Basic Information | |
---|---|
Family ID | F006053 |
Family Type | Metagenome |
Number of Sequences | 382 |
Average Sequence Length | 43 residues |
Representative Sequence | MKVKKLIMKLNKAEIEHNLEKAKKLWFKLLKKSLKHKHTEAVK |
Number of Associated Samples | 171 |
Number of Associated Scaffolds | 382 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 62.43 % |
% of genes near scaffold ends (potentially truncated) | 22.51 % |
% of genes from short scaffolds (< 2000 bps) | 63.09 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (40.838 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (47.382 % of family members) |
Environment Ontology (ENVO) | Unclassified (90.052 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (93.717 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 382 Family Scaffolds |
---|---|---|
PF00149 | Metallophos | 12.83 |
PF12705 | PDDEXK_1 | 6.02 |
PF01592 | NifU_N | 5.24 |
PF02627 | CMD | 4.71 |
PF12850 | Metallophos_2 | 4.19 |
PF07486 | Hydrolase_2 | 3.93 |
PF01223 | Endonuclease_NS | 2.88 |
PF01521 | Fe-S_biosyn | 2.88 |
PF13186 | SPASM | 2.62 |
PF13439 | Glyco_transf_4 | 2.09 |
PF08443 | RimK | 1.31 |
PF09825 | BPL_N | 1.05 |
PF05118 | Asp_Arg_Hydrox | 1.05 |
PF13609 | Porin_4 | 0.79 |
PF00583 | Acetyltransf_1 | 0.79 |
PF05226 | CHASE2 | 0.79 |
PF00578 | AhpC-TSA | 0.79 |
PF13759 | 2OG-FeII_Oxy_5 | 0.79 |
PF05050 | Methyltransf_21 | 0.79 |
PF04773 | FecR | 0.79 |
PF00182 | Glyco_hydro_19 | 0.79 |
PF05488 | PAAR_motif | 0.79 |
PF02915 | Rubrerythrin | 0.79 |
PF12708 | Pectate_lyase_3 | 0.79 |
PF00196 | GerE | 0.52 |
PF00534 | Glycos_transf_1 | 0.52 |
PF00301 | Rubredoxin | 0.52 |
PF07012 | Curlin_rpt | 0.52 |
PF03819 | MazG | 0.52 |
PF00691 | OmpA | 0.52 |
PF00574 | CLP_protease | 0.52 |
PF03401 | TctC | 0.26 |
PF04965 | GPW_gp25 | 0.26 |
PF01541 | GIY-YIG | 0.26 |
PF02562 | PhoH | 0.26 |
PF06941 | NT5C | 0.26 |
PF01126 | Heme_oxygenase | 0.26 |
PF00501 | AMP-binding | 0.26 |
PF04851 | ResIII | 0.26 |
PF13392 | HNH_3 | 0.26 |
PF01242 | PTPS | 0.26 |
PF16473 | Rv2179c-like | 0.26 |
PF07460 | NUMOD3 | 0.26 |
PF00011 | HSP20 | 0.26 |
PF00117 | GATase | 0.26 |
PF00211 | Guanylate_cyc | 0.26 |
PF00589 | Phage_integrase | 0.26 |
PF11160 | Hva1_TUDOR | 0.26 |
PF02777 | Sod_Fe_C | 0.26 |
PF01075 | Glyco_transf_9 | 0.26 |
PF00004 | AAA | 0.26 |
PF12849 | PBP_like_2 | 0.26 |
PF03120 | DNA_ligase_OB | 0.26 |
PF03783 | CsgG | 0.26 |
PF11246 | Phage_gp53 | 0.26 |
PF10118 | Metal_hydrol | 0.26 |
PF00487 | FA_desaturase | 0.26 |
PF02617 | ClpS | 0.26 |
PF12322 | T4_baseplate | 0.26 |
PF03851 | UvdE | 0.26 |
PF08804 | gp32 | 0.26 |
PF01527 | HTH_Tnp_1 | 0.26 |
PF01389 | OmpA_membrane | 0.26 |
PF00745 | GlutR_dimer | 0.26 |
COG ID | Name | Functional Category | % Frequency in 382 Family Scaffolds |
---|---|---|---|
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 5.24 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 4.71 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 4.71 |
COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 3.93 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 2.88 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 2.88 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 2.88 |
COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 1.05 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.05 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.05 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.79 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.79 |
COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.79 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.79 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG2885 | Outer membrane protein OmpA and related peptidoglycan-associated (lipo)proteins | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.26 |
COG3230 | Heme oxygenase | Inorganic ion transport and metabolism [P] | 0.26 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.26 |
COG3637 | Opacity protein LomR and related surface antigens | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.26 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.26 |
COG5398 | Heme oxygenase | Coenzyme transport and metabolism [H] | 0.26 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.26 |
COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.26 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.26 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.26 |
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.26 |
COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.26 |
COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.26 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.16 % |
Unclassified | root | N/A | 40.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000162|TB03JUN2009H_c024475 | Not Available | 653 | Open in IMG/M |
3300000176|TB03JUN2009E_c001536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5804 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1003223 | Not Available | 10960 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1033947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2076 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1041822 | Not Available | 1750 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1059704 | Not Available | 1281 | Open in IMG/M |
3300000553|TBL_comb47_HYPODRAFT_10053219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2432 | Open in IMG/M |
3300001847|RCM41_1008175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6240 | Open in IMG/M |
3300001848|RCM47_1016769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7303 | Open in IMG/M |
3300001851|RCM31_10428157 | Not Available | 694 | Open in IMG/M |
3300002092|JGI24218J26658_1004993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2744 | Open in IMG/M |
3300002092|JGI24218J26658_1038707 | Not Available | 556 | Open in IMG/M |
3300002098|JGI24219J26650_1001963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5641 | Open in IMG/M |
3300002307|JGI24890J29729_1011811 | All Organisms → Viruses → Predicted Viral | 2373 | Open in IMG/M |
3300002933|G310J44882_10063441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 804 | Open in IMG/M |
3300002933|G310J44882_10121083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300003277|JGI25908J49247_10084515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 778 | Open in IMG/M |
3300003375|JGI26470J50227_1001059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10182 | Open in IMG/M |
3300003375|JGI26470J50227_1004031 | Not Available | 4329 | Open in IMG/M |
3300003375|JGI26470J50227_1005048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3729 | Open in IMG/M |
3300003375|JGI26470J50227_1005739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3420 | Open in IMG/M |
3300003375|JGI26470J50227_1011314 | All Organisms → Viruses → Predicted Viral | 2206 | Open in IMG/M |
3300003375|JGI26470J50227_1013464 | All Organisms → Viruses → Predicted Viral | 1961 | Open in IMG/M |
3300003375|JGI26470J50227_1016059 | All Organisms → Viruses → Predicted Viral | 1737 | Open in IMG/M |
3300003375|JGI26470J50227_1018293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1582 | Open in IMG/M |
3300003375|JGI26470J50227_1021622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1400 | Open in IMG/M |
3300003375|JGI26470J50227_1022945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1339 | Open in IMG/M |
3300003375|JGI26470J50227_1042980 | Not Available | 827 | Open in IMG/M |
3300003783|Ga0007850_1014130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300003787|Ga0007811_1010660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis → Advenella kashmirensis WT001 | 875 | Open in IMG/M |
3300003787|Ga0007811_1010968 | Not Available | 859 | Open in IMG/M |
3300003787|Ga0007811_1017187 | Not Available | 640 | Open in IMG/M |
3300003789|Ga0007835_1017083 | Not Available | 604 | Open in IMG/M |
3300003796|Ga0007865_1000886 | All Organisms → Viruses → Predicted Viral | 4610 | Open in IMG/M |
3300003797|Ga0007846_1004783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
3300003798|Ga0007842_1000121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7161 | Open in IMG/M |
3300003798|Ga0007842_1002136 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
3300003804|Ga0007817_1002666 | Not Available | 1399 | Open in IMG/M |
3300003804|Ga0007817_1005888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
3300003806|Ga0007864_1006180 | Not Available | 994 | Open in IMG/M |
3300003806|Ga0007864_1012813 | Not Available | 633 | Open in IMG/M |
3300003809|Ga0007869_1014716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 727 | Open in IMG/M |
3300003812|Ga0007861_1011230 | Not Available | 812 | Open in IMG/M |
3300003813|Ga0007879_1015017 | Not Available | 832 | Open in IMG/M |
3300003815|Ga0007856_1015126 | Not Available | 502 | Open in IMG/M |
3300003820|Ga0007863_1000981 | All Organisms → cellular organisms → Bacteria | 3953 | Open in IMG/M |
3300003820|Ga0007863_1002901 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
3300003823|Ga0007875_1026010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 645 | Open in IMG/M |
3300004054|Ga0063232_10166702 | Not Available | 647 | Open in IMG/M |
3300004095|Ga0007829_10019174 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
3300004095|Ga0007829_10057501 | Not Available | 757 | Open in IMG/M |
3300004095|Ga0007829_10065969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300004095|Ga0007829_10066561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Oxalobacter → unclassified Oxalobacter → Oxalobacter sp. | 706 | Open in IMG/M |
3300004448|Ga0065861_1149484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1014 | Open in IMG/M |
3300004461|Ga0066223_1190837 | Not Available | 533 | Open in IMG/M |
3300004684|Ga0065168_1007610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1706 | Open in IMG/M |
3300004684|Ga0065168_1033473 | Not Available | 810 | Open in IMG/M |
3300004684|Ga0065168_1071038 | Not Available | 548 | Open in IMG/M |
3300004685|Ga0065177_1000190 | Not Available | 9963 | Open in IMG/M |
3300004685|Ga0065177_1005236 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2378 | Open in IMG/M |
3300004685|Ga0065177_1024017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
3300004685|Ga0065177_1063347 | Not Available | 690 | Open in IMG/M |
3300004686|Ga0065173_1000889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5516 | Open in IMG/M |
3300004686|Ga0065173_1000962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5275 | Open in IMG/M |
3300004686|Ga0065173_1001407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4478 | Open in IMG/M |
3300004686|Ga0065173_1003709 | All Organisms → Viruses → Predicted Viral | 2838 | Open in IMG/M |
3300004686|Ga0065173_1007911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1972 | Open in IMG/M |
3300004686|Ga0065173_1014993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 1425 | Open in IMG/M |
3300004686|Ga0065173_1052028 | Not Available | 742 | Open in IMG/M |
3300004686|Ga0065173_1057830 | Not Available | 701 | Open in IMG/M |
3300004687|Ga0065174_1047272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 814 | Open in IMG/M |
3300004692|Ga0065171_1000435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6750 | Open in IMG/M |
3300004692|Ga0065171_1026320 | Not Available | 938 | Open in IMG/M |
3300004692|Ga0065171_1031736 | Not Available | 850 | Open in IMG/M |
3300004770|Ga0007804_1005259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4091 | Open in IMG/M |
3300004772|Ga0007791_10184746 | Not Available | 599 | Open in IMG/M |
3300004774|Ga0007794_10040241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
3300004774|Ga0007794_10098753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
3300004805|Ga0007792_10025042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Oxalobacter → unclassified Oxalobacter → Oxalobacter sp. | 1811 | Open in IMG/M |
3300004805|Ga0007792_10279226 | Not Available | 513 | Open in IMG/M |
3300004806|Ga0007854_10255804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300004807|Ga0007809_10115585 | Not Available | 808 | Open in IMG/M |
3300004807|Ga0007809_10227717 | Not Available | 533 | Open in IMG/M |
3300006071|Ga0007876_1002464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5902 | Open in IMG/M |
3300006071|Ga0007876_1004231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4380 | Open in IMG/M |
3300006071|Ga0007876_1009262 | All Organisms → Viruses → Predicted Viral | 2856 | Open in IMG/M |
3300006071|Ga0007876_1009672 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
3300006071|Ga0007876_1014985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2213 | Open in IMG/M |
3300006071|Ga0007876_1020345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1869 | Open in IMG/M |
3300006071|Ga0007876_1050232 | Not Available | 1130 | Open in IMG/M |
3300006071|Ga0007876_1054738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1075 | Open in IMG/M |
3300006071|Ga0007876_1085092 | Not Available | 827 | Open in IMG/M |
3300006071|Ga0007876_1179784 | Not Available | 518 | Open in IMG/M |
3300006100|Ga0007806_1000909 | Not Available | 9438 | Open in IMG/M |
3300006100|Ga0007806_1013344 | All Organisms → Viruses → Predicted Viral | 1848 | Open in IMG/M |
3300006100|Ga0007806_1039702 | Not Available | 922 | Open in IMG/M |
3300006101|Ga0007810_1053821 | Not Available | 827 | Open in IMG/M |
3300006103|Ga0007813_1089548 | Not Available | 597 | Open in IMG/M |
3300006103|Ga0007813_1111214 | Not Available | 522 | Open in IMG/M |
3300006105|Ga0007819_1009553 | All Organisms → Viruses → Predicted Viral | 2513 | Open in IMG/M |
3300006105|Ga0007819_1115130 | Not Available | 525 | Open in IMG/M |
3300006105|Ga0007819_1120527 | Not Available | 510 | Open in IMG/M |
3300006108|Ga0007862_1038795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1003 | Open in IMG/M |
3300006109|Ga0007870_1095754 | Not Available | 578 | Open in IMG/M |
3300006110|Ga0007871_1012199 | All Organisms → Viruses → Predicted Viral | 1739 | Open in IMG/M |
3300006110|Ga0007871_1039486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300006112|Ga0007857_1035769 | Not Available | 992 | Open in IMG/M |
3300006113|Ga0007858_1005212 | Not Available | 3324 | Open in IMG/M |
3300006113|Ga0007858_1048192 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300006114|Ga0007815_1008875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2522 | Open in IMG/M |
3300006114|Ga0007815_1028581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
3300006115|Ga0007816_1006054 | Not Available | 3047 | Open in IMG/M |
3300006115|Ga0007816_1017638 | All Organisms → Viruses → Predicted Viral | 1676 | Open in IMG/M |
3300006115|Ga0007816_1075283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300006116|Ga0007807_1068007 | Not Available | 678 | Open in IMG/M |
3300006117|Ga0007818_1000893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7783 | Open in IMG/M |
3300006118|Ga0007859_1082365 | Not Available | 649 | Open in IMG/M |
3300006119|Ga0007866_1030424 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
3300006119|Ga0007866_1030716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis → Advenella kashmirensis WT001 | 1068 | Open in IMG/M |
3300006119|Ga0007866_1080944 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300006120|Ga0007867_1006302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2953 | Open in IMG/M |
3300006120|Ga0007867_1139199 | Not Available | 521 | Open in IMG/M |
3300006127|Ga0007805_1033639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
3300006127|Ga0007805_1049433 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300006127|Ga0007805_1099903 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300006127|Ga0007805_1131632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300006128|Ga0007828_1002418 | All Organisms → cellular organisms → Bacteria | 4215 | Open in IMG/M |
3300006162|Ga0075030_100000590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31820 | Open in IMG/M |
3300007603|Ga0102921_1345288 | Not Available | 529 | Open in IMG/M |
3300009068|Ga0114973_10034402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3053 | Open in IMG/M |
3300009068|Ga0114973_10332616 | Not Available | 805 | Open in IMG/M |
3300009151|Ga0114962_10000493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34989 | Open in IMG/M |
3300009151|Ga0114962_10001786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18360 | Open in IMG/M |
3300009151|Ga0114962_10003586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12538 | Open in IMG/M |
3300009151|Ga0114962_10012637 | Not Available | 6172 | Open in IMG/M |
3300009151|Ga0114962_10041205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 3097 | Open in IMG/M |
3300009151|Ga0114962_10174400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1275 | Open in IMG/M |
3300009151|Ga0114962_10298975 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300009151|Ga0114962_10358425 | Not Available | 798 | Open in IMG/M |
3300009151|Ga0114962_10430410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
3300009151|Ga0114962_10505385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 638 | Open in IMG/M |
3300009152|Ga0114980_10442813 | Not Available | 743 | Open in IMG/M |
3300009154|Ga0114963_10060119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2400 | Open in IMG/M |
3300009154|Ga0114963_10088399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1908 | Open in IMG/M |
3300009154|Ga0114963_10148892 | All Organisms → Viruses → Predicted Viral | 1391 | Open in IMG/M |
3300009154|Ga0114963_10162541 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300009154|Ga0114963_10755236 | Not Available | 501 | Open in IMG/M |
3300009155|Ga0114968_10257380 | Not Available | 989 | Open in IMG/M |
3300009158|Ga0114977_10324912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 871 | Open in IMG/M |
3300009159|Ga0114978_10006860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9018 | Open in IMG/M |
3300009159|Ga0114978_10008175 | Not Available | 8219 | Open in IMG/M |
3300009159|Ga0114978_10064540 | Not Available | 2479 | Open in IMG/M |
3300009159|Ga0114978_10191681 | Not Available | 1296 | Open in IMG/M |
3300009159|Ga0114978_10465174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 747 | Open in IMG/M |
3300009159|Ga0114978_10672172 | Not Available | 593 | Open in IMG/M |
3300009182|Ga0114959_10050259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2423 | Open in IMG/M |
3300009182|Ga0114959_10052876 | Not Available | 2347 | Open in IMG/M |
3300009182|Ga0114959_10055230 | All Organisms → Viruses → Predicted Viral | 2286 | Open in IMG/M |
3300009182|Ga0114959_10521784 | Not Available | 572 | Open in IMG/M |
3300009182|Ga0114959_10636586 | Not Available | 508 | Open in IMG/M |
3300009184|Ga0114976_10033933 | Not Available | 3059 | Open in IMG/M |
3300009184|Ga0114976_10041921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2724 | Open in IMG/M |
3300009184|Ga0114976_10058756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2250 | Open in IMG/M |
3300009184|Ga0114976_10380710 | Not Available | 741 | Open in IMG/M |
3300009502|Ga0114951_10104124 | Not Available | 1611 | Open in IMG/M |
3300009684|Ga0114958_10153353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1166 | Open in IMG/M |
3300010157|Ga0114964_10111747 | Not Available | 1349 | Open in IMG/M |
3300010157|Ga0114964_10355159 | Not Available | 693 | Open in IMG/M |
3300010158|Ga0114960_10094770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1672 | Open in IMG/M |
3300010334|Ga0136644_10311729 | Not Available | 910 | Open in IMG/M |
3300010354|Ga0129333_10060421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3535 | Open in IMG/M |
3300010370|Ga0129336_10702643 | Not Available | 535 | Open in IMG/M |
3300010885|Ga0133913_10086502 | Not Available | 8405 | Open in IMG/M |
3300010885|Ga0133913_10234506 | All Organisms → cellular organisms → Bacteria | 4878 | Open in IMG/M |
3300010885|Ga0133913_11356256 | Not Available | 1812 | Open in IMG/M |
3300010885|Ga0133913_12311462 | Not Available | 1320 | Open in IMG/M |
3300010885|Ga0133913_13168766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
3300011010|Ga0139557_1001828 | Not Available | 4841 | Open in IMG/M |
3300013093|Ga0164296_1001534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24296 | Open in IMG/M |
3300013093|Ga0164296_1001900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21519 | Open in IMG/M |
3300013093|Ga0164296_1002943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16463 | Open in IMG/M |
3300013093|Ga0164296_1007663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8800 | Open in IMG/M |
3300013093|Ga0164296_1008614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8074 | Open in IMG/M |
3300013093|Ga0164296_1011431 | Not Available | 6561 | Open in IMG/M |
3300013093|Ga0164296_1015324 | All Organisms → cellular organisms → Bacteria | 5254 | Open in IMG/M |
3300013093|Ga0164296_1021817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3939 | Open in IMG/M |
3300013093|Ga0164296_1095914 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
3300013093|Ga0164296_1198358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300013094|Ga0164297_10085772 | Not Available | 1371 | Open in IMG/M |
3300013286|Ga0136641_1113770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300013295|Ga0170791_11322477 | Not Available | 554 | Open in IMG/M |
3300017766|Ga0181343_1123070 | Not Available | 729 | Open in IMG/M |
3300017785|Ga0181355_1145389 | Not Available | 959 | Open in IMG/M |
3300019093|Ga0187843_10163834 | Not Available | 959 | Open in IMG/M |
3300019784|Ga0181359_1046434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1678 | Open in IMG/M |
3300019784|Ga0181359_1253353 | Not Available | 532 | Open in IMG/M |
3300020705|Ga0214177_1001357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4756 | Open in IMG/M |
3300020707|Ga0214238_1016098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300020710|Ga0214198_1023995 | Not Available | 753 | Open in IMG/M |
3300020716|Ga0214207_1023750 | Not Available | 723 | Open in IMG/M |
3300020718|Ga0214178_1004882 | All Organisms → cellular organisms → Bacteria → PVC group → Kiritimatiellota → Tichowtungiia → Tichowtungiales → Tichowtungiaceae → Tichowtungia → Tichowtungia aerotolerans | 2288 | Open in IMG/M |
3300020718|Ga0214178_1031853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300020726|Ga0214220_1036046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 663 | Open in IMG/M |
3300020727|Ga0214246_1003341 | All Organisms → Viruses → Predicted Viral | 3510 | Open in IMG/M |
3300020727|Ga0214246_1005026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2729 | Open in IMG/M |
3300020731|Ga0214170_1001655 | Not Available | 6084 | Open in IMG/M |
3300020731|Ga0214170_1001829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5736 | Open in IMG/M |
3300020731|Ga0214170_1002749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4417 | Open in IMG/M |
3300020733|Ga0214172_1006145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 2625 | Open in IMG/M |
3300020733|Ga0214172_1030143 | Not Available | 826 | Open in IMG/M |
3300020733|Ga0214172_1053483 | Not Available | 563 | Open in IMG/M |
3300020733|Ga0214172_1058301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300021131|Ga0214206_1018919 | Not Available | 862 | Open in IMG/M |
3300021133|Ga0214175_1008384 | All Organisms → Viruses → Predicted Viral | 1557 | Open in IMG/M |
3300021136|Ga0214167_1109913 | Not Available | 500 | Open in IMG/M |
3300021138|Ga0214164_1001140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15657 | Open in IMG/M |
3300021138|Ga0214164_1007359 | All Organisms → cellular organisms → Bacteria | 4238 | Open in IMG/M |
3300021138|Ga0214164_1028250 | Not Available | 1445 | Open in IMG/M |
3300021138|Ga0214164_1044655 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
3300021142|Ga0214192_1007147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4875 | Open in IMG/M |
3300021142|Ga0214192_1009662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3978 | Open in IMG/M |
3300021142|Ga0214192_1026179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2012 | Open in IMG/M |
3300021142|Ga0214192_1099359 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300021142|Ga0214192_1181729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 516 | Open in IMG/M |
3300021354|Ga0194047_10083162 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
3300021519|Ga0194048_10122205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300021519|Ga0194048_10207965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
3300021519|Ga0194048_10316696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae | 560 | Open in IMG/M |
3300021602|Ga0194060_10254349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 882 | Open in IMG/M |
3300022555|Ga0212088_10146233 | Not Available | 2009 | Open in IMG/M |
3300022555|Ga0212088_10714889 | Not Available | 594 | Open in IMG/M |
3300022555|Ga0212088_10860282 | Not Available | 514 | Open in IMG/M |
3300022602|Ga0248169_100241 | Not Available | 90668 | Open in IMG/M |
3300022602|Ga0248169_100732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 50066 | Open in IMG/M |
3300022602|Ga0248169_100850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 45597 | Open in IMG/M |
3300022602|Ga0248169_101079 | Not Available | 40132 | Open in IMG/M |
3300022602|Ga0248169_102585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22175 | Open in IMG/M |
3300022602|Ga0248169_110997 | Not Available | 6968 | Open in IMG/M |
3300022602|Ga0248169_113502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5830 | Open in IMG/M |
3300022602|Ga0248169_124444 | All Organisms → cellular organisms → Bacteria | 3473 | Open in IMG/M |
3300022602|Ga0248169_130697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2863 | Open in IMG/M |
3300022602|Ga0248169_134246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2607 | Open in IMG/M |
3300023174|Ga0214921_10000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 349716 | Open in IMG/M |
3300023174|Ga0214921_10068659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2912 | Open in IMG/M |
3300023174|Ga0214921_10312988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300023174|Ga0214921_10388865 | Not Available | 719 | Open in IMG/M |
3300025162|Ga0209083_1249626 | Not Available | 645 | Open in IMG/M |
3300025336|Ga0208619_111273 | Not Available | 654 | Open in IMG/M |
3300025357|Ga0208383_1000003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae | 146113 | Open in IMG/M |
3300025357|Ga0208383_1000394 | All Organisms → Viruses | 8092 | Open in IMG/M |
3300025357|Ga0208383_1000955 | All Organisms → cellular organisms → Bacteria | 4800 | Open in IMG/M |
3300025357|Ga0208383_1002943 | Not Available | 2452 | Open in IMG/M |
3300025358|Ga0208504_1001251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5272 | Open in IMG/M |
3300025358|Ga0208504_1003620 | Not Available | 2593 | Open in IMG/M |
3300025358|Ga0208504_1006604 | Not Available | 1787 | Open in IMG/M |
3300025358|Ga0208504_1010548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1339 | Open in IMG/M |
3300025358|Ga0208504_1013677 | Not Available | 1147 | Open in IMG/M |
3300025368|Ga0208620_1016685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300025369|Ga0208382_1011363 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
3300025369|Ga0208382_1034233 | Not Available | 623 | Open in IMG/M |
3300025369|Ga0208382_1043692 | All Organisms → cellular organisms → Eukaryota | 520 | Open in IMG/M |
3300025372|Ga0207957_1003235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2878 | Open in IMG/M |
3300025372|Ga0207957_1029317 | Not Available | 623 | Open in IMG/M |
3300025372|Ga0207957_1033886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
3300025379|Ga0208738_1000010 | Not Available | 62892 | Open in IMG/M |
3300025379|Ga0208738_1006455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2130 | Open in IMG/M |
3300025379|Ga0208738_1009343 | Not Available | 1718 | Open in IMG/M |
3300025379|Ga0208738_1020511 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
3300025379|Ga0208738_1025956 | Not Available | 910 | Open in IMG/M |
3300025379|Ga0208738_1059416 | All Organisms → cellular organisms → Eukaryota | 537 | Open in IMG/M |
3300025381|Ga0208871_1006949 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
3300025382|Ga0208256_1014936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 1196 | Open in IMG/M |
3300025383|Ga0208250_1001319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6252 | Open in IMG/M |
3300025383|Ga0208250_1011019 | Not Available | 1680 | Open in IMG/M |
3300025383|Ga0208250_1011066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1676 | Open in IMG/M |
3300025383|Ga0208250_1026630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300025383|Ga0208250_1064851 | Not Available | 509 | Open in IMG/M |
3300025391|Ga0208740_1000067 | Not Available | 41401 | Open in IMG/M |
3300025395|Ga0208109_1030222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 764 | Open in IMG/M |
3300025395|Ga0208109_1048976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis → Advenella kashmirensis WT001 | 575 | Open in IMG/M |
3300025396|Ga0208874_1027328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis → Advenella kashmirensis WT001 | 880 | Open in IMG/M |
3300025396|Ga0208874_1036417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 726 | Open in IMG/M |
3300025396|Ga0208874_1036574 | Not Available | 724 | Open in IMG/M |
3300025399|Ga0208107_1003534 | All Organisms → Viruses → Predicted Viral | 2273 | Open in IMG/M |
3300025402|Ga0208876_1027841 | Not Available | 922 | Open in IMG/M |
3300025407|Ga0208378_1047574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
3300025407|Ga0208378_1062239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 589 | Open in IMG/M |
3300025410|Ga0208875_1010065 | All Organisms → Viruses → Predicted Viral | 1726 | Open in IMG/M |
3300025410|Ga0208875_1015104 | All Organisms → Viruses → Predicted Viral | 1355 | Open in IMG/M |
3300025410|Ga0208875_1019296 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
3300025410|Ga0208875_1056222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 612 | Open in IMG/M |
3300025413|Ga0208614_1001036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7679 | Open in IMG/M |
3300025413|Ga0208614_1067484 | Not Available | 517 | Open in IMG/M |
3300025415|Ga0208868_1011604 | Not Available | 1353 | Open in IMG/M |
3300025418|Ga0208253_1015187 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
3300025418|Ga0208253_1023173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1224 | Open in IMG/M |
3300025418|Ga0208253_1070610 | Not Available | 556 | Open in IMG/M |
3300025423|Ga0208746_1040794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis → Advenella kashmirensis WT001 | 757 | Open in IMG/M |
3300025424|Ga0208617_1084394 | Not Available | 520 | Open in IMG/M |
3300025426|Ga0208739_1000256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17246 | Open in IMG/M |
3300025426|Ga0208739_1002180 | Not Available | 4699 | Open in IMG/M |
3300025426|Ga0208739_1012144 | All Organisms → Viruses → Predicted Viral | 1636 | Open in IMG/M |
3300025437|Ga0208742_1027827 | Not Available | 965 | Open in IMG/M |
3300025450|Ga0208744_1012310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1896 | Open in IMG/M |
3300025450|Ga0208744_1012421 | Not Available | 1885 | Open in IMG/M |
3300025450|Ga0208744_1037577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300025450|Ga0208744_1101522 | Not Available | 545 | Open in IMG/M |
3300025466|Ga0208497_1001575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8563 | Open in IMG/M |
3300025467|Ga0208260_1026786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
3300025467|Ga0208260_1108880 | Not Available | 540 | Open in IMG/M |
3300025578|Ga0208864_1152238 | Not Available | 509 | Open in IMG/M |
3300025648|Ga0208507_1012648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3421 | Open in IMG/M |
3300025723|Ga0208741_10011214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2393 | Open in IMG/M |
3300025723|Ga0208741_10031556 | Not Available | 1250 | Open in IMG/M |
3300025723|Ga0208741_10081603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 731 | Open in IMG/M |
3300025778|Ga0208388_1058967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis → Advenella kashmirensis WT001 | 533 | Open in IMG/M |
3300025781|Ga0208386_1001558 | All Organisms → Viruses | 5382 | Open in IMG/M |
3300025781|Ga0208386_1002712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3724 | Open in IMG/M |
3300025781|Ga0208386_1039919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae | 653 | Open in IMG/M |
3300025785|Ga0208498_1039169 | Not Available | 712 | Open in IMG/M |
3300027708|Ga0209188_1000023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 168414 | Open in IMG/M |
3300027708|Ga0209188_1000048 | Not Available | 138459 | Open in IMG/M |
3300027708|Ga0209188_1000869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26644 | Open in IMG/M |
3300027708|Ga0209188_1006526 | Not Available | 7244 | Open in IMG/M |
3300027708|Ga0209188_1008763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5928 | Open in IMG/M |
3300027708|Ga0209188_1009262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5707 | Open in IMG/M |
3300027708|Ga0209188_1027811 | Not Available | 2751 | Open in IMG/M |
3300027708|Ga0209188_1031159 | All Organisms → Viruses | 2548 | Open in IMG/M |
3300027708|Ga0209188_1031956 | Not Available | 2507 | Open in IMG/M |
3300027708|Ga0209188_1052611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1800 | Open in IMG/M |
3300027708|Ga0209188_1058569 | Not Available | 1676 | Open in IMG/M |
3300027708|Ga0209188_1225306 | Not Available | 661 | Open in IMG/M |
3300027708|Ga0209188_1299865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300027708|Ga0209188_1328908 | Not Available | 500 | Open in IMG/M |
3300027712|Ga0209499_1264556 | Not Available | 591 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1282474 | Not Available | 602 | Open in IMG/M |
3300027734|Ga0209087_1006460 | Not Available | 6221 | Open in IMG/M |
3300027734|Ga0209087_1099101 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
3300027734|Ga0209087_1220645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 716 | Open in IMG/M |
3300027736|Ga0209190_1341163 | Not Available | 557 | Open in IMG/M |
3300027741|Ga0209085_1017259 | All Organisms → Viruses | 3511 | Open in IMG/M |
3300027741|Ga0209085_1041899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2141 | Open in IMG/M |
3300027741|Ga0209085_1325602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 577 | Open in IMG/M |
3300027741|Ga0209085_1376109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300027749|Ga0209084_1002680 | Not Available | 13602 | Open in IMG/M |
3300027759|Ga0209296_1184515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 907 | Open in IMG/M |
3300027759|Ga0209296_1377283 | Not Available | 538 | Open in IMG/M |
3300027763|Ga0209088_10216042 | Not Available | 813 | Open in IMG/M |
3300027763|Ga0209088_10291485 | Not Available | 664 | Open in IMG/M |
3300027782|Ga0209500_10024337 | Not Available | 3483 | Open in IMG/M |
3300027782|Ga0209500_10358400 | Not Available | 599 | Open in IMG/M |
3300027896|Ga0209777_10096244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2534 | Open in IMG/M |
3300027896|Ga0209777_10382165 | Not Available | 1064 | Open in IMG/M |
3300027896|Ga0209777_10497360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300027911|Ga0209698_10001293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28889 | Open in IMG/M |
3300027963|Ga0209400_1001850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16531 | Open in IMG/M |
3300027969|Ga0209191_1000049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 94723 | Open in IMG/M |
3300028392|Ga0304729_1202622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300028392|Ga0304729_1235905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300028393|Ga0304728_1040884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1973 | Open in IMG/M |
3300028393|Ga0304728_1192426 | Not Available | 713 | Open in IMG/M |
3300029798|Ga0239581_1018752 | Not Available | 1883 | Open in IMG/M |
3300031759|Ga0316219_1018739 | Not Available | 3412 | Open in IMG/M |
3300031759|Ga0316219_1257973 | Not Available | 608 | Open in IMG/M |
3300031884|Ga0316220_1136066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 897 | Open in IMG/M |
3300031884|Ga0316220_1186946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → beta proteobacterium MWH-P2sevCIIIb | 725 | Open in IMG/M |
3300031884|Ga0316220_1256697 | Not Available | 584 | Open in IMG/M |
3300031884|Ga0316220_1296186 | Not Available | 529 | Open in IMG/M |
3300032116|Ga0315903_10726151 | Not Available | 738 | Open in IMG/M |
3300032117|Ga0316218_1034620 | Not Available | 2292 | Open in IMG/M |
3300032117|Ga0316218_1080848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1308 | Open in IMG/M |
3300032117|Ga0316218_1083493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1280 | Open in IMG/M |
3300032562|Ga0316226_1056968 | Not Available | 1992 | Open in IMG/M |
3300032605|Ga0316232_1113009 | Not Available | 1197 | Open in IMG/M |
3300032668|Ga0316230_1024846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3014 | Open in IMG/M |
3300032676|Ga0316229_1187255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 815 | Open in IMG/M |
3300032753|Ga0316224_1168673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300034106|Ga0335036_0006772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9634 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 47.38% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 21.47% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.59% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.07% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 6.02% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.57% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.31% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.05% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.79% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.79% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater | 0.52% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.52% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.52% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.52% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.26% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.26% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.26% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
3300003789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 | Environmental | Open in IMG/M |
3300003796 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 | Environmental | Open in IMG/M |
3300003797 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 | Environmental | Open in IMG/M |
3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
3300003804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 | Environmental | Open in IMG/M |
3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
3300003809 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 | Environmental | Open in IMG/M |
3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
3300003815 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 | Environmental | Open in IMG/M |
3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
3300003823 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 | Environmental | Open in IMG/M |
3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
3300004687 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2) | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
3300006108 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 | Environmental | Open in IMG/M |
3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
3300006110 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 | Environmental | Open in IMG/M |
3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
3300006117 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 | Environmental | Open in IMG/M |
3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
3300006127 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 | Environmental | Open in IMG/M |
3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020705 | Freshwater microbial communities from Trout Bog Lake, WI - 27AUG2007 epilimnion | Environmental | Open in IMG/M |
3300020707 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnion | Environmental | Open in IMG/M |
3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
3300020716 | Freshwater microbial communities from Trout Bog Lake, WI - 13JUL2009 epilimnion | Environmental | Open in IMG/M |
3300020718 | Freshwater microbial communities from Trout Bog Lake, WI - 17SEP2007 epilimnion | Environmental | Open in IMG/M |
3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
3300020733 | Freshwater microbial communities from Trout Bog Lake, WI - 12JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
3300021136 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 hypolimnion | Environmental | Open in IMG/M |
3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300021142 | Freshwater microbial communities from Trout Bog Lake, WI - 29JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300025162 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes) | Environmental | Open in IMG/M |
3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025368 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025369 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025381 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025391 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025395 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025399 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025402 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025407 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025415 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025418 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025424 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 (SPAdes) | Environmental | Open in IMG/M |
3300025426 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025450 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
3300025648 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes) | Environmental | Open in IMG/M |
3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025781 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300029798 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11 | Environmental | Open in IMG/M |
3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB03JUN2009H_0244752 | 3300000162 | Freshwater | MKVKKLVQKLNRAELQHNLEKAKKFWMKLLKKSLKGKHTESVR* |
TB03JUN2009E_0015363 | 3300000176 | Freshwater | MKIKKLIEKLNKAELEHNIEKCKKLWLKAIKKSLKHKHTEPIQ* |
TBL_comb48_EPIDRAFT_100322317 | 3300000439 | Freshwater | MKVKKLIMKLNKAEIEHNLEKAKKLWFKLLKKSLKHKHTEAVK* |
TBL_comb48_EPIDRAFT_10339474 | 3300000439 | Freshwater | MKVKELIKKLYKAELEHDIPLVKKLWYKLLKKSLKGKHTEAVK* |
TBL_comb48_EPIDRAFT_10418223 | 3300000439 | Freshwater | MKVKKLIMKLNKAELEHNLKKAKELWFKLLKKSIKGKHTEAVR* |
TBL_comb48_EPIDRAFT_10597042 | 3300000439 | Freshwater | MKLKKLITKLNRAEFEHNLSKAKKLWFKILKKSVKHKHTEAVR* |
TBL_comb47_HYPODRAFT_100532193 | 3300000553 | Freshwater | MKIKKLIFKLNKAEFEHKLQKAKKLWLKILKKSFKGKHTEAVR* |
RCM41_100817514 | 3300001847 | Marine Plankton | MKTRKLIQKLNRAELQHNLNKVKDIWFKLLKKSFKHKPTHSVK* |
RCM47_101676912 | 3300001848 | Marine Plankton | MKTRKLIQKLNRAELQHNLNKAKDLWFKILKKSFKHKDTHSVK* |
RCM31_104281573 | 3300001851 | Marine Plankton | MKVKKLIFKLNKAEVEHNVEKLKKLWRKALKKSLKHKHTEPIQ* |
JGI24218J26658_10049937 | 3300002092 | Lentic | MKTRKLILKLNRAEIRHNLDKAKKFWFKLLKKSIKH |
JGI24218J26658_10387071 | 3300002092 | Lentic | MKIKKLIMKLNRAEFEHKLDKVKKLWFKILKKSVKHKHTEAVR* |
JGI24219J26650_10019637 | 3300002098 | Lentic | MLQYYYKGEVMKVKKLILKLNRAELDHNMDLAKKFWFKLLKKSLKHKHTEAVK* |
JGI24890J29729_10118111 | 3300002307 | Lentic | MKVKKLILKLNKAEIQHNLEKAKKLWFKILKKSLHHKHTETVV* |
G310J44882_100634412 | 3300002933 | Freshwater | MKLKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKGKHTESVR* |
G310J44882_101210831 | 3300002933 | Freshwater | MKVKELVKRLYKAEIEHDMPLVKKLWYKLLKKSLKHKHTEA |
JGI25908J49247_100845152 | 3300003277 | Freshwater Lake | MKVKELIKMLNVAEIKHNTPLIKKLWFKLLKKSLKHKHTEAVK* |
JGI26470J50227_10010594 | 3300003375 | Freshwater | MKTKKLILKLNRAEVRHNLDKAKKFWFKLLKKSLKHKHTEVVQ* |
JGI26470J50227_10040314 | 3300003375 | Freshwater | MKTRKLILKLNRAEMRHNTIKAKKFWFKLLKKSLKHKHTEVVQ* |
JGI26470J50227_10050486 | 3300003375 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILRKSVKHKHTEAVR* |
JGI26470J50227_10057392 | 3300003375 | Freshwater | MKLKKLILKLNRAEFEHNLKKAKELWFKILKKSLKHKHTEAVR* |
JGI26470J50227_10113142 | 3300003375 | Freshwater | MKIKKLIMKLNRAEFEHNLEKAKKLWFKILKKSVKHKHTEAVR* |
JGI26470J50227_10134643 | 3300003375 | Freshwater | MKIKKLIMKLNRAEFEHKLDKVKKLWFKILKKSVRHKHTEAVR* |
JGI26470J50227_10160593 | 3300003375 | Freshwater | MKLKKLIFKLNRAEFEHNLDKVKKLWFKILKKSVKHKHTEAVR* |
JGI26470J50227_10182934 | 3300003375 | Freshwater | MKVKKLIFKLNRAEIEHNMEQAKKLWFKLLKKSLKHKHTEAVK* |
JGI26470J50227_10216224 | 3300003375 | Freshwater | MKIKKLIEKLNKAELEHNLEKCKKLWLKAIKKSLKHKHTEPIQ* |
JGI26470J50227_10229454 | 3300003375 | Freshwater | MKTRKLILKLNRAEIRHDLVKAKKIWFKLLKKSFKHKHTEVVQ* |
JGI26470J50227_10429802 | 3300003375 | Freshwater | MKVQKLIKKLNRAEVEHNLERVKKLWFRLLKKSLKHKNTGSAQ* |
Ga0007850_10141301 | 3300003783 | Freshwater | MKVEKLVRKLYKAEIEHNLDKVKKFWFKLLKKSLKHKHTEAVK* |
Ga0007811_10106601 | 3300003787 | Freshwater | MKVKKLIMKLNRAELDHNMEKARKFWFKLLKKSLKHKHTEAVK* |
Ga0007811_10109682 | 3300003787 | Freshwater | MKVKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTESVR* |
Ga0007811_10171872 | 3300003787 | Freshwater | MLHFDYKEESIMKVKKLVMKLYKAEIEHNLEKAKKIWFKLLKKSLDHKHTEAVK* |
Ga0007835_10166772 | 3300003789 | Freshwater | NNINTFQEGNTMKVKKLILKLNKAEMQHKLAKAKKFWFKLLKKSFKHKHTEAVR* |
Ga0007835_10170833 | 3300003789 | Freshwater | MKIKKLIMKLNRAEFEHNLEKAKKLWFKILKKSVKHKHTEAVR |
Ga0007865_10008862 | 3300003796 | Freshwater | MKVKKLIQKLNRAXFEHNLEKAKKFWMKLLKKSVKGKHTESVR* |
Ga0007846_10047831 | 3300003797 | Freshwater | MKVKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTEAVR* |
Ga0007842_10001215 | 3300003798 | Freshwater | MKVKKLIMKLNKAEFEHNLEKVKKLWFKLLKKSLDGKHTEAVK* |
Ga0007842_10021362 | 3300003798 | Freshwater | MKIQKLVTKLNKAEIEHNLEKVKKIWFKILKKSLNHKHTEKVQ* |
Ga0007817_10026662 | 3300003804 | Freshwater | MKVKKLIMKLNKAEFEHNLKKAKELWFKILKKSIKHKHTAAVR* |
Ga0007817_10058881 | 3300003804 | Freshwater | MKTRKLILKLNRAEIRHDLVKAKKIWFKLLKKSIKHKHTEVVQ* |
Ga0007864_10061802 | 3300003806 | Freshwater | MKVKKLILKLNKAEVQHKPVKAKILWLKLLKKSLKHKHTESVR* |
Ga0007864_10128131 | 3300003806 | Freshwater | MKIKKLILKLNRAEFEHNLDKVKXXWFKILKKSFKHKHTEAVR* |
Ga0007869_10147162 | 3300003809 | Freshwater | MKIKKLILKLNRAEFEHNLEKAKKLWFKILKKSLKHKHTESVR* |
Ga0007861_10112303 | 3300003812 | Freshwater | MKVKKLIMKLNKAEFEHNLKKAKELWFKLLKKSIKHKHTAAVR* |
Ga0007879_10150171 | 3300003813 | Freshwater | NMLHFDYKEESIMKVKKLVMKLYKAEIEHNLEKAKKIWFKLLKKSLDHKHTEAVK* |
Ga0007856_10151262 | 3300003815 | Freshwater | MKVKKLVQKLNRAEFQHNLDKAKKLWMKLLKKSFKGKHTESVR* |
Ga0007863_10009813 | 3300003820 | Freshwater | MKIKKLILKLNRAEFEHNLDKVKKLWFKILKKSFKHKHTEAVR* |
Ga0007863_10029011 | 3300003820 | Freshwater | IGTKSMKVKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTEAVR* |
Ga0007875_10260102 | 3300003823 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILKXSIKHKHTESVR* |
Ga0063232_101667021 | 3300004054 | Freshwater Lake | TMKVKELIKMLNVAEIKHNTPLIKKLWFKLLKKSLKHKHTEAVK* |
Ga0007829_100191742 | 3300004095 | Freshwater | MKVKKLIMKLNRAEFEHRLDKVKKLWFKILKKSVKHKHTESVR* |
Ga0007829_100575011 | 3300004095 | Freshwater | MKTKKLILKLNKAEVEHNIKKAKDLWFKLLKKSLKHKHTEAVK* |
Ga0007829_100659692 | 3300004095 | Freshwater | MKIKKLIMKLNRAEFEHKLDKVKKLWFKILKKSMKHKHTEAVR* |
Ga0007829_100665612 | 3300004095 | Freshwater | MKVKKLIMKLNKAEFEHNLKKAKVLWFKILKKSIKHKHTEAVR* |
Ga0065861_11494841 | 3300004448 | Marine | MKVKKLILKLNRAELEHNLDQAKKFWLKLLKKSLKHKHTQAVK |
Ga0066223_11908372 | 3300004461 | Marine | MKTKKLILKLNRAELKHNLVKAKVLWLKLLKKSFKGKHTETVK* |
Ga0065168_10076102 | 3300004684 | Freshwater | MKIKKLIMKLNRAEFEHRLDKVKKLWFKILKKSVKHKHTESVR* |
Ga0065168_10334731 | 3300004684 | Freshwater | MKVKKLIMKLNKAELQHNMEKVKKFWLKLLKKSLEGKDTHAVK* |
Ga0065168_10710381 | 3300004684 | Freshwater | FTLEEFAMKLKKLILKLNRAEFEHNLKKAKELWFKILKKSLKHKHTEAVR* |
Ga0065177_10001906 | 3300004685 | Freshwater | MKVKKLIAKLYRAEIEHNMAQAKKFWLKLLKKSLKGKHTEAVK* |
Ga0065177_10052364 | 3300004685 | Freshwater | MKVKKLILKLNKAEIQHNLKKAKEIWLKILKKSIKHKHTQAVQ* |
Ga0065177_10240173 | 3300004685 | Freshwater | MKLDKLIRKLNRAEFDHNMEKVKKFWFKILKKSIKHKHTEAVR* |
Ga0065177_10633472 | 3300004685 | Freshwater | MKVKKLIMKLNKAELQHNMEKAKKFWLKLLKKSLEGKDTHAVK* |
Ga0065173_10008895 | 3300004686 | Freshwater | MKTKKLILKLNRAEMQHKLDKAKKFWFKLLKKSFKHKHTEVVQ* |
Ga0065173_10009621 | 3300004686 | Freshwater | MKIKKLIQKLNRAEFEHNLEKAKKFWLKLLKKSVKGKHTEAVR* |
Ga0065173_10014073 | 3300004686 | Freshwater | MKVKKLIRRLNIAEVEHNLAKVKKLWFKVLKKSLKRKHTEKIQ* |
Ga0065173_10037092 | 3300004686 | Freshwater | MKVKKLILKLNKAEMQHKLAKAKKFWFKLLKKSFKHKHTEAVR* |
Ga0065173_10079112 | 3300004686 | Freshwater | MKVEKLVHKLYKAEIEHNLNKVKKFWFKLLKKSLKHKHTQAVK* |
Ga0065173_10149932 | 3300004686 | Freshwater | MKIEKLVRKLNRAEIEHNINKVKTLWFKILKKSLKHKHTERVQ* |
Ga0065173_10520281 | 3300004686 | Freshwater | MDRHGTSTKMKVKKLIQKLNKAEFEHNLEKVKKFWFKLLKKSFKGKHTQSVK* |
Ga0065173_10578302 | 3300004686 | Freshwater | MKTKKLIAKLYSAEIAHNMEKAKKFWFKLLKKSLKGKHTEAVK* |
Ga0065174_10472722 | 3300004687 | Freshwater | MKVKKLIMKLNRAEFEHNLEKVKKLWFKLLKKSIKHKHTEAVR* |
Ga0065171_10004357 | 3300004692 | Freshwater | MKTKKLILKLNKAEVEHNLKKVKELWFKLLKKSLKHKHTESVR* |
Ga0065171_10263202 | 3300004692 | Freshwater | MKVKKLIMKLNRAEVEHNFEKAKKFWLKLLKKSLKHKHTEAVK* |
Ga0065171_10317361 | 3300004692 | Freshwater | MKIEKLVFKLNKAEIEHNLEKVKKIWFKILKKSLKHKHTEKAQ* |
Ga0007804_10052596 | 3300004770 | Freshwater | MKVKKLVIKLNRAELEHNLVKAKALWLKLLKKSFKGKHTEAVK* |
Ga0007791_101847461 | 3300004772 | Freshwater | MKVKKLILKLNRAEVQHNLDKVKELWLKLLKKSLKHKHTEAVR* |
Ga0007794_100402412 | 3300004774 | Freshwater | MKVKKLVIKLNKAEVQHNLSKVKELWFKLLKKSLKGKHTEAVK* |
Ga0007794_100987531 | 3300004774 | Freshwater | MKTKKLILKLNRAEMQHQLDKAKKLWIKLLKKSFKHKHTEAVQ* |
Ga0007792_100250427 | 3300004805 | Freshwater | MKVKKLILRLNRAEVEHNVDKVKKFWLKLLKKSLKHKHTEAVK* |
Ga0007792_102792261 | 3300004805 | Freshwater | MKTRKLILKLNRAEIQHNLDKAKKFWFKLLKKSIRHKHTEVVQ* |
Ga0007854_102558042 | 3300004806 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTESVR* |
Ga0007809_101155851 | 3300004807 | Freshwater | YTVLQFYYKGNTMKVKKLISKLNRAEVEHNMELAKKFWFKLLKKSLKHKHTEAVK* |
Ga0007809_102277172 | 3300004807 | Freshwater | MKLKKLILKLNRAEIEHNMEKARKFWFKLLKKSLKGKHTEAVK* |
Ga0007876_10024647 | 3300006071 | Freshwater | MKIKKLIMKLNRAEFEHRLDKVKKLWFKILKKSIKHKHTESVR* |
Ga0007876_10042314 | 3300006071 | Freshwater | MKVKKLITKLNRAEFEHNLEKVKKLWFKLLKKSFKHKHTEAVR* |
Ga0007876_10092625 | 3300006071 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSIKHKHTESVR* |
Ga0007876_10096723 | 3300006071 | Freshwater | MKLKKLIIKLNRAEFEHNLEKAKKFWFKILKKSLKHKHTEAVK* |
Ga0007876_10149855 | 3300006071 | Freshwater | MKTKKLILKLNRAEIQHNLDKAKKLWFKLLKKSLKHKHTEVVQ* |
Ga0007876_10203451 | 3300006071 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTEAVR* |
Ga0007876_10502324 | 3300006071 | Freshwater | MKVKKLILKLNRAEIEHNMEQARKFWLKLLKKSLKGKH |
Ga0007876_10547381 | 3300006071 | Freshwater | MKVKKLIFKLNRAEIEHNMELAKKFWFKLLKKSLKHKHTEAVK* |
Ga0007876_10850922 | 3300006071 | Freshwater | MKVKKLILKLNKAEFEHNLEKVKKLWFKLLKKSLKGKHTEAVR* |
Ga0007876_11797841 | 3300006071 | Freshwater | IQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTEAVR* |
Ga0007806_10009093 | 3300006100 | Freshwater | MKLNRAELDHNMEKARKFWFKLLKKSLKHKHTEAVK* |
Ga0007806_10133444 | 3300006100 | Freshwater | TKNCIGTKSMKIKKLIMKLNRAEFEHNLEKAKKLWFKILKKSVKHKHTEAVR* |
Ga0007806_10322233 | 3300006100 | Freshwater | KNVHSNNINTFQEGNTMKVKKLILKLNKAEMQHKLAKAKKFWFKLLKKSFKHKHTEAVR* |
Ga0007806_10397023 | 3300006100 | Freshwater | QKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTESVR* |
Ga0007810_10538211 | 3300006101 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVK |
Ga0007813_10895481 | 3300006103 | Freshwater | MKVKTLIQKLNRAEFEHNLEKAKKLWMKLLKKSFKGKHTEAAR* |
Ga0007813_11112142 | 3300006103 | Freshwater | MKIKKLIFKLNKAEFEHKLQKAKKLWLKILKKSFKGKHT |
Ga0007819_10095536 | 3300006105 | Freshwater | MKLNRAEFEHNLEKAKKLWFKILKKSVKHKHTEAVR* |
Ga0007819_11151302 | 3300006105 | Freshwater | TKLMKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSIKHKHTESVR* |
Ga0007819_11205272 | 3300006105 | Freshwater | MLQLCYKGDTMKVKKLVLKLNRAEVEHNLEKAKKLWIKLLHKSLKHKHTEAVK* |
Ga0007862_10387952 | 3300006108 | Freshwater | MKLNKAEFEHNLEKVKKLWFKLLKKSLDGKHTEAVK* |
Ga0007870_10957541 | 3300006109 | Freshwater | MKTKKLILKLNKAEVTHNIKKAKELWFKLLKKSLKHKHTEAVK* |
Ga0007871_10121991 | 3300006110 | Freshwater | MKIKKLILKLNRAEFEHNLEKAKKLWFKILKKSVKHKHTEAVR* |
Ga0007871_10394861 | 3300006110 | Freshwater | KVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTEAVR* |
Ga0007857_10357691 | 3300006112 | Freshwater | MLQSCYKGETMKVKKLIMKLNRAELDHNMEKARKFWFKLLKKSLKHKHTEAVK* |
Ga0007858_10052124 | 3300006113 | Freshwater | MKVKKLILKLNKAEIQHNLKKAKEIWLKILKKSIKHKHTQAVQQL* |
Ga0007858_10481923 | 3300006113 | Freshwater | LIMKVKKLIRRLNIAEVEHNLAKVKKLWFKILKKSLKHKHTQDVQ* |
Ga0007815_10088756 | 3300006114 | Freshwater | MKVKKLVMKLYKAEIEHNLEKAKKIWFKLLKKSLDHKHTEAVK* |
Ga0007815_10285814 | 3300006114 | Freshwater | MKLNKAELEHNLKKAKELWFKLLKKSIKGKHTEAVR* |
Ga0007816_10060549 | 3300006115 | Freshwater | FLSQFLACFLIYNMLQSCYKGETMKVKKLIMKLNRAELDHNMEKARKFWFKLLKKSLKHKHTEAVK* |
Ga0007816_10176381 | 3300006115 | Freshwater | IKEGYNMKVKKLIMKLNKAEFEHNLKKAKELWFKILKKSIKHKHTAAVR* |
Ga0007816_10752831 | 3300006115 | Freshwater | MKIKKLIMKLNRAEFDHKLDKVKKLWFKILKKSIKHKHTESVR* |
Ga0007807_10680071 | 3300006116 | Freshwater | MKIKKLILKLNKAEFEHNLEKVKKLWFKLLKKSLKGKHTEAVR* |
Ga0007818_100089313 | 3300006117 | Freshwater | MKLNKAEFEHNLKKAKELWFKILKKSIKHKHTAAVR* |
Ga0007859_10823652 | 3300006118 | Freshwater | MLQYYYKGYTMKVKKLISKLNRAEVEHNMELAKKFWFKLLKKSLKHKHTEAVK* |
Ga0007866_10304242 | 3300006119 | Freshwater | MKVKKLISKLNRAEVEHNMELAKKFWFKLLKKSLKHKHTEAVK* |
Ga0007866_10307162 | 3300006119 | Freshwater | MKVKKLIFKLNRAEIAHNMERAKKLWFKLLKKSLKGKHTEAVK* |
Ga0007866_10809441 | 3300006119 | Freshwater | GTQLIMKVKKLIRRLNIAEVEHNLAKVKKLWFKILKKSLKHKHTQDVQ* |
Ga0007867_10063025 | 3300006120 | Freshwater | MKLNKAEIEHNLEKAKKFWFKLLKKSIKGKHTEAVK* |
Ga0007867_11391991 | 3300006120 | Freshwater | SGGTKLMKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTESVR* |
Ga0007805_10336391 | 3300006127 | Freshwater | MKLKKLILKLNRAEFEHNLKKAKELWFKILKKSLKHKHTEA |
Ga0007805_10494332 | 3300006127 | Freshwater | MKIEKLVKKLNRAEIEHNIKRVKELWFKILKKSLKHKHTERVQ* |
Ga0007805_10999032 | 3300006127 | Freshwater | MKVKKLIMKLNKAEMEHNLDKVKKFWFKLLKKSFKHKHTEAVR* |
Ga0007805_11316321 | 3300006127 | Freshwater | MKVKKLILKLNRAEIEHNIDKAKKLWFKLLKKSLKHKHTEAVK* |
Ga0007828_10024185 | 3300006128 | Freshwater | MKVKELVKKLYKAEIQHNMTKAKKLWLKLLKKSLKHKHTEAVK* |
Ga0075030_10000059014 | 3300006162 | Watersheds | MKTKKLIMKLYRAEFEHNLEKAKKLWMKILKKSVKHKHTETVQ* |
Ga0102921_13452881 | 3300007603 | Estuarine | RVKNLIKKLYKAEIEHNVEKIKKIWFKLIKKSLKHKHTEAVK* |
Ga0114973_100344022 | 3300009068 | Freshwater Lake | MKVEKLVKKLNRAEVDHNLEKVKQLWLKLLKKSLKHKHTEQVQ* |
Ga0114973_103326162 | 3300009068 | Freshwater Lake | MRVKNLIKKLYKAEIEHDVEKIKKIWFKLIKKSLKHKHTEAVK* |
Ga0114962_1000049319 | 3300009151 | Freshwater Lake | MKIKKLIMKLNRAEFEHKLNKVKELWFKILKKSIRHKHTESVR* |
Ga0114962_1000178620 | 3300009151 | Freshwater Lake | MKVKKLIMKLNRAEVEHNFKKVQELWFKLLKKSFKHKHTEAVK* |
Ga0114962_1000358613 | 3300009151 | Freshwater Lake | MKVKKLVMKLNKAEVEHNLKKVKEFWFKLLKKSLKHKHTESVR* |
Ga0114962_100126372 | 3300009151 | Freshwater Lake | MKVKKLVLKLNRAELEHNLDKAKKFWFKLLKKSLKHKHTEAVK* |
Ga0114962_100412052 | 3300009151 | Freshwater Lake | MKVEKLVKKLNRAEVDHDLEKVKQLWLKLLKKSLKHKHTEQAQ* |
Ga0114962_101744003 | 3300009151 | Freshwater Lake | LNRAEFEHKLNKAKKIWFKILKKSVRHKHTEAVR* |
Ga0114962_102989752 | 3300009151 | Freshwater Lake | MKIKKLIKKLNQAEFEHKVDQVKKLWFKILKKSLKHKSTGPVQ* |
Ga0114962_103584252 | 3300009151 | Freshwater Lake | MKTHKLILKLNRAEMRHDAVKAKKFWFKLLKKSIRHKHTEVVQ* |
Ga0114962_104304101 | 3300009151 | Freshwater Lake | MKVKALILKLNKAEVEHKADKVKKFWMKLLKKSLKHKHTQAVK* |
Ga0114962_105053851 | 3300009151 | Freshwater Lake | MKVKKLIMKLNKAEFEHNLDKAKKFWLKLLKKSFKHKHTEAVR* |
Ga0114980_104428133 | 3300009152 | Freshwater Lake | MKVKKLIMKLNKAEFEHNVQKVKELWLKILKKSLKGKHTEAVK* |
Ga0114963_100601191 | 3300009154 | Freshwater Lake | KKLIFKLNRAEFEHKLNKAKKIWFKILKKSVRHKHTEAVR* |
Ga0114963_100883993 | 3300009154 | Freshwater Lake | MKVKKLIMKLNKAELEHNMEKVKKFWFKILKKSLKGKHTESVK* |
Ga0114963_101488921 | 3300009154 | Freshwater Lake | MKVKKLILKLNKAEIEHNLDKAKKFWLKLLKKSLNHKHTEAVK* |
Ga0114963_101625412 | 3300009154 | Freshwater Lake | MKVEKLVKKLNRAEVDHNLEKVKQLWLKLLKKSLKHKHTEQAQ* |
Ga0114963_107552361 | 3300009154 | Freshwater Lake | MKVKKLILRLNRAEVEHKVDKVKKFWLKLLKKSIKHKHTEAVK* |
Ga0114968_102573801 | 3300009155 | Freshwater Lake | MKVKKLIFKLNKAEFNHNLIKVKKLWFKILKKSVRHKHTEAVR* |
Ga0114977_103249122 | 3300009158 | Freshwater Lake | MKVKKLIMKLNKAEFQHNLVKVKELWLKLLKKSLKHKHTEAVR* |
Ga0114978_100068602 | 3300009159 | Freshwater Lake | MKVKALVKKLNQAELNHNIDKVKRVWFKLLKKSLKHKHTEKAQ* |
Ga0114978_1000817513 | 3300009159 | Freshwater Lake | MKVRKLILKLNRAEIEHNVDRARKFWFKLLKKSLKHKHTEAVK* |
Ga0114978_100645404 | 3300009159 | Freshwater Lake | MKVEKLVKKLNRAEVDHNLEKVKQLWLKLLKKSLKHKHTEQ |
Ga0114978_101916813 | 3300009159 | Freshwater Lake | KVEKLVKKLNRAEVDHNLEKVKQLWLKLLKKSLKHKHTEQVQ* |
Ga0114978_104651742 | 3300009159 | Freshwater Lake | MKVKKLIMKLNKAEIQHNIYKAKEIWLKLLKKSLKHKHTEAVK* |
Ga0114978_106721722 | 3300009159 | Freshwater Lake | KVEKLVKKLNRAEVDHNLEKVKQLWLKLLKKSLKHKHTEQAQ* |
Ga0114959_1005025911 | 3300009182 | Freshwater Lake | MKLKRLVEKLNRAEFEHNLDKAKKFWLKILKKSFKHKHTENVQ* |
Ga0114959_100528763 | 3300009182 | Freshwater Lake | MKVKKLIMKLNRAELNHNMEKVKKFWFKILKKSFKGKHTESVK* |
Ga0114959_100552305 | 3300009182 | Freshwater Lake | MKLKKLVKKLNKAEMNHNLQNAKKFWVKILKKSFKHKDTTRVQ* |
Ga0114959_105217842 | 3300009182 | Freshwater Lake | MKVKKLIMKLNKAEFEHKLDKAKKFWLKLLKKSFKHKHTEAVR* |
Ga0114959_106365862 | 3300009182 | Freshwater Lake | MKVKKLVLKLNRAELEHNLDQAKKFWFKLLKKSLKHKHTEAVK* |
Ga0114976_100339332 | 3300009184 | Freshwater Lake | MKVKKLIMKLNKAELEHNMEKVKKFWFKILKKILKGKHTESVK* |
Ga0114976_100419213 | 3300009184 | Freshwater Lake | MKIKKLILKLNRAEIEHNMDKAKKFWFKLLKKSLKHKHTEAVK* |
Ga0114976_100587563 | 3300009184 | Freshwater Lake | MKTKKLILKLNKAEVEHNMKKAKEFWFKLLKKSLKHKHTESVK* |
Ga0114976_103807104 | 3300009184 | Freshwater Lake | MKVRKLILKLNRAEIEHNVDRARKFWFKLLKKSLKHKH |
Ga0114951_101041243 | 3300009502 | Freshwater | MLQYYYKGNIMKVKKLILKLNRAEIEHNMDKAKKLWIKLLHKSLKHKHTEAVK* |
Ga0114958_101533533 | 3300009684 | Freshwater Lake | MKVKKLVLKLNRAELEHNLDQAKKFWFKLLKKSLKHKH |
Ga0114964_101117471 | 3300010157 | Freshwater Lake | MKVKKLIFKLNRAEFEHKLNKAKKIWFKILKKSVRHKHTEAVR* |
Ga0114964_103551591 | 3300010157 | Freshwater Lake | MKVKKLILKLNKAEVEHNLNKAKKFWIKLLKKSLNHKHTEAVK* |
Ga0114960_100947702 | 3300010158 | Freshwater Lake | MKVKKLIMKLNKAELNHNMEKVKKFWFKILKKSFKGKHTESVK* |
Ga0136644_103117291 | 3300010334 | Freshwater Lake | KKLVLKLNRAELEHNLDKAKKFWFKLLKKSLKHKHTEAVK* |
Ga0129333_100604213 | 3300010354 | Freshwater To Marine Saline Gradient | LTVSKYKEVVMKVKKLIKKHYKACVQHDAEQEKKTWLKLLKKSLDHKHTESVK* |
Ga0129336_107026432 | 3300010370 | Freshwater To Marine Saline Gradient | LTVSKYKEVVMKVKKLIKKHYKACVQHDAEQEKKTWIKLLKKSLDHKHTESVK* |
Ga0133913_100865023 | 3300010885 | Freshwater Lake | MKVKKLILKLNRAEIEHNVDKARKFWFRLLKKSLKHKHTESVK* |
Ga0133913_102345062 | 3300010885 | Freshwater Lake | MKIETLVKKLNRAEAEHKLNKVKKIWFRILKKSLKHKHTEQVQ* |
Ga0133913_113562564 | 3300010885 | Freshwater Lake | MKVKKLIMKLNKAEFEHNVQKVKELWLKILKKSLKGKHT |
Ga0133913_123114621 | 3300010885 | Freshwater Lake | KNMKVKKLIMKLNKAEFEHNVQKVKELWLKILKKSLKGKHTEAVK* |
Ga0133913_131687662 | 3300010885 | Freshwater Lake | MKIQVLIRKLHKAIFEHNDAKEKKFWFKILKKSVKHKHTEAVR* |
Ga0139557_100182813 | 3300011010 | Freshwater | MRVKNLIKKLYKAEIEHNVEKIKKIWFKLIKKSLKHKHTEAVK* |
Ga0164296_100153426 | 3300013093 | Freshwater | MKIKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTESVR* |
Ga0164296_100190015 | 3300013093 | Freshwater | MKVKKLIMKLNRAEVQHNLEKAKKFWFKLLKKSIKHKHTEAVR* |
Ga0164296_10029432 | 3300013093 | Freshwater | MKVKKLIMKLNKAELQHNMEKAKKFWLKLLKKSLEGKYTHAVK* |
Ga0164296_100766312 | 3300013093 | Freshwater | MKVKKLIMKLNKAELQHNMEKAKKFWLKLLKKSLKGKHTEAVK* |
Ga0164296_10086145 | 3300013093 | Freshwater | MKTEKLIRKLYKAEIEHNLGKVKKFWLKLLKKSLKHKHTEAVK* |
Ga0164296_101143112 | 3300013093 | Freshwater | MLQYCYKGKTMKVKKLIFKLNRAEIEHNMERAKKLWFKLLKKSLKHKHTEAVK* |
Ga0164296_10153248 | 3300013093 | Freshwater | MKVKKLIMKLNKAEMEHNLEKVKKLWFKLLKKSFKHKHTEAVR* |
Ga0164296_10218174 | 3300013093 | Freshwater | MKTRKLILKLNRAEMQHKLDKAKKFWVKLLKKSFKHKHTEVVQ* |
Ga0164296_10959142 | 3300013093 | Freshwater | MKVKKLITKLNRAEFEHNLEKVKNLWFKLLKKSFKHKHTEAVR* |
Ga0164296_11983581 | 3300013093 | Freshwater | MKVRKLILKLNKAEMEHKLDKAKKFWFKLLKKSFKHKHTEAVR* |
Ga0164297_100857723 | 3300013094 | Freshwater | MKVKKLILKLYRAEIEHNMDLAKKFWLKLLKKSLKHKHTEAVK* |
Ga0136641_11137702 | 3300013286 | Freshwater | MKVKKLILKLNKAELEHNLKKAKELWFKILKKSFKGKHTEAVR* |
Ga0170791_113224772 | 3300013295 | Freshwater | KTKKLILKLNKAEVEHNMKKAKEFWFKLLKKSLKHKHTESVK* |
Ga0181343_11230701 | 3300017766 | Freshwater Lake | MRVKNLIKKLYKAEIEHNVEKIKKIWFKLIKKSLKHKHTEAVK |
Ga0181355_11453891 | 3300017785 | Freshwater Lake | DLIMKVEKLVKKLNRAEVDHDLEKVKQLWLKLLKKSLKHKHTEQAQ |
Ga0187843_101638343 | 3300019093 | Freshwater | MKVKKLIMKLNKAEFEHNIRKVKELWLKLLKKSLKGKHTEAVK |
Ga0181359_10464341 | 3300019784 | Freshwater Lake | MKVKELIKMLNVAEIKHNTPLIKKLWFKLLKKSLKHKHTEAVK |
Ga0181359_12533531 | 3300019784 | Freshwater Lake | MKVKELIKMLNVAEIKHDTPLIKKLWFKLLKKSLKHKHTEAVK |
Ga0214177_10013574 | 3300020705 | Freshwater | MKLKKLILKLNRAEFEHNLKKAKELWFKILKKSLKHKHTEAVR |
Ga0214238_10160982 | 3300020707 | Freshwater | MKVKELIKKLYKAELEHDIPLVKKLWYKLLKKSLKGKHTEAVK |
Ga0214198_10239952 | 3300020710 | Freshwater | MKVKKLIMKLNKAEFEHNLKKAKELWFKLLKKSIKHKHTAAVR |
Ga0214207_10237502 | 3300020716 | Freshwater | MKVKKLVQKLNRAEFQHNLDKAKKLWMKLLKKSFKGKHTESVR |
Ga0214178_10048823 | 3300020718 | Freshwater | MKVKKLVQKLNRAELQHNLEKAKKFWMKLLKKSLKGKHTESVR |
Ga0214178_10318532 | 3300020718 | Freshwater | MKIKKLIMKLNRAEFEHKLDKVKKLWFKILKKSMKHKH |
Ga0214220_10360461 | 3300020726 | Freshwater | MKTRKLILKLNRAEIRHDLVKAKKIWFKLLKKSIKHKHTEVVQ |
Ga0214246_10033416 | 3300020727 | Freshwater | MKIKKLIMKLNRAEFEHKLDKVKKLWFKILKKSMKHKHTEAVR |
Ga0214246_10050266 | 3300020727 | Freshwater | MKIKKLIEKLNKAELEHNIEKCKKLWLKAIKKSLKHKHTEPIQ |
Ga0214170_10016559 | 3300020731 | Freshwater | MKVKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTESVR |
Ga0214170_10018299 | 3300020731 | Freshwater | MKVKKLIEKLNKAEVEHNLDKAKKFWLKLLKKSLNHKHTEAVK |
Ga0214170_10027494 | 3300020731 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILRKSVKHKHTEAVR |
Ga0214172_10061451 | 3300020733 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKGKHTESVR |
Ga0214172_10301431 | 3300020733 | Freshwater | MKVKELVKRLYKAEIEHDMPLVKKLWYKLLKKSLKHKHTEAVK |
Ga0214172_10534832 | 3300020733 | Freshwater | MKVEKLVHKLYKAEIEHNLNKVKKFWFKLLKKSLKHKHTQAVK |
Ga0214172_10583011 | 3300020733 | Freshwater | MKVEKLVRKLYKAEIEHNLDKVKKFWFKLLKKSLKHKHTEAVK |
Ga0214206_10189192 | 3300021131 | Freshwater | MKIKKLIFKLNKAEFEHKLQKAKKLWLKILKKSFKGKHTEAVR |
Ga0214175_10083841 | 3300021133 | Freshwater | MKLKKLIQKLNRAEFEHNLEKVKKLWFKILRKSVKHKHTEAVR |
Ga0214167_11099132 | 3300021136 | Freshwater | TGTQLIMKVKKLIRRLNIAEVEHNLAKVKKLWFKILKKSLKHKHTQDVQ |
Ga0214164_100114020 | 3300021138 | Freshwater | MKLNRAEFEHNLEKAKKLWFKILKKSVKHKHTEAVR |
Ga0214164_10073591 | 3300021138 | Freshwater | MKIKKLIMKLNRAEFEHKLDKVKKLWFKILKKSVRHKHTEAVR |
Ga0214164_10282502 | 3300021138 | Freshwater | MLHFDYKEESIMKVKKLVMKLYKAEIEHNLEKAKKIWFKLLKKSLDHKHTEAVK |
Ga0214164_10446552 | 3300021138 | Freshwater | MKIKKLVFKLNKAELEHNLAKVKKIWFKILKKSLKHKHTESAQ |
Ga0214166_10073327 | 3300021139 | Freshwater | MKTNKLIFKLNKAEFKHKAEKAKELWFKILRKSFKGKPTQSVR |
Ga0214192_10071474 | 3300021142 | Freshwater | MKVKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTEAVR |
Ga0214192_10096623 | 3300021142 | Freshwater | MKVKKLIMKLNKAELEHNLKKAKELWFKLLKKSIKGKHTEAVR |
Ga0214192_10261792 | 3300021142 | Freshwater | MKLKKLITKLNRAEFEHNLSKAKKLWFKILKKSVKHKHTEAVR |
Ga0214192_10993591 | 3300021142 | Freshwater | KLQKLINKLNRAEFEHNLEKAKKFWFKILKKSIRHKHTEAVR |
Ga0214192_11817291 | 3300021142 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILRKSVKHKHTES |
Ga0194047_100831622 | 3300021354 | Anoxic Zone Freshwater | MKIEKLVRKLNKAEFEHRVNRVKELWFKILKKSLKHKHTERVQ |
Ga0194048_101222052 | 3300021519 | Anoxic Zone Freshwater | MKIKKLIMKLNRAEFEHKLNKVKELWFKILKKSIRHKHTESVR |
Ga0194048_102079652 | 3300021519 | Anoxic Zone Freshwater | MKTHKLILKLNRAEMRHDAVKAKKFWFKLLKKSIRHKHTEVVQ |
Ga0194048_103166962 | 3300021519 | Anoxic Zone Freshwater | MKVKKLIMKLNKAEFEHNLDKAKKFWLKLLKKSFKHKHTEAVR |
Ga0194060_102543493 | 3300021602 | Anoxic Zone Freshwater | MKTRKLILKLNRAEIRHNVDKVKKFWFKLLKKSIKHKHTEVVQ |
Ga0212088_101462333 | 3300022555 | Freshwater Lake Hypolimnion | MLQYYYKGNIMKVKKLILKLNRAEIEHNMDKAKKLWIKLLHKSLKHKHTEAVK |
Ga0212088_107148891 | 3300022555 | Freshwater Lake Hypolimnion | MKTRKLILKLNRAEMRHNTIKAKKFWFKLLKKSLKHKHTE |
Ga0212088_108602822 | 3300022555 | Freshwater Lake Hypolimnion | MKTRKLILKLNRAEIRHNLDKAKKFWFKLLKKSIKHK |
Ga0248169_10024135 | 3300022602 | Freshwater | MKVRKLILKLNKAEMEHKLDKAKKFWFKLLKKSFKHKHTEAVR |
Ga0248169_10073211 | 3300022602 | Freshwater | MKTEKLIRKLYKAEIEHNLGKVKKFWLKLLKKSLKHKHTEAVK |
Ga0248169_10085079 | 3300022602 | Freshwater | MKVKKLIMKLNKAELQHNMEKAKKFWLKLLKKSLKGKHTEAVK |
Ga0248169_10107918 | 3300022602 | Freshwater | MKTRKLILKLNRAEIRHNMIKAKKFWFKLLKKSLKHKHTEVVQ |
Ga0248169_1025853 | 3300022602 | Freshwater | MKTKKLILKLNRAEVRHNLDKAKKFWFKLLKKSLKHKHTEVVQ |
Ga0248169_1109973 | 3300022602 | Freshwater | MLQYCYKGKTMKVKKLIFKLNRAEIEHNMERAKKLWFKLLKKSLKHKHTEAVK |
Ga0248169_1135022 | 3300022602 | Freshwater | MKVKKLILKLNRAEIEHNMEQAKKFWLKLLKKSLKHKHTEAVK |
Ga0248169_1244445 | 3300022602 | Freshwater | MKVQKLIKKLNRAEVEHNLERVKKLWFRLLKKSLKHKNTGSAQ |
Ga0248169_1306974 | 3300022602 | Freshwater | MKIKKLIEKLNKAELEHNLEKCKKLWLKAIKKSLKHKHTEPIQ |
Ga0248169_1342466 | 3300022602 | Freshwater | MKVKTLIQKLNRAEFEHNLEKAKKLWMKLLKKSFKGKHTEAAR |
Ga0214921_1000001611 | 3300023174 | Freshwater | MKVKKLILKLNRAEIEHNVDKAKKFWFRLLKKSLKHRHTESVK |
Ga0214921_100686592 | 3300023174 | Freshwater | MKVKKLVIKLNKAEVQHNLSKVKELWFKLLKKSLKGKHTEAVK |
Ga0214921_103129882 | 3300023174 | Freshwater | MRVKNLIKKLYKAEIEHNVEKVKKIWFKLIKKSLKHKHTEAVK |
Ga0214921_103888652 | 3300023174 | Freshwater | MKVRKLVMKLNKAEMEHNLNKVKEIWFKLLKKSLKGKHTEAVK |
Ga0209083_12496262 | 3300025162 | Freshwater | MKTRKLILKLNRAEIRHNLDKAKKFWFKLLKKSIKHKHTEVVQ |
Ga0208619_1112732 | 3300025336 | Freshwater | IQGGPVMKIEKLVFKLNKAEIEHNLEKVKKIWFKILKKSLKHKHTEKAQ |
Ga0208383_100000349 | 3300025357 | Freshwater | MKVKKLIMKLNKAEFEHNLEKVKKLWFKLLKKSLDGKHTEAVK |
Ga0208383_10003945 | 3300025357 | Freshwater | MKIQKLVTKLNKAEIEHNLEKVKKIWFKILKKSLNHKHTEKVQ |
Ga0208383_10009556 | 3300025357 | Freshwater | MKVKKLILKLNKAEVQHKPVKAKILWLKLLKKSLKHKHTESVR |
Ga0208383_10029434 | 3300025357 | Freshwater | MKIKKLILKLNRAEFEHNLDKVKKLWFKILKKSFKHKHTEAVR |
Ga0208504_10012517 | 3300025358 | Freshwater | MKTKKLILKLNRAEMQHKLDKAKKFWFKLLKKSFKHKHTEVVQ |
Ga0208504_10036203 | 3300025358 | Freshwater | MKVKKLILKLNKAEMQHKLAKAKKFWFKLLKKSFKHKHTEAVR |
Ga0208504_10066042 | 3300025358 | Freshwater | MKVKKLILKLNRAEIEHNMDKAKKFWLKLLKKSLKHKHTEAVK |
Ga0208504_10105482 | 3300025358 | Freshwater | MKVKKLIMKLNRAELDHNMEKARKFWFKLLKKSLKHKHTEAVK |
Ga0208504_10136772 | 3300025358 | Freshwater | MKIKKLIQKLNRAEFEHNLEKAKKFWLKLLKKSVKGKHTEAVR |
Ga0208620_10166853 | 3300025368 | Freshwater | MKTKKLILKLNKAEVEHNIKKAKDLWFKLLKKSLKHKHTEAVK |
Ga0208382_10113632 | 3300025369 | Freshwater | MKVKKLIRRLNIAEVEHNLAKVKKLWFKVLKKSLKRKHTEKIQ |
Ga0208382_10342332 | 3300025369 | Freshwater | MKVKKLILKLNKAEIQHNLKKAKEIWLKILKKSIKHKHTQAVQ |
Ga0208382_10436921 | 3300025369 | Freshwater | MKLDKLIRKLNRAEFDHNMEKVKKFWFKILKKSIKHKHTEAVR |
Ga0207957_10032351 | 3300025372 | Freshwater | GTGTQLIMKVKKLIRRLNIAEVEHNLAKVKKLWFKVLKKSLKRKHTEKIQ |
Ga0207957_10293172 | 3300025372 | Freshwater | MKVKKLIMKLNRAEVEHNFEKAKKFWLKLLKKSLK |
Ga0207957_10338862 | 3300025372 | Freshwater | MKVKKLVTKLNRAEFEHNLEKVKKLWFKLLKKSFKHKHTEAVR |
Ga0208738_100001075 | 3300025379 | Freshwater | MKVKKLIMKLNKAELQHNMEKVKKFWLKLLKKSLEGKDTHAVK |
Ga0208738_10064553 | 3300025379 | Freshwater | MKVKKLILKLNKAEFEHNLEKVKKLWFKLLKKSLKGKHTEAVR |
Ga0208738_10093433 | 3300025379 | Freshwater | MKVKKLIMKLNKAELQHNMEKAKKFWLKLLKKSLEGKDTHAVK |
Ga0208738_10205113 | 3300025379 | Freshwater | MKIKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTESVR |
Ga0208738_10259563 | 3300025379 | Freshwater | MKVKKLIMKLNKAEFEHNLKKAKELWFKLLKKSIKGKHTEAVR |
Ga0208738_10594161 | 3300025379 | Freshwater | LIMKLKKLIIKLNRAEFEHNLEKAKKFWFKILKKSLKHKHTEAVK |
Ga0208871_10069493 | 3300025381 | Freshwater | MKVKKLIMKLNKAEFEHNLKKAKELWFKILKKSIKHKHTAAVR |
Ga0208256_10149361 | 3300025382 | Freshwater | MKVKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTE |
Ga0208250_100131910 | 3300025383 | Freshwater | MKIKKLIQKLNRAEFEHNLEKAKKFWLKLLKKSVKGKHTESVR |
Ga0208250_10110192 | 3300025383 | Freshwater | MKVKKLIMKLNRAEVEHNFEKAKKFWLKLLKKSLKHKHTEAVK |
Ga0208250_10110661 | 3300025383 | Freshwater | KVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTEAVR |
Ga0208250_10225051 | 3300025383 | Freshwater | KNVHSNNINTFQEGNTMKVKKLILKLNKAEMQHKLAKAKKFWFKLLKKSFKHKHTEAVR |
Ga0208250_10266301 | 3300025383 | Freshwater | MKIKKLIMKLNRAEFEHRLDKVKKLWFKILKKSVKHKHT |
Ga0208250_10648511 | 3300025383 | Freshwater | MKLNKAELEHNLKKAKELWFKLLKKSIKGKHTEAVR |
Ga0208740_100006731 | 3300025391 | Freshwater | MKLNKAEFEHNLKKAKELWFKILKKSIKHKHTAAVR |
Ga0208109_10302221 | 3300025395 | Freshwater | MKVKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKG |
Ga0208109_10489762 | 3300025395 | Freshwater | MKVKKLIAKLYRAEIEHNMAQAKKFWLKLLKKSLKGKH |
Ga0208874_10273282 | 3300025396 | Freshwater | MKVKKLILKLNRAELDHNMDKAKKFWLKLLKKSLKHKHTEAVK |
Ga0208874_10364172 | 3300025396 | Freshwater | MKIEKLVRKLNRAEIEHNINKVKTLWFKILKKSLKHKHTERVQ |
Ga0208874_10365741 | 3300025396 | Freshwater | LQSCYKGETMKVKKLIMKLNRAELDHNMEKARKFWFKLLKKSLKHKHTEAVK |
Ga0208107_10035343 | 3300025399 | Freshwater | MKLNKAEFEHNLEKVKKLWFKLLKKSLDGKHTEAVK |
Ga0208876_10278412 | 3300025402 | Freshwater | NMKVKKLIMKLNKAEFEHNLKKAKELWFKILKKSIKHKHTAAVR |
Ga0208378_10475742 | 3300025407 | Freshwater | MKLKKLIIKLNRAEFEHNLEKAKKFWFKILKKSLKHKHTEAVK |
Ga0208378_10622392 | 3300025407 | Freshwater | MKTKKLILKLNRAEIQHNLDKAKKLWFKLLKKSLKHKHTEVVQ |
Ga0208875_10100652 | 3300025410 | Freshwater | MKIQKLVTKLNKAEIEHNLEKVKKIWFKILKKSLKHKHTEKAQ |
Ga0208875_10151042 | 3300025410 | Freshwater | IGTKSMKIKKLIMKLNRAEFEHNLEKAKKLWFKILKKSVKHKHTEAVR |
Ga0208875_10192964 | 3300025410 | Freshwater | MKVKKLIMKLNKAEIEHNLEKAKKFWFKLLKKSIKGKHTEAVK |
Ga0208875_10562221 | 3300025410 | Freshwater | MKIEKLVRKLNRAEIEHNINKVKTLWFKILKKSLK |
Ga0208614_100103616 | 3300025413 | Freshwater | MKIKKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTEAVR |
Ga0208614_10674841 | 3300025413 | Freshwater | EFAMKLKKLILKLNRAEFEHNLKKAKELWFKILKKSLKHKHTEAVR |
Ga0208868_10116041 | 3300025415 | Freshwater | IINGEKIMKVKKLILKLNKAEVQHKPVKAKILWLKLLKKSLKHKHTESVR |
Ga0208253_10151872 | 3300025418 | Freshwater | MKTKKLIAKLYSAEIAHNMEKAKKFWFKLLKKSLKGKHTEAVK |
Ga0208253_10231733 | 3300025418 | Freshwater | MKVKKLILKLNKAEIQHNLKKAKEIWLKILKKSIKHKH |
Ga0208253_10706101 | 3300025418 | Freshwater | TMDRHGTSTKMKVKKLIQKLNKAEFEHNLEKVKKFWFKLLKKSFKGKHTQSVK |
Ga0208746_10407942 | 3300025423 | Freshwater | MLQSCYKGETMKVKKLIMKLNRAELDHNMEKARKFWFKLLKKSLKHKHTEAVK |
Ga0208617_10843942 | 3300025424 | Freshwater | MLHFDYKEESIMKVKKLVMKLYKAEIEHNLEKAKKIWFKLLKKSLDHKHTEAVR |
Ga0208739_100025626 | 3300025426 | Freshwater | MKLNRAELDHNMEKARKFWFKLLKKSLKHKHTEAVK |
Ga0208739_10021804 | 3300025426 | Freshwater | MKVKKLVMKLYKAEIEHNLEKAKKIWFKLLKKSLDHKHTEAVK |
Ga0208739_10121442 | 3300025426 | Freshwater | MKVKKLIMKLNKAELEHNLKKAKELWFKILKKSIKHKHTAAVR |
Ga0208742_10278272 | 3300025437 | Freshwater | MKVKKLIFKLNRAEIEHNMEQAKKLWFKLLKKSLKHKHTEAVK |
Ga0208744_10123101 | 3300025450 | Freshwater | KLMKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTEAVR |
Ga0208744_10124212 | 3300025450 | Freshwater | MKVKKLIFKLNRAEIEHNMELAKKFWFKLLKKSLKHKHTEAVK |
Ga0208744_10375773 | 3300025450 | Freshwater | MKVKKLIMKLNKAEFEHNLEKVKKLWFKLLKKSLDGKHT |
Ga0208744_11015222 | 3300025450 | Freshwater | KLIMKLNKAEFEHNLKKAKELWFKLLKKSIKHKHTAAVR |
Ga0208497_100157511 | 3300025466 | Freshwater | MKVKKLIMKLNRAEFEHRLDKVKKLWFKILKKSVKHKHTESVR |
Ga0208260_10267862 | 3300025467 | Freshwater | TSKAMKVKKLILKLNKAEFEHNLEKVKKLWFKLLKKSLKGKHTEAVR |
Ga0208260_11088803 | 3300025467 | Freshwater | MKVKKLILKLNRAEIEHNMEQARKFWLKLLKKSLKGKHTEAVK |
Ga0208864_11522382 | 3300025578 | Freshwater | MKVKKLILKLNRAEVQHNLDKVKELWLKLLKKSLKHKHTEAVR |
Ga0208507_10126481 | 3300025648 | Freshwater | GTKLMKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTEAVR |
Ga0208741_100112144 | 3300025723 | Freshwater | MKVKKLIMKLNKAEFEHNLKKAKVLWFKILKKSIKHKHTEAVR |
Ga0208741_100315561 | 3300025723 | Freshwater | TGTQLIMKVKKLIRRLNIAEVEHNLAKVKKLWFKVLKKSLKRKHTEKIQ |
Ga0208741_100816033 | 3300025723 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSIK |
Ga0208388_10589673 | 3300025778 | Freshwater | MKVKKLIMKLNRAELDHNMEQARKFWFKLLKKSLKH |
Ga0208386_10015587 | 3300025781 | Freshwater | MKIKKLIMKLNRAEFEHRLDKVKKLWFKILKKSIKHKHTESVR |
Ga0208386_10027124 | 3300025781 | Freshwater | MKVKELVKKLYKAEIQHNMTKAKKLWLKLLKKSLKHKHTEAVK |
Ga0208386_10399192 | 3300025781 | Freshwater | MKVKKLVLKLNRAEVEHNLEKAKKLWIKLLHKSLKHKHTEAVK |
Ga0208498_10391691 | 3300025785 | Freshwater | MKVKKLIMKLNKAELEHNLKKAKELWFKLLKKSIKGKH |
Ga0209188_100002390 | 3300027708 | Freshwater Lake | MKVKALILKLNKAEVEHKADKVKKFWMKLLKKSLKHKHTQAVK |
Ga0209188_100004858 | 3300027708 | Freshwater Lake | MKVKKLVMKLNKAEVEHNLKKVKEFWFKLLKKSLKHKHTESVR |
Ga0209188_100086925 | 3300027708 | Freshwater Lake | MKLKRLVEKLNRAEFEHNLDKAKKFWLKILKKSFKHKHTENVQ |
Ga0209188_10065262 | 3300027708 | Freshwater Lake | MKVEKLVKKLNRAEVDHDLEKVKQLWLKLLKKSLKHKHTEQAQ |
Ga0209188_10087636 | 3300027708 | Freshwater Lake | MKVKKLILKLNKAEIEHNLDKAKKFWLKLLKKSLNHKHTEAVK |
Ga0209188_10092627 | 3300027708 | Freshwater Lake | MKIKKLIKKLNQAEFEHKVDQVKKLWFKILKKSLKHKSTGPVQ |
Ga0209188_10278114 | 3300027708 | Freshwater Lake | MKVKKLIMKLNRAELNHNMEKVKKFWFKILKKSFKGKHTESVK |
Ga0209188_10311596 | 3300027708 | Freshwater Lake | MKVKKLIFKLNRAEFEHKLNKAKKIWFKILKKSVRHKHTEAVR |
Ga0209188_10319564 | 3300027708 | Freshwater Lake | MKVKKLIFKLNKAEFNHNLIKVKKLWFKILKKSVRHKHTEAVR |
Ga0209188_10526114 | 3300027708 | Freshwater Lake | MKTKKLILKLNRAEMQHQLDKAKKLWIKLLKKSFKHKHTEAVQ |
Ga0209188_10585695 | 3300027708 | Freshwater Lake | LMKTRKLILKLNRAEMRHNIIKAKKFWFKLLKKSLKHKHTEVVQ |
Ga0209188_12253062 | 3300027708 | Freshwater Lake | KLVLKLNRAELEHNLDKAKKFWFKLLKKSLKHKHTEAVK |
Ga0209188_12998652 | 3300027708 | Freshwater Lake | MKTKKLILKLNRAEIRHNLDKAKKLWFKLLKKSFKHKHTEVV |
Ga0209188_13289083 | 3300027708 | Freshwater Lake | MKLKKLVKKLNKAEMNHNLQNAKKFWVKILKKSFKHKDTTRVQ |
Ga0209499_12645562 | 3300027712 | Freshwater Lake | MKVKKLVLKLNRAELEHNLDKAKKFWFKLLKKSLKHKHTEAV |
(restricted) Ga0247836_12824741 | 3300027728 | Freshwater | MKVKELIKKLYEAEVHHNVEKVKKLWLKLLKKSLKHKHTEAVK |
Ga0209087_100646010 | 3300027734 | Freshwater Lake | MKIKKLILKLNRAEIEHNMDKAKKFWFKLLKKSLKHKHTEAVK |
Ga0209087_10991011 | 3300027734 | Freshwater Lake | MKTKKLILKLNKAEVEHNMKKAKEFWFKLLKKSLKHKHTESVK |
Ga0209087_12206452 | 3300027734 | Freshwater Lake | MKVEKLVKKLNRAEVDHNLEKVKQLWLKLLKKSLKHKHTEQVQ |
Ga0209190_13411631 | 3300027736 | Freshwater Lake | MRVKNLIKKLYKAEIEHDVEKIKKIWFKLIKKSLKHKHTEAVK |
Ga0209085_10172594 | 3300027741 | Freshwater Lake | MKTKKLILKLNRAELKHNLVKAKVLWLKLLKKSFKGKHTETVK |
Ga0209085_10418992 | 3300027741 | Freshwater Lake | MKVKKLIQKLNKAEVEHNLDKVKKFWFELLKKSLKHKHTESVK |
Ga0209085_13256022 | 3300027741 | Freshwater Lake | MKVEKLVKKLNRAEVDHNLEKVKQLWLKLLKKSLKHKHTEQAQ |
Ga0209085_13761092 | 3300027741 | Freshwater Lake | MKVKKLIMKLNKAELEHNMEKVKKFWFKILKKSLKGKHTESVK |
Ga0209084_100268018 | 3300027749 | Freshwater Lake | MKVKKLIMKLNRAEVEHNFKKVQELWFKLLKKSFKHKHTEAVK |
Ga0209296_11845151 | 3300027759 | Freshwater Lake | MKVKALVKKLNQAELNHNIDKVKRVWFKLLKKSLKHKHTEKAQ |
Ga0209296_13772832 | 3300027759 | Freshwater Lake | MKVKKLILKLNRAEIEHNVDKAKKFWFKLLKKSLNHKHTEAVK |
Ga0209088_102160421 | 3300027763 | Freshwater Lake | TTGDPIMKVEKLVKKLNRAEVDHNLEKVKQLWLKLLKKSLKHKHTEQVQ |
Ga0209088_102914852 | 3300027763 | Freshwater Lake | MKVKKLIMKLNKAEFEHNVQKVKELWLKILKKSLKGKHTE |
Ga0209500_100243372 | 3300027782 | Freshwater Lake | MKVRKLILKLNRAEIEHNVDRARKFWFKLLKKSLKHKHTEAVK |
Ga0209500_103584002 | 3300027782 | Freshwater Lake | MKVKKLIMKLNKAEIQHNIYKAKEIWLKLLKKSLKHKHTEAVK |
Ga0209777_100962445 | 3300027896 | Freshwater Lake Sediment | MKTKKLILKLNRAEIRHNLDKAKKFWLKLLKKSLKHKHTEVVQ |
Ga0209777_103821653 | 3300027896 | Freshwater Lake Sediment | MKVKKLIQKLNRAELQHNLDKVKKLWMKLLKKSFKGKHTESVR |
Ga0209777_104973603 | 3300027896 | Freshwater Lake Sediment | MKVKKLVIKLNRAELEHNLVKAKALWLKLLKKSFKGKHTEAVK |
Ga0209698_100012936 | 3300027911 | Watersheds | MKTKKLIMKLYRAEFEHNLEKAKKLWMKILKKSVKHKHTETVQ |
Ga0209400_100185010 | 3300027963 | Freshwater Lake | MKVKKLIMKLNKAEFEHNVQKVKELWLKILKKSLKGKHTEAVK |
Ga0209191_100004988 | 3300027969 | Freshwater Lake | MKVKKLIMKLNKAEFQHNLVKVKELWLKLLKKSLKHKHTEAVR |
Ga0304729_12026221 | 3300028392 | Freshwater Lake | MKTKKLILKLNRAELKHNLVKAKVLWLKLLKKSFKG |
Ga0304729_12359052 | 3300028392 | Freshwater Lake | FMKVKKLIFKLNRAEFEHKLNKAKKIWFKILKKSVRHKHTEAVR |
Ga0304728_10408842 | 3300028393 | Freshwater Lake | MKVKKLIMKLNKAELNHNMEKVKKFWFKILKKSFKGKHTESVK |
Ga0304728_11924262 | 3300028393 | Freshwater Lake | MKVKKLVLKLNRAELEHNLDKAKKFWFKLLKKSLKHKHTEAVK |
Ga0239581_10187525 | 3300029798 | Freshwater Lake | MKVKKLILKLNRAEIEHNMDKAKKLWIKLLHKSLKHK |
Ga0316219_10187395 | 3300031759 | Freshwater | MKVQKLIQKLNRAEFEHNLEKAKKLWMKLLKKSFKGKHTEAAR |
Ga0316219_12579732 | 3300031759 | Freshwater | GHTMKVKKLIMKLNRAEVQHNLEKAKKFWFKLLKKSIKHKHTEAVR |
Ga0316220_11360663 | 3300031884 | Freshwater | MKVKKLIRRLNIAEVEHNLAKVKKLWFKILKKSLKHKHTQDVQ |
Ga0316220_11869461 | 3300031884 | Freshwater | MKVKKLIQKLNRAEFEHNLEKVKKLWFKILKKSVKHKHTEAVR |
Ga0316220_12566972 | 3300031884 | Freshwater | IMKLNRAEVQHNLEKAKKFWFKLLKKSIKHKHTEAVR |
Ga0316220_12961862 | 3300031884 | Freshwater | MKLKKLILKLNRAEFEHNLKKAKELWFKILKKSLKHKH |
Ga0315903_107261511 | 3300032116 | Freshwater | MKVKNLIKKLYKAEIEHNVEKIKKIWFKLIKKSLKHKHTEAVK |
Ga0316218_10346202 | 3300032117 | Freshwater | MKVKKLIMKLNRAEVQHNLEKAKKFWFKLLKKSIKHKHTEAVR |
Ga0316218_10808482 | 3300032117 | Freshwater | MKVKKLIFKLNRAEIAHNMERAKKLWFKLLKKSLKGKHTEAVK |
Ga0316218_10834933 | 3300032117 | Freshwater | MKVQKLIQKLNRAEFEHNLEKAKKFWMKLLKKSVKGKHTEAVR |
Ga0316226_10569684 | 3300032562 | Freshwater | TRDRKILFHPLKEFVMKVKKLILKLNKAEIQHNLKKAKEIWLKILKKSIKHKHTQAVQ |
Ga0316232_11130093 | 3300032605 | Freshwater | KVQKLIKKLNRAEVEHNLERVKKLWFRLLKKSLKHKNTGSAQ |
Ga0316230_10248465 | 3300032668 | Freshwater | MKTRKLILKLNRAEIRHNMIKAKKFWFKLLKKSFKHKHTEVVQ |
Ga0316229_11872551 | 3300032676 | Freshwater | MKVQKLIKKLNRAEVEHNLERVKKLWFRLLKKSLKHKNTGSA |
Ga0316224_11686732 | 3300032753 | Freshwater | KLIMKLNRAEFEHNLEKAKKLWFKILKKSVKHKHTEAVR |
Ga0335036_0006772_2701_2832 | 3300034106 | Freshwater | MKVKKLIKKHYKACVQHDAEQEKKTWLKLLKKSLDHKHTESVK |
⦗Top⦘ |