEARWAL*
Ga0066192_12216021	3300004094	Marine Gutless Worms Symbiont	MFNVSSLLVDDAVKPTTPLANGVISETLRQFAPLSDDTLEVW
Ga0066192_12820501	3300004094	Marine Gutless Worms Symbiont	MQFLHQVFNVSALLRDDPLKPAMPTTNGTINETLRQFAPLSDDCLLQLIDCRESS
Ga0066192_13160552	3300004094	Marine Gutless Worms Symbiont	MFNVSALLRDDPLKPATPLTNDAINETLRQFAPLSDDTLEVW
Ga0066192_13463421	3300004094	Marine Gutless Worms Symbiont	HQMFNVSALLLDDALKPATPLTNGTISETLRQFAPLSDDTLEVWWHL*
Ga0066188_10023044	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPVTPLTNGAINETLRQFAPLNDDRLL*
Ga0066188_10036721	3300004626	Marine Gutless Worms Symbiont	MRFLYQMFNVSALLLDDARKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0066188_10037882	3300004626	Marine Gutless Worms Symbiont	MQFLYQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0066188_10044593	3300004626	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGYNNETLRQFAPLNDDRLL*
Ga0066188_10217853	3300004626	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDGLKPATPLTNGEMNERCQFAPLNDDRLL*
Ga0066188_10278451	3300004626	Marine Gutless Worms Symbiont	MQFLLQMFNVSTLLLDDGLKPATPLTNGAINETLRQFAPLSDDRLL*
Ga0066188_10330473	3300004626	Marine Gutless Worms Symbiont	MQFLQQMFNVSALLLDDGLKPATPLTRPNGAINETLRQFAPLNDDRLI*
Ga0066188_10526211	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDAIKPTTPLTNGAINETLRQFAALNDDRLH*
Ga0066188_10570781	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTSGVISETLRQFAPLNDDRLL*
Ga0066188_10836212	3300004626	Marine Gutless Worms Symbiont	MVNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0066188_10954471	3300004626	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDDHLL*
Ga0066188_11378412	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDALKLATPLTNGAISEMLRQFAPLNDDRLL*
Ga0066188_11410391	3300004626	Marine Gutless Worms Symbiont	MQFVHQMFSVSALLLDNALNGVINETQRQFAPFNDDRLL*
Ga0066188_11735732	3300004626	Marine Gutless Worms Symbiont	MFNVSTLLLDDALKPAMPLTNGAINEMLRQFAPLNDDRLLL*
Ga0066188_11954061	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDGLKPATPLTDGAINETLRQFGPFNLCPT*
Ga0066188_12197191	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINGTLRQFAPLNDDRLL*
Ga0066188_12432931	3300004626	Marine Gutless Worms Symbiont	MQSLHQMFNASALLLDDALKPATPLTNGAINETLRQFAPLSDDRLL*
Ga0066188_12637012	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDGLKPATPLTNGAINETLRQFVPFNDDRLL*
Ga0066188_13020761	3300004626	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPTPLTNGAINEALRQFAPLNDDRLL*
Ga0049105_10578174	3300004630	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLINEMLRQFAPLSDYRLLQLVD*
Ga0049105_10776113	3300004630	Marine Gutless Worms Symbiont	MFNVSALLLDDAVKPATPLTNGTIDETLRQFAPLSDDRLLQLVD*
Ga0049105_11600541	3300004630	Marine Gutless Worms Symbiont	MFNVSALLLDDTLKPATPPTNGAINKMLRQFVPLSDDRLLQLVD
Ga0071327_10177385	3300005170	Marine Gutless Worms Symbiont	MFNVSLLLLDDAVKPATPLTNGTIDETLRQFAPLSDDRLLQLVD*
Ga0071327_11240983	3300005170	Marine Gutless Worms Symbiont	SNCSHSAVFTLFNVSALLLDDTLKPAMPLNNRVINETLRQIAPLCDDTLEVWWDL*
Ga0056116_10212007	3300005649	Marine Gutless Worms Symbiont	MFNVFALLMDDALKPATPLTNGAINETLRQLAPLIDDHCVPGSV*
Ga0056135_101099623	3300005652	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLGQFSPLRDDRLLQLVDCRES*
Ga0056128_100024581	3300005967	Marine Gutless Worms Symbiont	MFNVSTLLLDDASKNATPLTNGTINQMLRQFAPLSENGFL*
Ga0056128_100114022	3300005967	Marine Gutless Worms Symbiont	MYALLLDDALKPATPLTNGAISETLQQFTPLSSQNSL*
Ga0056128_100151819	3300005967	Marine Gutless Worms Symbiont	VSALLLDDASKPAMPLTNGAINQTLQHFAPLSDNGFL*
Ga0056128_100306027	3300005967	Marine Gutless Worms Symbiont	MFNTSALLLDDALKPATPLNNGAISETLRQFAAFS*
Ga0056128_100377822	3300005967	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLTNSAINQTLQQFAPLS
Ga0056128_100396031	3300005967	Marine Gutless Worms Symbiont	MFDVSALLLDDTFKPATPLTNGAINQTLRQFVPLSDDRLLLLVDCR*
Ga0056128_10039929	3300005967	Marine Gutless Worms Symbiont	MLNVSALLLNDALKLATPLTNGAINQTLQRFAPLSASAV*
Ga0056128_10047675	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKAANGAINQTLRHFAPLSDNGFL*
Ga0056128_100502128	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPSTPLTNGAISQTLWQIAPLSDNHLLQLVD*
Ga0056128_100618726	3300005967	Marine Gutless Worms Symbiont	MFNVFALLVDDASKTPTPLTNGAINQTLWLQQSAPLSDDRLL*
Ga0056128_100750913	3300005967	Marine Gutless Worms Symbiont	MFNMSALLLDDALKPATPLNNGAISETLRQFAAFS*
Ga0056128_10084424	3300005967	Marine Gutless Worms Symbiont	MFNVFTLLLDDALKPATPLTNGAVNQTLRQFAPLSAQELS*
Ga0056128_10090216	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDTSKTATLLTNGVIHQTLRQFAPLSDNCLLQLVD*
Ga0056128_100946413	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLINGAINQTLWQFAPLSDNHLLQLVD*
Ga0056128_101050822	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDSHLLQLVD*
Ga0056128_101274316	3300005967	Marine Gutless Worms Symbiont	MCNVSALLLDDALKPATPLTNGAINQTLWQFAPLNDNGFL*
Ga0056128_101429017	3300005967	Marine Gutless Worms Symbiont	MFSVSALLLDDALKPATPLTYGAINQMLRQFAPLGAPELS*
Ga0056128_101465612	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDASKPATPLTNGAINQTLRHIAPLSDNGFLAG*
Ga0056128_10166633	3300005967	Marine Gutless Worms Symbiont	MFNVSVLLLHDASKLATPLTNGAINQTLRHFAALSDNGFF*
Ga0056128_10169608	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDNASKPATPLTNGAINQTLQHFAQLSDNGFL*
Ga0056128_10353266	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATLLTKGAINETLRQFAPLGAPELS*
Ga0056128_10363343	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNDAINQTLRQFASLSAPELS*
Ga0056128_10411602	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPPMINGAINETLRQLAPLS*
Ga0056128_10505461	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTATPLTNGAINQTLRHFAPLSDNGFF*
Ga0056128_10590221	3300005967	Marine Gutless Worms Symbiont	VSALLLDVASKPATPLTNEAINQTLRQFAPLSDNGFL*
Ga0056128_10621431	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNYLLQLVD*
Ga0056130_10257333	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPVTPLTNGAINETLRQFAPLNDDRLL*
Ga0056130_10384843	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETPRQFAPLNDECLL*
Ga0056130_10396592	3300005968	Marine Gutless Worms Symbiont	MQFLHKMFNVSALLLDDALKPATALTNGTINETLRQFAPLNDDRLL*
Ga0056130_10441254	3300005968	Marine Gutless Worms Symbiont	MQFLHRMFNVSALLLDDALKPATPQSNGAINETLRQFAPLNDDRLL*
Ga0056130_10486372	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLEHALKPATPLTNGAISETLRQFAPLNHLL*
Ga0056130_10525893	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKLATPLTNGAIIETLRQFAPLNDDRLL*
Ga0056130_10527954	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNMSALLLDDRLKPATPLNNGAINETLRQFAPLNDDRLL*
Ga0056130_10539731	3300005968	Marine Gutless Worms Symbiont	VSALLLDDALKLATPLTNGAINETLRQFVPLNDDRLL*
Ga0056130_10620672	3300005968	Marine Gutless Worms Symbiont	MQYLHLMFNVSTLLLDDALKPATPLTNGAINKTLRLFAPLNDDRLL*
Ga0056130_10629572	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGMINETLRQFAPFNDDRLL*
Ga0056130_10735912	3300005968	Marine Gutless Worms Symbiont	MQQMFNVSTMLLDDAIKPTTPLTNGAIDETLRQFAALNDDRLN*
Ga0056130_10832082	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVFDLLLDDALKPAMPLTSGAINETLQFDPLNDDRLL
Ga0056130_10872072	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDGLKPATPLTKSNGAINETLRQFAPLNDDRLP*
Ga0056130_11096443	3300005968	Marine Gutless Worms Symbiont	FLHQMFNVSALLLDDALKPATPMTNGAINEMLRQFAPLNDDRLLL*
Ga0056130_11123582	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFIVSALPLDDALKPAMPQTNGAINETLRQFDPPNDDRLL*
Ga0056130_11218921	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAISETLRQFATLNDDRLL*
Ga0056130_11305041	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056130_11311102	3300005968	Marine Gutless Worms Symbiont	MFNLSALLLDDALKPATPLTNGAINETLQQFSPLNDDRLL*
Ga0056130_11534691	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDTALKPATPLTNGAINETLRQFAQLGDDRLL*
Ga0056130_11714271	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPQTNGAINDTLRQFVPLNDDRLL*
Ga0056130_11802311	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAISETLEQFAPNQ*
Ga0056130_12006182	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPTTPLPNGAINETLRQFAPLNDDRLL*
Ga0056130_12133582	3300005968	Marine Gutless Worms Symbiont	MQFLQQMFNVSALLQDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056130_12865431	3300005968	Marine Gutless Worms Symbiont	LLDDALKPATPLTNGAINETLRQFAPLSDDRLLKAGRLS*
Ga0056130_13377252	3300005968	Marine Gutless Worms Symbiont	MQFLNLMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLLAG*
Ga0056129_10073236	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQF
Ga0056129_100829711	3300005978	Marine Gutless Worms Symbiont	MQFLNLMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056129_10287823	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLGDTLKPATTLTNGAINETLRQFAPLNDDRLL*
Ga0056129_10497354	3300005978	Marine Gutless Worms Symbiont	ALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056129_10534363	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDAFKPATPMPNGAINEMLQQFAPLNDDRLL*
Ga0056129_10573964	3300005978	Marine Gutless Worms Symbiont	QFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDCLR*
Ga0056129_10662564	3300005978	Marine Gutless Worms Symbiont	MLHQMFNVSALLLDDALKPATPLTNGAINETLRQFA
Ga0056129_10880113	3300005978	Marine Gutless Worms Symbiont	MQFSNLMFNMSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLLAG*
Ga0056129_11102473	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNDAINVKLRQFAALSDDRML*
Ga0056129_11203974	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSVLLLYDALKPATPLTNGAINETLRQFAPLND
Ga0056129_11445021	3300005978	Marine Gutless Worms Symbiont	MFNVSALLLEDALKPATPLTNVAINETLRQFAPLSDDRLL*
Ga0056129_11711321	3300005978	Marine Gutless Worms Symbiont	MQFLGLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056129_11848231	3300005978	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDDVKIA*
Ga0056129_12146351	3300005978	Marine Gutless Worms Symbiont	MQFLHQVFNVSTLLLDDALKPATPLTNGAINETLRQFAPLNDDRLLY
Ga0056129_12699281	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFDFAPLNDDRLL*
Ga0056129_12852572	3300005978	Marine Gutless Worms Symbiont	LDDALKPATPLTNGAINETLRQFAPLNDDRLLYLV*
Ga0056129_12859101	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAP
Ga0056114_10076681	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFIVSALLLDDALKLTTPLTNGAINETLRQFVPLNDDRL
Ga0056114_10129487	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLDDALKPAMPLTNGAINETLRQFAPLNDNRVL*
Ga0056114_10199584	3300006912	Marine Gutless Worms Symbiont	MRFLHRMFNVSALLLDDALKPATPQSNGAINETLRQFAPLNDDRLL*
Ga0056114_10216285	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLDDALKPATPLTNGAINETLRLFAPLNDDRLL*
Ga0056114_10360796	3300006912	Marine Gutless Worms Symbiont	MQFLHQLFNVSALLLDDALKPATNGAINETLRQFAPLNDDRLL*
Ga0056114_10400362	3300006912	Marine Gutless Worms Symbiont	MQFLHHIFNVTTLLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056114_10419531	3300006912	Marine Gutless Worms Symbiont	MSALLLDDGLKPATPLTNGAISETLRQFAPLNDDRLL*
Ga0056114_10433236	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLLQFAPLNDDRLL*
Ga0056114_10494434	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALEPASPLTNGAINETLRQFAPLNDDRLL*
Ga0056114_10542962	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKPATPMPNGAINEMLQQFAPLNDDRLL*
Ga0056114_10571327	3300006912	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDGLKPSTPLTNGAVNERCVFAPLNDDRLL*
Ga0056114_10654373	3300006912	Marine Gutless Worms Symbiont	MQFVHQMFNMSALLLDDALKPAMSLTNGAINETLRQFVPVNDDRLL*
Ga0056114_10685313	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDD*
Ga0056114_10770153	3300006912	Marine Gutless Worms Symbiont	MFNVSTLLLDDALKPATPLTNGAINETLRQFAPLNDDRLR*
Ga0056114_11022782	3300006912	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDGFKPATPLTNGAMNERCNCEFAPLNDDRLL*
Ga0056114_11200424	3300006912	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDD
Ga0056114_11206514	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPVTPLTNGAINETLRQFDPLNDDRLL*
Ga0056114_11392661	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDAHKLATPLTNGSINETLRQFAPLNDDRLL*
Ga0056114_11404603	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKLATPLTNGAIIEMLRQFAPLNDDRLL*
Ga0056114_11409362	3300006912	Marine Gutless Worms Symbiont	MMQFLHQMFNVSALLLDDALKPATPLTNGAINETL*
Ga0056114_11478862	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDASKLATPLTNGAMNETLRQFVPLNDDRLL*
Ga0056114_11518512	3300006912	Marine Gutless Worms Symbiont	MHYLHQMFNVSALLLDDALKLATPLTNGAISEMLRQFAPLNDDRLL*
Ga0056114_11522672	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDAIKPTTPLTNGAINETLRQFAALNDDRLH*
Ga0056114_11617542	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATTLANDAINEMLRQFAPFNDDRLL*
Ga0056114_11621791	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDD
Ga0056114_11844872	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLN
Ga0056114_12044072	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLEDVVKLATPLTNGNETLRQFALLNDDRLL*
Ga0056114_12373431	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAVNETLRQFAPLNDDHLL*
Ga0056114_12429012	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDD
Ga0056114_12560481	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAIIETLRQFAPLSDDRLL*
Ga0056114_12602751	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLDDGLKPATPLTTGAINETLRQFVPLNDDRLL*
Ga0056114_12838821	3300006912	Marine Gutless Worms Symbiont	MHFLHQVFNVSALLLDDALKPATPLTNSAIKETLRQFAPLSDDRLL*
Ga0056111_10226281	3300008214	Marine Gutless Worms Symbiont	MFNVFALLMDDALKPATPLTNGAINEKLMRQFAPLSDDRLLQLVDFVNRRC*
Ga0056108_11438981	3300008215	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPPATPLTNGAISETLGQFSPLSGDSR*
Ga0209367_100017731	3300027098	Marine Gutless Worms Symbiont	MFNVSTLLLDDASKNATPLTNGTINQMLRQFAPLSENGFL
Ga0209367_100027227	3300027098	Marine Gutless Worms Symbiont	MFNVPALLLDDASKTVTPLTSGAINQTLRQLAPLSDDRLLQLVDCCESN
Ga0209367_100035827	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKAANGAINQTLRHFAPLSDNGFL
Ga0209367_100115227	3300027098	Marine Gutless Worms Symbiont	MFNVSAVLLDDALKPATPLTNGAISQTLWQFAPLSGNHLLQLVD
Ga0209367_10014257	3300027098	Marine Gutless Worms Symbiont	MFNVFALLLDDALKPVTPLTNGTINQTLQQFAPLNDNLLL
Ga0209367_100178213	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTATPLTNGAINQTLRHFASLTDNGFL
Ga0209367_10019939	3300027098	Marine Gutless Worms Symbiont	MFNIFALLLDDASKTATPLTNGAVNQTPRQFAPLNDDRLL
Ga0209367_100210613	3300027098	Marine Gutless Worms Symbiont	MFNVFALLLDDARKPATPLTNGAISQKLRQFAPLSDNHLLQLVD
Ga0209367_100329714	3300027098	Marine Gutless Worms Symbiont	MFNMSALLLDDALKPSMPLTNGAINQTLRQFAPISDDRLLVDCH
Ga0209367_10040286	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLINGAINQTLWQFAPLSDNHLLQLVD
Ga0209367_10047901	3300027098	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLTNSAINQTLQQFAPLSAP
Ga0209367_10050199	3300027098	Marine Gutless Worms Symbiont	MLNVSALLLNDALKLATPLTNGAINQTLQRFAPLSASAV
Ga0209367_10052035	3300027098	Marine Gutless Worms Symbiont	VSALLLDDASKPAMPLTNGAINQTLQHFAPLSDNGFL
Ga0209367_10055086	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATLLTKGAINETLRQFAPLGAPELS
Ga0209367_100651812	3300027098	Marine Gutless Worms Symbiont	MFNVFTLLLDDALKPATPLTNGAVNQTLRQFAPLSAQELS
Ga0209367_10067379	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLEDALKPATPLTNGAINQTLRQFAPLGASAG
Ga0209367_10070577	3300027098	Marine Gutless Worms Symbiont	MFNMPVLLLDDASKAATPLTNGAISQTLRHFAPLSDNGFFLAN
Ga0209367_10075906	3300027098	Marine Gutless Worms Symbiont	MSALLLDDASKSATPLTSGAINQTLRQFAPLSDNGFFLAG
Ga0209367_10082641	3300027098	Marine Gutless Worms Symbiont	MYALLLDDALKPATPLTNGAISETLQQFTPLSSQNSL
Ga0209367_100851912	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPSTPLTNGAISQTLWQIAPLSDNHLLQLVD
Ga0209367_100887512	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTSGAISQTLWQFAPLSDNHLLQLVN
Ga0209367_101063112	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDALKSATPLTIGAISQTLWKFAPLSENHLLQLVD
Ga0209367_10126994	3300027098	Marine Gutless Worms Symbiont	MFNMSALLLDDTSKMAMPLTNGTINQTLWQFAPLSDDHLLQLTVVNHQH
Ga0209367_10137023	3300027098	Marine Gutless Worms Symbiont	MCNVSALLLDDALKPATPLTNGAINQTLWQFAPLNDNGFL
Ga0209367_10155816	3300027098	Marine Gutless Worms Symbiont	MFSVSALLLDDALKPATPLTYGAINQMLRQFAPLGAPELS
Ga0209367_10158056	3300027098	Marine Gutless Worms Symbiont	MFYVSALLLDDASKTATPLSNGAINQTLRQFAPLSDDRLL
Ga0209367_10161106	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDASKPATPLTNGAINQTLRHIAPLSDNGFLAG
Ga0209367_10174143	3300027098	Marine Gutless Worms Symbiont	MVNVSALLLKDALKTATPLTNGAINQTLWQFSPLIDDRLL
Ga0209367_10178116	3300027098	Marine Gutless Worms Symbiont	MFNVSVLLLHDASKLATPLTNGAINQTLRHFAALSDNGFF
Ga0209367_10178583	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDNASKPATPLTNGAINQTLQHFAQLSDNGFL
Ga0209367_10184202	3300027098	Marine Gutless Worms Symbiont	MFSVSALLLDDAFKPSTPLTNGAINQTLQQFAPLSAPELS
Ga0209367_10191402	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNHLLQLVD
Ga0209367_10236511	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLNDAPKPATPLTNGAISQTLRQFAPLSDNSFL
Ga0209367_10238135	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDSHLLQLVD
Ga0209367_10264864	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNATPLTNSAINQMLRHFAPLSDNRFLQLVDCRE
Ga0209367_10309682	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPPMINGAINETLRQLAPLS
Ga0209367_10358662	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNDAINQTLRQFASLSAPELS
Ga0209454_10004213	3300027118	Marine Gutless Worms Symbiont	MFNVSAVLLDDALKPATPLTNGAISQTLWRFAPLSGNHLLQLVD
Ga0209454_10007306	3300027118	Marine Gutless Worms Symbiont	MFDVSALLLDDTFKPATPLTNGAINQTLRQFVPLSDDRLLLLVDCR
Ga0209454_10022201	3300027118	Marine Gutless Worms Symbiont	MFNVSALLLDGTSKTATLLTNGGINQTLRQFAPLSDSRLLQLVDCRESST
Ga0209454_10190864	3300027118	Marine Gutless Worms Symbiont	MFNVAALLLDDAPKPATPLTNGAISQPLWQFVPLSDNHLLQLVD
Ga0209454_10268022	3300027118	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPMTNGAISQTLWQFAQLSDSHLLQLVD
Ga0209454_10297846	3300027118	Marine Gutless Worms Symbiont	VSALLLDDALKPATPLTNGAINQTLQQFAPVSAPQLS
Ga0209454_10298991	3300027118	Marine Gutless Worms Symbiont	MSALLLDDASKSATPLTGGAINQTLRQFAPLSDNGFFLAG
Ga0209454_10421942	3300027118	Marine Gutless Worms Symbiont	VSALLLDDASKPATPLTNGAINQTLRHFAPLGDNGFL
Ga0209454_10795232	3300027118	Marine Gutless Worms Symbiont	MSALLLDDTLKPATPLTNGAINQTLQQFAPLSAPELS
Ga0209454_11355061	3300027118	Marine Gutless Worms Symbiont	FSHQIFNVSALLLDDASKPATPLTNGAINQTLRYVAPLIDNGFL
Ga0209146_10118994	3300027175	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPTTPLTNGAICQTLWQFAQLSDNHLLQLVD
Ga0209146_11090851	3300027175	Marine Gutless Worms Symbiont	VSALLLDDALKPATPLTNGAINQTLRQFAPLGAPE
Ga0209146_11218911	3300027175	Marine Gutless Worms Symbiont	MFNVSGLLLDDALKHMTPLTSGAINQTLRQFAPLSDDRLLQLADCRKCRR
Ga0209146_11783441	3300027175	Marine Gutless Worms Symbiont	SALLLDDAPKPATPLTNGAISQTLWQFAPLSDNHLLQLVD
Ga0209146_12134961	3300027175	Marine Gutless Worms Symbiont	NHISQFPHQMFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNHLLQLVD
Ga0209671_10011076	3300027208	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTAMPLTNGAINQTLRQFAPLSDDRLLQLADCRESSK
Ga0209671_10121386	3300027208	Marine Gutless Worms Symbiont	MFNVFALLLDDALKPVTPLTNGTINQTLRQFAPLNDNLLL
Ga0209671_10187491	3300027208	Marine Gutless Worms Symbiont	MSALPLDVALKPTTPLNNGAISETLRQFAAFSWSQNSL
Ga0209671_10276395	3300027208	Marine Gutless Worms Symbiont	MSALLLDDTSKMAMPLTNGTINQTLWQFAPLSDDHLLQLTVVNHQH
Ga0209671_10449034	3300027208	Marine Gutless Worms Symbiont	VSALLLDDASKAATPLTNGAINQALRHFAPLSDNGLF
Ga0209671_10573503	3300027208	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLTNSAINQTLRQFAPLSAPELS
Ga0209671_10672611	3300027208	Marine Gutless Worms Symbiont	MFNAFALLLDDASKIATLLTNGAINQTLRQFAPLSDSRLLQLVDCRESSTVID
Ga0209671_10785811	3300027208	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNYLLQLVD
Ga0209671_10882921	3300027208	Marine Gutless Worms Symbiont	MFNVSGLLLDDTPKPATPLTNSAINQTLGQFVSLSDCDNRLLQLVD
Ga0209671_10997821	3300027208	Marine Gutless Worms Symbiont	FNVSALLLDDASKPATPLTNGAINQTLRHFAPLSDNGFL
Ga0209787_10025852	3300027289	Marine Gutless Worms Symbiont	MQYLHLMFNVSTLLLDDALKPATPLTNGAINKTLRLFAPLNDDRLL
Ga0209787_10212191	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFIVSALLLDDALKLATPLTNGAINETLRQFVPLNDDRLL
Ga0209787_10232141	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNMSALLLDDRLKPATPLNNGAINETLRQFAPLNDDRLL
Ga0209787_10521501	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDTALKPATPLTNGAINETLRQFAQLGDDRLL
Ga0209787_10744691	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVFDLLLDDALKPAMPLTSGAINETLXQFDPLNDDRLL
Ga0209787_10886481	3300027289	Marine Gutless Worms Symbiont	CHIMQFLHQMFNVSALLLDDALKPVTPLTNGAINETLRQFAPLNDDRLL
Ga0209787_10965882	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAISETLRQFATLNDDRLL
Ga0209787_11041981	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLDDTLKSAIPLTNGAINETLRQFAQI
Ga0209787_11121411	3300027289	Marine Gutless Worms Symbiont	MQQMFNVSTMLLDDAIKPTTPLTNGAIDETLRQFAALNDDRLN
Ga0209787_11290532	3300027289	Marine Gutless Worms Symbiont	MQFLHKMFNVSALLLDDALKPATALTNGTINETLRQFAPLNDDRLL
Ga0209787_11354202	3300027289	Marine Gutless Worms Symbiont	MFNLSALLLDDALKPATPLTNGAINETLQQFSPLNDDRLL
Ga0209787_11362233	3300027289	Marine Gutless Worms Symbiont	MQILRQMFNVSALLLDDALKPATPLTNGAINETLRQFVPLNDDRLL
Ga0209787_11369281	3300027289	Marine Gutless Worms Symbiont	VQFLRQMFNVSALLLDDALKPATPLTNGVISETLRQFTPLNDDRLL
Ga0209787_11525921	3300027289	Marine Gutless Worms Symbiont	SALPLDDALKPAMPQTNGAINETLRQFDPPNDDRLL
Ga0209787_11635561	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLGDSLKPATPLINGAINETLRQFAPLNDDRLL
Ga0209787_12198701	3300027289	Marine Gutless Worms Symbiont	MQFLNLMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209787_12345511	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGYNNETLRQFAPLNDDRLL
Ga0209787_12721501	3300027289	Marine Gutless Worms Symbiont	MQFSHQMFNVSALLLDDALKPATPQTNGAINDTLRQFVPLNDDRLL
Ga0209569_11904101	3300027331	Marine Gutless Worms Symbiont	VFNVSAFVLNDALKPATPLTNGAINETLRQLLGHPVY
Ga0209366_10045193	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDDTFNPATPLTNGVISEALQQLATLSDISQ
Ga0209366_10101153	3300027347	Marine Gutless Worms Symbiont	MFNLSALLLDSAFKLVTPLTNGVISEILQQFAPLSD
Ga0209366_10265512	3300027347	Marine Gutless Worms Symbiont	MFNMSALLLDDALKPAMPLTNGVINETLRQFASLSDTQ
Ga0209366_10637601	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDNALEPETPLTSGVINETLRQFAPASN
Ga0209366_10776902	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDYAFKPATPLTNRGVINETLQQFTPLSDISQG
Ga0209366_11001251	3300027347	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKPATPLTNGIINEMLQQFAPLSDIHKVV
Ga0209366_11236881	3300027347	Marine Gutless Worms Symbiont	VFSVLHQMFNVSALLLDDALKPATPLTNETLQQFSPLSDILQ
Ga0209366_11339921	3300027347	Marine Gutless Worms Symbiont	MSNVSTLLLDDEFKPATSLTNGVISETLRQFVPLSDSSQGS
Ga0209366_11441171	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDDAFKPATPLTNGVINETLLQFAATQ
Ga0209366_11485561	3300027347	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKPAMPLSNGAINEMLRQFAQLS
Ga0209366_12006421	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDDAFKPATPLTNGVISETLRQFASLSDILQG
Ga0209363_10044338	3300027377	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPMTNGAINEMLRQFAPLSDDRLLLIVVNR
Ga0209680_10039714	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209680_10077335	3300027392	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATALTNGTINETLRQFAPLNDDRLL
Ga0209680_10088264	3300027392	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPVTPLTNGAINETLRQFAPLNDDRLL
Ga0209680_10088862	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPQTNGAINDTLRQFVPLNDDRLL
Ga0209680_10237883	3300027392	Marine Gutless Worms Symbiont	IMQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209680_10273703	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGMINETLRQFAPFNDDRLL
Ga0209680_10302542	3300027392	Marine Gutless Worms Symbiont	MFNVSALLPDDALKPATPLTNDAINETLRQFAPFNDDRLL
Ga0209680_10599682	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPMTNGAINEMLRQFAPLNDDRLLL
Ga0209680_10773441	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAISETLEQFAPNQXRSPAL
Ga0209680_11315671	3300027392	Marine Gutless Worms Symbiont	MQFLHQMVNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209680_11421101	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLEDALKPATPLTNVAINETLRQFAPLSDDRLL
Ga0209680_11452001	3300027392	Marine Gutless Worms Symbiont	MQFSNLMFNMSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLLAG
Ga0209680_11799182	3300027392	Marine Gutless Worms Symbiont	MQFLGLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209680_11866302	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDDVKIA
Ga0209680_11996301	3300027392	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLEHALKPATPLTNGAISETLRQFAPLNHLL
Ga0209680_12096701	3300027392	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDDRLLKAGRLS
Ga0209680_12374811	3300027392	Marine Gutless Worms Symbiont	MLHQMFNVSALLLDDALKPATPLTNGAINETLRQFASLND
Ga0209680_12779011	3300027392	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLEDVVKLATPLTNGNETLRQFALLNNDRLL
Ga0209782_10063491	3300027398	Marine Gutless Worms Symbiont	MFNLSALLLDSAFKLVTPLTNGVISEILQQFAPLSDIHKVWWDL
Ga0209782_10083672	3300027398	Marine Gutless Worms Symbiont	MFIVSTLLLDDAFKPATPLTNGVINVTLQQFAPLSVSK
Ga0209782_10089642	3300027398	Marine Gutless Worms Symbiont	MFSVSALLLDDALKPATPLTNGMISETLRKFASLSDISQGNTLEVWWDH
Ga0209782_10108621	3300027398	Marine Gutless Worms Symbiont	VSTLLLDDAFKPVTPLTNGAMSETLRQFAPLSDISQGS
Ga0209782_10143943	3300027398	Marine Gutless Worms Symbiont	MFNAFALLLDDAFKPATPLTNGVINETLRQFASLNNISKGSVV
Ga0209049_11096341	3300027404	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRLFTRWY
Ga0209562_10011638	3300027519	Marine Gutless Worms Symbiont	MQFLHQMFNMSALLLDDALKPATPLTNSAINETLRQFALPLSDDTLEVWWDLL
Ga0209562_10035944	3300027519	Marine Gutless Worms Symbiont	MFNLSALLLDDALKPATPLTNGAINETLRQFAPLSDDTLEMWWDL
Ga0209562_10044242	3300027519	Marine Gutless Worms Symbiont	MQFLHLMFNASALLRDDQLKPVTPLTNGAIDETLQQFAALSDDCLL
Ga0209562_10119833	3300027519	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAISETLQQFALLSDDTQDLF
Ga0209562_10145242	3300027519	Marine Gutless Worms Symbiont	LSQLLSKVTVILQFLHQMFNVSALLLDDALKPVTPLTNGAINESLRQFAPLSDDTLEARWAL
Ga0209562_10274263	3300027519	Marine Gutless Worms Symbiont	MFNVSALLLDDALKLATPLANVAINETLQQFAPLSDDTLEVWWDL
Ga0209562_10287291	3300027519	Marine Gutless Worms Symbiont	MFSVSALLLDDALKPATPLTNGAINETLRQFAPLSDDTLEV
Ga0209562_10299415	3300027519	Marine Gutless Worms Symbiont	MFNMPALLREDPLKPATPLTNDAINETLRQFAPLSDDTLEVWWYL
Ga0209562_10325312	3300027519	Marine Gutless Worms Symbiont	MFNVSVLLLDDPLKPATPLTNGGISETLQQFAPLNDDTLEVWWDL
Ga0209562_10393101	3300027519	Marine Gutless Worms Symbiont	MLQFLHQMFDVSALLLDDALKPATPLTNGVINEMLPQFALLSENTLEV
Ga0209562_10423681	3300027519	Marine Gutless Worms Symbiont	MFNLFALLRDDPLKPATPLTNGAIDETLQQFAPLGD
Ga0209562_10465913	3300027519	Marine Gutless Worms Symbiont	MQFLHQMFSVSALLLDDALKPVTPLTNGAINETLRQFAPLSDDTLEVWWDL
Ga0209562_10490422	3300027519	Marine Gutless Worms Symbiont	MFNVPALLLDDTLKLATTLINGAINETLRQFAPLSDDTLEV
Ga0209562_10552721	3300027519	Marine Gutless Worms Symbiont	MFNMSTLLLDDALKPSTPLTNGAISEKLRQFAQLS
Ga0209562_10571272	3300027519	Marine Gutless Worms Symbiont	MFSVSTLLLDEALKPVTPLTNGAINETLREFAPLSDDTLEVWWNL
Ga0209562_10596342	3300027519	Marine Gutless Worms Symbiont	MLNVSVLLLDDTLKPATPLTNGTINETLRQFAPLSDDTLEVWWDLQ
Ga0209562_10613393	3300027519	Marine Gutless Worms Symbiont	MFYLSVSALLLDDALKPATPLTNGVFNETLRQFAPLSDDTREVWWDL
Ga0209562_10669062	3300027519	Marine Gutless Worms Symbiont	MFNASALLLDYALKPATPLTNGAINETLRQFAPLSDDTLEVWWNL
Ga0209562_10684811	3300027519	Marine Gutless Worms Symbiont	MFNLIALLQDDPLKPVTPLTNGTIDETLQQFASLSDDCLL
Ga0209562_10794712	3300027519	Marine Gutless Worms Symbiont	MFNVSTLLLDDALKPATPLTNGAINETLRQFAPLSHDTPEV
Ga0209562_10826583	3300027519	Marine Gutless Worms Symbiont	LLDDALKPATPLTNGAINETLRQFAPLSDDTLKVLRDL
Ga0209562_10894652	3300027519	Marine Gutless Worms Symbiont	MLHFLHLMFNLFALLRDDPLKPVTPLTNGTIDEMLQQFTALSDDCLLQLV
Ga0209562_10944841	3300027519	Marine Gutless Worms Symbiont	MFNLFALLRDDPFKPATPLTNGTINETLQEFAPLSDNCLFQLVDCRE
Ga0209562_11119012	3300027519	Marine Gutless Worms Symbiont	MFNVSALLQDDALKPATPLTNGAINETQRQFAPLSDDTLEVW
Ga0209562_11401401	3300027519	Marine Gutless Worms Symbiont	MFNLFLLRDDLLKPATPLTNGAIDEMLQQFVPLSDDFPASAG
Ga0209562_12119611	3300027519	Marine Gutless Worms Symbiont	MLQFLHQMFNVSALLLDDALKPVTPLTNGAINETLRQFAPLSDDTLEVWWHP
Ga0209562_12328721	3300027519	Marine Gutless Worms Symbiont	FNVSALLLDDALKPATPLTNGAISETLRQFAPLSDNTFEV
Ga0209562_12477991	3300027519	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKPATPVTNGVINETLRQFAPLSDDTLEVWWDL
Ga0209562_12564402	3300027519	Marine Gutless Worms Symbiont	MFNVPALLRDDPLKPAMPMTNGMINEKLRQFASLNDDRMLRSAG
Ga0209562_12590911	3300027519	Marine Gutless Worms Symbiont	MFNLFALRRDDPLKPVTLLTNGAIDETLQQFAPLSDDCHALAG
Ga0209562_12797521	3300027519	Marine Gutless Worms Symbiont	MFNLFALLRDDALKQATPLTNGAIDETLQWFAQLSD
Ga0209568_10125033	3300027544	Marine Gutless Worms Symbiont	MFNVFALLMDDALKPATPLTNGAINETLRQLAPLIDDHCVPGSV
Ga0209255_10008195	3300027550	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLINEMLRQFAPLSDYRLLQLVD
Ga0209255_10139411	3300027550	Marine Gutless Worms Symbiont	MLQFLHQMFNVSVLHALKPATPLTIGAINVTLRQFVPLSDDTLEMWWDL
Ga0209255_12163382	3300027550	Marine Gutless Worms Symbiont	MFNVSALLLDDAVKPATPLTNGAINEMLRQFAPLSDDRLLQLVD
Ga0209679_12537092	3300027557	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLIDDRLLQLVDCRESS
Ga0209364_11000351	3300027569	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFAPLSDDRLLQLVDCRE
Ga0209364_11313372	3300027569	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFVPLSDNRLLQLIDCRESF
Ga0209364_11882831	3300027569	Marine Gutless Worms Symbiont	MFNVSALPLDDALKPTTPLTNGAINETLRQFAPLSDDRLLQL
Ga0209781_11504993	3300027602	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAVNETLRQFAPLSDDRLLQL
Ga0209781_11531111	3300027602	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFSPLSNFI
Ga0209781_11664612	3300027602	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFSPISDDRLLQLVDCRE
Ga0209781_12423351	3300027602	Marine Gutless Worms Symbiont	MFMSALLLDDALKPTTPLTNGGINEMLRQFSPLSDVTIACFS
Ga0209259_10133463	3300027658	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLGQFSPLRDDRLLQLVDCRES

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F005944

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated	Open in IMG/M
3300003748	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2	Host-Associated	Open in IMG/M
3300003769	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.2	Host-Associated	Open in IMG/M
3300003776	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1	Host-Associated	Open in IMG/M
3300003786	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2	Host-Associated	Open in IMG/M
3300003843	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.1	Host-Associated	Open in IMG/M
3300003904	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.2	Host-Associated	Open in IMG/M
3300003905	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.1	Host-Associated	Open in IMG/M
3300003906	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2	Host-Associated	Open in IMG/M
3300003944	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND	Host-Associated	Open in IMG/M
3300004085	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.1	Host-Associated	Open in IMG/M
3300004094	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.1	Host-Associated	Open in IMG/M
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated	Open in IMG/M
3300004630	Worm MetaG Olavius vacuus BAHAMAS.1	Host-Associated	Open in IMG/M
3300005170	Worm MetaG Olavius vacuus BAHAMAS.1 (version 1)	Host-Associated	Open in IMG/M
3300005649	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2	Host-Associated	Open in IMG/M
3300005652	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1	Host-Associated	Open in IMG/M
3300005967	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2	Host-Associated	Open in IMG/M
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated	Open in IMG/M
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated	Open in IMG/M
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated	Open in IMG/M
3300008214	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius longissimus B BELIZE.2	Host-Associated	Open in IMG/M
3300008215	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1 BERMUDA.1	Host-Associated	Open in IMG/M
3300027098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027118	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027175	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND (SPAdes)	Host-Associated	Open in IMG/M
3300027208	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027331	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BAHAMAS.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027347	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027377	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.3 (SPAdes)	Host-Associated	Open in IMG/M
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027398	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027404	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027519	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027544	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027550	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027557	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes)	Host-Associated	Open in IMG/M
3300027569	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027602	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027658	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign