NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F006177

Metagenome / Metatranscriptome Family F006177

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F006177
Family Type Metagenome / Metatranscriptome
Number of Sequences 379
Average Sequence Length 109 residues
Representative Sequence PRVRVPVRRSGYRYTARPGRRYPVRPAPPPRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLRRSL
Number of Associated Samples 144
Number of Associated Scaffolds 378

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 6.33 %
% of genes near scaffold ends (potentially truncated) 58.31 %
% of genes from short scaffolds (< 2000 bps) 99.47 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (74.934 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(70.185 % of family members)
Environment Ontology (ENVO) Unclassified
(49.868 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(85.488 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.45%    β-sheet: 0.00%    Coil/Unstructured: 48.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.93 %
UnclassifiedrootN/A25.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003401|JGI26530J50255_1008305All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea4581Open in IMG/M
3300003403|JGI26532J50257_10007634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea4581Open in IMG/M
3300004259|Ga0058868_1018549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea854Open in IMG/M
3300004622|Ga0058865_1016481All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea729Open in IMG/M
3300007244|Ga0075167_10029463All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea735Open in IMG/M
3300007244|Ga0075167_10045506All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea845Open in IMG/M
3300007250|Ga0075165_1803703All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea718Open in IMG/M
3300008884|Ga0103746_10059546All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea501Open in IMG/M
3300009257|Ga0103869_10073170All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea815Open in IMG/M
3300009411|Ga0115017_1057870Not Available668Open in IMG/M
3300009411|Ga0115017_1082752All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea540Open in IMG/M
3300009411|Ga0115017_1132260All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea502Open in IMG/M
3300009411|Ga0115017_1136110All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea574Open in IMG/M
3300009411|Ga0115017_1143045Not Available514Open in IMG/M
3300009411|Ga0115017_1163269Not Available753Open in IMG/M
3300009411|Ga0115017_1200222All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea694Open in IMG/M
3300009411|Ga0115017_1262470Not Available663Open in IMG/M
3300009411|Ga0115017_1391662All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea876Open in IMG/M
3300009411|Ga0115017_1400727All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea787Open in IMG/M
3300009411|Ga0115017_1403488All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea821Open in IMG/M
3300009411|Ga0115017_1426141All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea564Open in IMG/M
3300010185|Ga0127504_1161028All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea712Open in IMG/M
3300010188|Ga0127505_1110156All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea841Open in IMG/M
3300010192|Ga0127506_1067960All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea838Open in IMG/M
3300010198|Ga0127509_1076045All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1017Open in IMG/M
3300010198|Ga0127509_1076045All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1017Open in IMG/M
3300010198|Ga0127509_1172194All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea856Open in IMG/M
3300010199|Ga0127508_1161682All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea616Open in IMG/M
3300010199|Ga0127508_1165939All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea918Open in IMG/M
3300010200|Ga0127507_1032230All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea564Open in IMG/M
3300010870|Ga0102750_10045447All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea501Open in IMG/M
3300010870|Ga0102750_10107495Not Available851Open in IMG/M
3300010870|Ga0102750_10682213Not Available914Open in IMG/M
3300010870|Ga0102750_10844666All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea917Open in IMG/M
3300010870|Ga0102750_10898190Not Available627Open in IMG/M
3300010870|Ga0102750_10907748All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea742Open in IMG/M
3300010872|Ga0136897_11148352All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea754Open in IMG/M
3300010872|Ga0136897_11170767Not Available817Open in IMG/M
3300010878|Ga0136899_10172200All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea766Open in IMG/M
3300011120|Ga0150983_14364434Not Available576Open in IMG/M
3300020069|Ga0197907_10470130All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea681Open in IMG/M
3300020069|Ga0197907_11181957All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea840Open in IMG/M
3300020070|Ga0206356_11061113All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea538Open in IMG/M
3300020078|Ga0206352_10475824Not Available751Open in IMG/M
3300020078|Ga0206352_10853303All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea721Open in IMG/M
3300020081|Ga0206354_10562877All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea810Open in IMG/M
3300022523|Ga0242663_1133109All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea522Open in IMG/M
3300022530|Ga0242658_1245155All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea505Open in IMG/M
3300028554|Ga0302047_10035762All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea917Open in IMG/M
3300028554|Ga0302047_10081596Not Available851Open in IMG/M
3300028554|Ga0302047_10569660All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea501Open in IMG/M
3300028554|Ga0302047_10599384All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea742Open in IMG/M
3300028554|Ga0302047_10849704Not Available627Open in IMG/M
3300028554|Ga0302047_11026485Not Available914Open in IMG/M
3300030525|Ga0210273_1221634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea531Open in IMG/M
3300030526|Ga0210267_1085471All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea833Open in IMG/M
3300030528|Ga0210277_10215288All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea546Open in IMG/M
3300030528|Ga0210277_10734508Not Available792Open in IMG/M
3300030528|Ga0210277_10923425Not Available571Open in IMG/M
3300030529|Ga0210284_1101027All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea940Open in IMG/M
3300030529|Ga0210284_1316488All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea789Open in IMG/M
3300030529|Ga0210284_1604595All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea718Open in IMG/M
3300030530|Ga0210264_1198296Not Available569Open in IMG/M
3300030531|Ga0210274_1190626Not Available942Open in IMG/M
3300030531|Ga0210274_1538988All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea504Open in IMG/M
3300030531|Ga0210274_1601649All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea834Open in IMG/M
3300030531|Ga0210274_1623360All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea823Open in IMG/M
3300030532|Ga0210290_1237068All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1019Open in IMG/M
3300030532|Ga0210290_1258196All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea681Open in IMG/M
3300030535|Ga0210285_1161211Not Available650Open in IMG/M
3300030535|Ga0210285_1245934All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea517Open in IMG/M
3300030539|Ga0210281_1146820All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea517Open in IMG/M
3300030539|Ga0210281_1160905All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea682Open in IMG/M
3300030539|Ga0210281_1334175All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea565Open in IMG/M
3300030539|Ga0210281_1373691All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea710Open in IMG/M
3300030542|Ga0210249_1007853All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea586Open in IMG/M
3300030543|Ga0210289_1293164Not Available865Open in IMG/M
3300030543|Ga0210289_1432237Not Available789Open in IMG/M
3300030543|Ga0210289_1447453All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea855Open in IMG/M
3300030545|Ga0210271_10710169All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea828Open in IMG/M
3300030546|Ga0247646_1050801Not Available861Open in IMG/M
3300030546|Ga0247646_1057948All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea832Open in IMG/M
3300030546|Ga0247646_1243709All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea535Open in IMG/M
3300030549|Ga0210257_10231316Not Available874Open in IMG/M
3300030552|Ga0247654_1021811All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea868Open in IMG/M
3300030553|Ga0247645_1039383Not Available832Open in IMG/M
3300030554|Ga0247640_1044505All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea894Open in IMG/M
3300030554|Ga0247640_1051852All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea849Open in IMG/M
3300030559|Ga0257205_1060270All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea742Open in IMG/M
3300030563|Ga0247653_1096323All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea520Open in IMG/M
3300030564|Ga0210256_10161159All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea502Open in IMG/M
3300030564|Ga0210256_10309326Not Available654Open in IMG/M
3300030564|Ga0210256_10597173Not Available569Open in IMG/M
3300030568|Ga0257206_1013046All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1112Open in IMG/M
3300030568|Ga0257206_1023097All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea971Open in IMG/M
3300030568|Ga0257206_1038337All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea845Open in IMG/M
3300030570|Ga0247647_1063517All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea823Open in IMG/M
3300030570|Ga0247647_1282043All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea502Open in IMG/M
3300030572|Ga0210258_10361687Not Available801Open in IMG/M
3300030572|Ga0210258_10561723All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea501Open in IMG/M
3300030572|Ga0210258_10829416All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea583Open in IMG/M
3300030573|Ga0210272_1194848All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea594Open in IMG/M
3300030573|Ga0210272_1304846All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea514Open in IMG/M
3300030575|Ga0210288_1038006Not Available910Open in IMG/M
3300030575|Ga0210288_1059837All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea811Open in IMG/M
3300030577|Ga0210260_10046771Not Available974Open in IMG/M
3300030577|Ga0210260_10089644All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea831Open in IMG/M
3300030577|Ga0210260_10178292Not Available681Open in IMG/M
3300030577|Ga0210260_10257286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea601Open in IMG/M
3300030578|Ga0210275_10156312Not Available691Open in IMG/M
3300030579|Ga0247633_10281387Not Available536Open in IMG/M
3300030581|Ga0210270_1273923All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea536Open in IMG/M
3300030582|Ga0210261_1052050Not Available795Open in IMG/M
3300030582|Ga0210261_1126518All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea616Open in IMG/M
3300030583|Ga0210262_1036433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea896Open in IMG/M
3300030583|Ga0210262_1045943All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea849Open in IMG/M
3300030583|Ga0210262_1129614All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea645Open in IMG/M
3300030585|Ga0247639_1175796Not Available623Open in IMG/M
3300030586|Ga0265393_1210260Not Available518Open in IMG/M
3300030588|Ga0210283_1313068All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea840Open in IMG/M
3300030588|Ga0210283_1470674All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea861Open in IMG/M
3300030589|Ga0210255_10054398All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea810Open in IMG/M
3300030589|Ga0210255_10659233Not Available832Open in IMG/M
3300030590|Ga0247643_1053467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea760Open in IMG/M
3300030593|Ga0210263_1049208All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea795Open in IMG/M
3300030593|Ga0210263_1142419Not Available584Open in IMG/M
3300030594|Ga0210280_1038708All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea785Open in IMG/M
3300030594|Ga0210280_1059068All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea714Open in IMG/M
3300030596|Ga0210278_1020566Not Available1010Open in IMG/M
3300030596|Ga0210278_1028750Not Available927Open in IMG/M
3300030597|Ga0210286_1050575All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea900Open in IMG/M
3300030597|Ga0210286_1067874Not Available835Open in IMG/M
3300030597|Ga0210286_1068027All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea835Open in IMG/M
3300030597|Ga0210286_1068992All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea831Open in IMG/M
3300030597|Ga0210286_1130971All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea696Open in IMG/M
3300030598|Ga0210287_1088378Not Available725Open in IMG/M
3300030602|Ga0210254_10072000Not Available605Open in IMG/M
3300030602|Ga0210254_10234160All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea763Open in IMG/M
3300030602|Ga0210254_10888129All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea533Open in IMG/M
3300030602|Ga0210254_10908185Not Available890Open in IMG/M
3300030603|Ga0210253_10035677All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea883Open in IMG/M
3300030603|Ga0210253_10044335All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea833Open in IMG/M
3300030603|Ga0210253_10681472All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea913Open in IMG/M
3300030603|Ga0210253_10972952All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea630Open in IMG/M
3300030611|Ga0257182_1054630All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1024Open in IMG/M
3300030611|Ga0257182_1077272All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea916Open in IMG/M
3300030612|Ga0257196_1078401Not Available994Open in IMG/M
3300030612|Ga0257196_1150570All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea787Open in IMG/M
3300030612|Ga0257196_1174648All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea741Open in IMG/M
3300030615|Ga0257185_10050133Not Available968Open in IMG/M
3300030615|Ga0257185_10083369All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea851Open in IMG/M
3300030615|Ga0257185_10085760All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea844Open in IMG/M
3300030615|Ga0257185_10088776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea836Open in IMG/M
3300030621|Ga0247655_10050829All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea865Open in IMG/M
3300030621|Ga0247655_10056163All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea845Open in IMG/M
3300030622|Ga0265391_10038158All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea910Open in IMG/M
3300030623|Ga0265392_1019008All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea961Open in IMG/M
3300030623|Ga0265392_1039696Not Available828Open in IMG/M
3300030624|Ga0210251_10054127Not Available500Open in IMG/M
3300030624|Ga0210251_10136918All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea654Open in IMG/M
3300030624|Ga0210251_10422041All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea533Open in IMG/M
3300030624|Ga0210251_11017824All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea602Open in IMG/M
3300030625|Ga0210259_10624705All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea689Open in IMG/M
3300030626|Ga0210291_10073112All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea696Open in IMG/M
3300030626|Ga0210291_11339259All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea839Open in IMG/M
3300030626|Ga0210291_11365257All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea588Open in IMG/M
3300030626|Ga0210291_11366351All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea765Open in IMG/M
3300030626|Ga0210291_11868929Not Available792Open in IMG/M
3300030627|Ga0210269_10071937All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea887Open in IMG/M
3300030627|Ga0210269_10129216Not Available747Open in IMG/M
3300030627|Ga0210269_10212828Not Available634Open in IMG/M
3300030627|Ga0210269_10352770All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea525Open in IMG/M
3300030629|Ga0210268_1251648Not Available585Open in IMG/M
3300030629|Ga0210268_1269310All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea570Open in IMG/M
3300030630|Ga0210282_10032456All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1009Open in IMG/M
3300030630|Ga0210282_10316749All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea556Open in IMG/M
3300030631|Ga0210279_10078982Not Available934Open in IMG/M
3300030631|Ga0210279_10454328All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea523Open in IMG/M
3300030632|Ga0210250_10152399All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea766Open in IMG/M
3300030632|Ga0210250_10379036All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea775Open in IMG/M
3300030632|Ga0210250_11352147All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea888Open in IMG/M
3300030633|Ga0247623_10066990All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea813Open in IMG/M
3300030738|Ga0265462_10469439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea894Open in IMG/M
3300030738|Ga0265462_10531070All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea865Open in IMG/M
3300030738|Ga0265462_10558797All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea853Open in IMG/M
3300030738|Ga0265462_10628821All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea825Open in IMG/M
3300030738|Ga0265462_10638074All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea822Open in IMG/M
3300030738|Ga0265462_10737704All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea788Open in IMG/M
3300030738|Ga0265462_10746381Not Available785Open in IMG/M
3300030738|Ga0265462_10759077All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea781Open in IMG/M
3300030738|Ga0265462_11132584All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea690Open in IMG/M
3300030738|Ga0265462_11157666All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea685Open in IMG/M
3300030738|Ga0265462_12444752All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea520Open in IMG/M
3300030740|Ga0265460_10312906All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1062Open in IMG/M
3300030740|Ga0265460_10791336Not Available829Open in IMG/M
3300030740|Ga0265460_10830485Not Available817Open in IMG/M
3300030740|Ga0265460_10868569All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea806Open in IMG/M
3300030740|Ga0265460_10875129All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea804Open in IMG/M
3300030740|Ga0265460_10946795All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea785Open in IMG/M
3300030740|Ga0265460_10961345All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea781Open in IMG/M
3300030740|Ga0265460_11088081All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea750Open in IMG/M
3300030740|Ga0265460_11138163All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea739Open in IMG/M
3300030740|Ga0265460_11156189All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea736Open in IMG/M
3300030740|Ga0265460_12870915All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea518Open in IMG/M
3300030741|Ga0265459_10181959All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1338Open in IMG/M
3300030741|Ga0265459_10720582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea966Open in IMG/M
3300030741|Ga0265459_10944836All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea893Open in IMG/M
3300030741|Ga0265459_11096103Not Available853Open in IMG/M
3300030741|Ga0265459_11200005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea829Open in IMG/M
3300030741|Ga0265459_11207191Not Available827Open in IMG/M
3300030741|Ga0265459_11543331Not Available762Open in IMG/M
3300030741|Ga0265459_11840934All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea715Open in IMG/M
3300030741|Ga0265459_12616863All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea624Open in IMG/M
3300030743|Ga0265461_10397744All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1053Open in IMG/M
3300030743|Ga0265461_10621641All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea944Open in IMG/M
3300030743|Ga0265461_10934560All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea843Open in IMG/M
3300030743|Ga0265461_10955717All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea838Open in IMG/M
3300030743|Ga0265461_10975345All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea833Open in IMG/M
3300030743|Ga0265461_11062542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea812Open in IMG/M
3300030743|Ga0265461_11096189All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea804Open in IMG/M
3300030743|Ga0265461_12168582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea642Open in IMG/M
3300030743|Ga0265461_12406849All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea617Open in IMG/M
3300030754|Ga0074008_10059842All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea843Open in IMG/M
3300030768|Ga0315877_134449All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea534Open in IMG/M
3300030774|Ga0074007_10931995All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea753Open in IMG/M
3300030775|Ga0074021_1008391Not Available973Open in IMG/M
3300030775|Ga0074021_1855925All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea820Open in IMG/M
3300030778|Ga0075398_12084457All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea555Open in IMG/M
3300030778|Ga0075398_12103693All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea712Open in IMG/M
3300030778|Ga0075398_12159254All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea846Open in IMG/M
3300030778|Ga0075398_12208579All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea739Open in IMG/M
3300030782|Ga0102754_1050665Not Available647Open in IMG/M
3300030782|Ga0102754_1961461All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea784Open in IMG/M
3300030784|Ga0102758_10007719All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea597Open in IMG/M
3300030784|Ga0102758_10978680All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea813Open in IMG/M
3300030784|Ga0102758_11058354All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea586Open in IMG/M
3300030784|Ga0102758_11085718All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea779Open in IMG/M
3300030799|Ga0074010_11072821All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea661Open in IMG/M
3300030839|Ga0073999_10013520All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea832Open in IMG/M
3300030840|Ga0074020_10034448All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea851Open in IMG/M
3300030846|Ga0075403_10914108All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea743Open in IMG/M
3300030850|Ga0075387_10130188Not Available898Open in IMG/M
3300030850|Ga0075387_11810404All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea751Open in IMG/M
3300030858|Ga0102759_1717834All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea753Open in IMG/M
3300030864|Ga0315855_126602All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea575Open in IMG/M
3300030864|Ga0315855_126957All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea572Open in IMG/M
3300030867|Ga0102749_1258089Not Available727Open in IMG/M
3300030907|Ga0074013_10056636All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea879Open in IMG/M
3300030907|Ga0074013_11627710All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea806Open in IMG/M
3300030907|Ga0074013_11831239All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea628Open in IMG/M
3300030907|Ga0074013_11924681All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea793Open in IMG/M
3300030909|Ga0074033_10018013Not Available729Open in IMG/M
3300030911|Ga0102763_10003468Not Available676Open in IMG/M
3300030911|Ga0102763_11241132Not Available720Open in IMG/M
3300030922|Ga0138300_1085763All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea553Open in IMG/M
3300030922|Ga0138300_1228181All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea524Open in IMG/M
3300030922|Ga0138300_1392394Not Available630Open in IMG/M
3300030922|Ga0138300_1439002All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea545Open in IMG/M
3300030922|Ga0138300_1687836All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea827Open in IMG/M
3300030922|Ga0138300_1729400All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea533Open in IMG/M
3300030923|Ga0138296_1434994All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea531Open in IMG/M
3300030931|Ga0074006_10057969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1220Open in IMG/M
3300030931|Ga0074006_11530385All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea648Open in IMG/M
3300030931|Ga0074006_11550361All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea871Open in IMG/M
3300030933|Ga0074039_10033785Not Available832Open in IMG/M
3300030933|Ga0074039_11455011All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea818Open in IMG/M
3300030933|Ga0074039_11510111All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea567Open in IMG/M
3300030933|Ga0074039_11518825Not Available812Open in IMG/M
3300030933|Ga0074039_11661105All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea718Open in IMG/M
3300030935|Ga0075401_11508638All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea593Open in IMG/M
3300030938|Ga0138299_10034853All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea744Open in IMG/M
3300030938|Ga0138299_10035563All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea537Open in IMG/M
3300030938|Ga0138299_10100381All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea632Open in IMG/M
3300030938|Ga0138299_10514765All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea501Open in IMG/M
3300030938|Ga0138299_10608314All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea504Open in IMG/M
3300030938|Ga0138299_10846086All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea851Open in IMG/M
3300030938|Ga0138299_10989384All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea510Open in IMG/M
3300030946|Ga0075379_11362407All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea571Open in IMG/M
3300030959|Ga0102747_11221762All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea838Open in IMG/M
3300030972|Ga0075400_11470369Not Available528Open in IMG/M
3300030972|Ga0075400_11813000All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea572Open in IMG/M
3300030979|Ga0068589_11724609Not Available826Open in IMG/M
3300030992|Ga0074040_11016150All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea559Open in IMG/M
3300030992|Ga0074040_11276531Not Available747Open in IMG/M
3300030992|Ga0074040_11304835All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea556Open in IMG/M
3300030999|Ga0074019_10887353Not Available558Open in IMG/M
3300030999|Ga0074019_11036695All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea578Open in IMG/M
3300031008|Ga0074038_10032959Not Available813Open in IMG/M
3300031008|Ga0074038_11681716All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea540Open in IMG/M
3300031021|Ga0102765_10033010Not Available637Open in IMG/M
3300031021|Ga0102765_10035455All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea794Open in IMG/M
3300031021|Ga0102765_10059775All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea848Open in IMG/M
3300031021|Ga0102765_11467418All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea673Open in IMG/M
3300031023|Ga0073998_11118653Not Available631Open in IMG/M
3300031029|Ga0074012_11617604All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea795Open in IMG/M
3300031029|Ga0074012_11621574All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea754Open in IMG/M
3300031031|Ga0074042_11355543Not Available810Open in IMG/M
3300031031|Ga0074042_11433476Not Available773Open in IMG/M
3300031034|Ga0074041_11296107Not Available791Open in IMG/M
3300031035|Ga0074026_10999797Not Available651Open in IMG/M
3300031049|Ga0074036_11281946All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea757Open in IMG/M
3300031053|Ga0074018_1742240All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea749Open in IMG/M
3300031057|Ga0170834_100968537All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea505Open in IMG/M
3300031057|Ga0170834_105181056All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea835Open in IMG/M
3300031057|Ga0170834_105450955All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea835Open in IMG/M
3300031057|Ga0170834_105765683All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea851Open in IMG/M
3300031057|Ga0170834_108085480All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea649Open in IMG/M
3300031057|Ga0170834_108365802All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea834Open in IMG/M
3300031057|Ga0170834_108774178All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea843Open in IMG/M
3300031057|Ga0170834_113801367Not Available635Open in IMG/M
3300031089|Ga0102748_11274761All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea502Open in IMG/M
3300031122|Ga0170822_12225935All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea855Open in IMG/M
3300031122|Ga0170822_13306185All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea568Open in IMG/M
3300031122|Ga0170822_13593527All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea705Open in IMG/M
3300031128|Ga0170823_11398153All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea789Open in IMG/M
3300031128|Ga0170823_11555629All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea515Open in IMG/M
3300031128|Ga0170823_12426084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea770Open in IMG/M
3300031128|Ga0170823_15185802All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea856Open in IMG/M
3300031128|Ga0170823_17058083All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea556Open in IMG/M
3300031128|Ga0170823_17312382All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea797Open in IMG/M
3300031231|Ga0170824_102466236All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea680Open in IMG/M
3300031231|Ga0170824_105024598All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea877Open in IMG/M
3300031231|Ga0170824_105997117All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea856Open in IMG/M
3300031231|Ga0170824_108081694All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea500Open in IMG/M
3300031231|Ga0170824_110788300All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea783Open in IMG/M
3300031231|Ga0170824_110795954All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea821Open in IMG/M
3300031231|Ga0170824_111009564All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea923Open in IMG/M
3300031231|Ga0170824_122227915All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea854Open in IMG/M
3300031231|Ga0170824_126860111All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea579Open in IMG/M
3300031231|Ga0170824_127101541Not Available812Open in IMG/M
3300031231|Ga0170824_128199725All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea874Open in IMG/M
3300031411|Ga0102761_10089004Not Available605Open in IMG/M
3300031411|Ga0102761_10127842Not Available667Open in IMG/M
3300031411|Ga0102761_12680183All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea683Open in IMG/M
3300031411|Ga0102761_12702119All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea622Open in IMG/M
3300031469|Ga0170819_10626458Not Available563Open in IMG/M
3300031469|Ga0170819_11949629Not Available575Open in IMG/M
3300031469|Ga0170819_15907354All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea851Open in IMG/M
3300031469|Ga0170819_17281042All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea858Open in IMG/M
3300031474|Ga0170818_100254974All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea754Open in IMG/M
3300031474|Ga0170818_112049158All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea531Open in IMG/M
3300032169|Ga0257195_10115237Not Available801Open in IMG/M
3300032169|Ga0257195_10383492Not Available522Open in IMG/M
3300032470|Ga0314670_10285330All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea854Open in IMG/M
3300032515|Ga0348332_10532117All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea524Open in IMG/M
3300032589|Ga0214500_1091873All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea860Open in IMG/M
3300032593|Ga0321338_1139522All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea865Open in IMG/M
3300032593|Ga0321338_1174197All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea771Open in IMG/M
3300032593|Ga0321338_1240679All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea650Open in IMG/M
3300032593|Ga0321338_1378961All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea505Open in IMG/M
3300032593|Ga0321338_1385924All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea500Open in IMG/M
3300032697|Ga0214499_1103474Not Available874Open in IMG/M
3300032739|Ga0315741_10893583All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea784Open in IMG/M
3300032739|Ga0315741_11149212All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea695Open in IMG/M
3300032739|Ga0315741_12029820All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea503Open in IMG/M
3300032756|Ga0315742_10532358All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1000Open in IMG/M
3300032756|Ga0315742_10660544All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea940Open in IMG/M
3300032756|Ga0315742_10672808Not Available935Open in IMG/M
3300032756|Ga0315742_10760246All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea902Open in IMG/M
3300032756|Ga0315742_10907534All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea854Open in IMG/M
3300032756|Ga0315742_10951974Not Available841Open in IMG/M
3300032756|Ga0315742_10961069Not Available838Open in IMG/M
3300032756|Ga0315742_10975166All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea834Open in IMG/M
3300032756|Ga0315742_11033013Not Available819Open in IMG/M
3300032756|Ga0315742_11060017All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea812Open in IMG/M
3300032756|Ga0315742_11129532All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea795Open in IMG/M
3300032756|Ga0315742_11162013Not Available787Open in IMG/M
3300032756|Ga0315742_11630507All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea698Open in IMG/M
3300032756|Ga0315742_11802388All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea672Open in IMG/M
3300032756|Ga0315742_11820973All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea669Open in IMG/M
3300032756|Ga0315742_12102538All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea632Open in IMG/M
3300032756|Ga0315742_12152598All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea626Open in IMG/M
3300032756|Ga0315742_12571236Not Available582Open in IMG/M
3300032756|Ga0315742_12880190All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea554Open in IMG/M
3300032756|Ga0315742_12896046All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea552Open in IMG/M
3300032756|Ga0315742_13092067Not Available536Open in IMG/M
3300032756|Ga0315742_13291294All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea521Open in IMG/M
3300033523|Ga0314768_1232920All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea645Open in IMG/M
3300033523|Ga0314768_1234445Not Available643Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil70.18%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil15.57%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated3.96%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere2.37%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.58%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.79%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.79%
Wastewater TreatmentEngineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment0.53%
Wastewater BioreactorEngineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor0.53%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.26%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.26%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.26%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.26%
Wastewater SludgeEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge0.26%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003401Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_500_planEngineeredOpen in IMG/M
3300003403Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_500_planEngineeredOpen in IMG/M
3300004259Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time F- 52min-Aerobic_ RNA (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300004622Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time C-32min-Anaerobic_ RNA (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300007244Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007250Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300008884Microbial communities of wastewater sludge from Singapore - Sludge3_b2_FebruaryEnvironmentalOpen in IMG/M
3300009257Microbial communities of water from Amazon river, Brazil - RCM22EnvironmentalOpen in IMG/M
3300009411Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010185Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fa - Sphagnum fallax MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010188Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010192Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum fallax MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010198Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010199Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum fallax MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010200Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300010870Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010872Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 5)EnvironmentalOpen in IMG/M
3300010878Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 7)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300028554Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9)EnvironmentalOpen in IMG/M
3300030525Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030526Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030530Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030532Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030542Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR003SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030546Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030553Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030554Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030559Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030563Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030568Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030585Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030590Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030597Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030603Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR017SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030611Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030612Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030615Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030621Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030624Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR005SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030629Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030633Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030754Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030768Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030774Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030782Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030784Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030799Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030839Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030840Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030846Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030858Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030864Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T22 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030867Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030907Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030911Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030922Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030931Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030933Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030946Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030959Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 2A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030972Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030979Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030992Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030999Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031008Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031021Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031023Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031029Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031031Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031049Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031053Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031089Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032169Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP2-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26530J50255_100830533300003401Wastewater BioreactorMPRVRVPVRRSGVRYTTRPGDDIQFGKIDNSCYYHHRVTLLVHYRPAPVQPAGGRGLLGGLAGLLLCLFCLATLGLLGLFATFIAVTAYLGETFHKIYSHTNILFPFSGDIYRALKDANSGAGLYMNMIVLLAALCFAGFHKLQRAL*
JGI26532J50257_1000763453300003403Wastewater BioreactorMPRVRVPVRRSGVRYTTRPGRRYPVGKIDNSCYYHHRVTLLVHYRPAPVQPAGGRGLLGGLAGLLLCLFCLATLGLLGLFATFIAVTAYLVETFHKIYSHTNILFPFSGDIYRALKDANSGAGLYMNMIVLLAALCFAGFHKLQRAL*
Ga0058868_101854923300004259Wastewater TreatmentMPRVRVPVRRSGVRYTTRPGRRYPVRPVAPPPRRGGLLGLLGGLGGLLLCLFCLATLGLLGLFATFIAVTAYLGDIYRALKDANGAATAYMNMFILLAALCIAGYHKICRSS*
Ga0058865_101648113300004622Wastewater TreatmentMPRVRVPVRRSGVRYTTRPGRRYPVRPAPVQPAGGRGLLGGLAGLLLCLFCLATLGLLGLFATFIAVTAYLGDIYRALKDANSGAGLYMNMIVLLAALCFAGFHKLQRAL*
Ga0075167_1002946333300007244Wastewater EffluentMPRVRVPVRRTGVRYTARPGRRYPVPPPAARPAAGGRGLMGLIGGLGGLLLCLLCLATMGLLGLFASFIAVTAYLGKLYKALQTIGGSGAPGLYVNSVVLLAALCFAGFHKIRRSL*
Ga0075167_1004550613300007244Wastewater EffluentKMPRVRVPVRRTGVRYTARPGRRYPVPPPRAPSGGAGLLGLIGGLGGLLLCLLCLATMGLLGLFATFIAVTAYLGKLYKALKDIGGNGASGHYANMAILIAALCFAGYHKLRRSL*
Ga0075165_180370313300007250Wastewater EffluentKMPRVRVPVRRTGVRYTARPGRRYPVPPPRAPSGGGGLLGLIGGLGGLLLCLLCLATMGLLGLFATFIAVTAYLGKLYKALKDIGGSGASGHYANMAILIAALCFAGYHKLRRSL*
Ga0103746_1005954613300008884Wastewater SludgeMPRVRVPIRRAGTRYVARPGRRYPVRPAAAPSRGSILPLIGGLGGLLLCLLCLATMGILGLFATFIAVVAYLGDLYRALRDLGGNSTASVQYVNMAILLAALCFAGYHKLRRSL*
Ga0103869_1007317023300009257River WaterPTYRVRVRRSGVRYSARPGRRYPVAPARPATGGKGLMGLIGGLGGLLLCLLCLATMGILGLFATFIAITTYLGRLYKALKDIGSDAPGHYMNMTILIAALCFAGYHKLRRSL*
Ga0115017_105787013300009411SoilVPIRRSGIRYTARPARAAARAGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRAMKSSDGSVHYVNMTILLAALGFASYHKIRRSL*
Ga0115017_108275213300009411SoilRVRVPIRRSGVRVTARPGRQYPIRPVIPVAPARRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDIYRALRDTGNSASGHYMNMTILLVALCFAGYHKLRRSL*
Ga0115017_113226013300009411SoilMPRVRVPVRRSGYRYTARPGRRYPIRPPVAPRRGGLGLLGGLAGLLICLLCLATLGLLGLFGAFIAVTAYLGDVYRAVRDAGAGNSASGIYMNMAILLAALCFAGFHKLQRSL*
Ga0115017_113611013300009411SoilMPRVRVPVRRSGYRYTARPGRRYPVRPIAPPPARGGRGLIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALRDSGNSASGLYMNMAILLAALCFAGYHKLRRSL*
Ga0115017_114304513300009411SoilPRVRVPIRRSGVRVTARPGRQYPVRPAPPPRRGGLIGLLGGLAGILLCLLCLATLGLLGLFATFIAVTAYLVDVWRALRNNNSASGNYVNMAILLAALGFVSYQKLRRSL*
Ga0115017_116326913300009411SoilPGRRFPVAPPPAKSGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYKAIKNNGSAASGLYVNMAILLAASSFAVFHKLQRSL*
Ga0115017_120022213300009411SoilRRSGYRYTARPGRRYPVRPIAPPPARGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALRDSGNTASGLYVNMAILLAALCFAGFHKLQRSL*
Ga0115017_126247023300009411SoilMPRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALSAIGNTASGQYMNMGILLAALCFVGFYKLRRSL*
Ga0115017_139166213300009411SoilMPRVRVPVRRSGYRYTARPGRRYPVRPAPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYINMTILLAALCFAGLLKLRRSL*
Ga0115017_140072713300009411SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAAARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDIYRALRDTGNSASGHYMNMTILLAALCFAGYHKLRRSL*
Ga0115017_140348813300009411SoilPRVRVPVRRSGYRYSARPGRRYPIRPPPPARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGHYVNMAILLAALCFAGYHKLRRSL*
Ga0115017_142614113300009411SoilRTGYRRAMRPGRRYPIRPIVPVVPVPPPRTRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDQDNSASGYYVNMVILLAALCFAGYHKLHRSL*
Ga0127504_116102813300010185Host-AssociatedVPVRRSGYRYTARPGRRYPIRPVVQPSSGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFVAVTAYLGGVYRALKSAGSNASGNYVNMAILLGALSFAGYHKLRRSI*
Ga0127505_111015613300010188Host-AssociatedMPRIRVPVRRSGYRYTARPGRRYPVQPIVQPVARANRGLIGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGDVYRALKDAGTGSASGLYVNMAILLAALCFAGYHKLRRSL*
Ga0127506_106796013300010192Host-AssociatedTLKMPRVRVPVRRSGYRYTARPGRRYPTAAPSGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFVAVTAYLGGVYRALKSAGSGASGLYINMAILLAALCFAVFHKLQRSL*
Ga0127509_107604513300010198Host-AssociatedVPVRRSGYRYTARPGRRYPTAAPSGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFVAVTAYLGGVYRALKTAGSNASGNYVNMAILLGALCFAGYHKLRRSI*
Ga0127509_107604523300010198Host-AssociatedARPGRRYPVRPVVQQRGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGDVYRALRDTGNSASGLYMNMAILLVALCFAGYHKLRRSL*
Ga0127509_117219413300010198Host-AssociatedMPRVRVPVRRSGIRYTARPGRRYPIRPAPVVATGGRGLIGGLAGLLLCLLCLATLGLLGLFAAFVAVTAYLASVYHALRSVGNSAPGLYVNMGILLAALCFAGFHKLQRSL*
Ga0127508_116168213300010199Host-AssociatedVPVRRSGYRYTARPGRRYPVRPVVQQRGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGDVYRALRDTGNSASGLYMNMAILLVALCFAGYHKLRRSL*
Ga0127508_116593923300010199Host-AssociatedMPRVRVPVRRSGYRYTARPGRRYPVRPVVQPRGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGDVYRALRDTGNSASGLYINMAILLAALCFASFHKLQRSL*
Ga0127507_103223023300010200Host-AssociatedRVPVRRSGYRYTARPGRRYPVRPAPQRGGLGLLGGLAGLLLCLLCLAAMGLLGLFAAFVAVTAYLGDVYRALKTSGASGLYINMAILLAALCFAGFHKLQRSL*
Ga0102750_1004544713300010870SoilRVRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSNASGHYMNMTILLAALCFAGYHKLRRSL*
Ga0102750_1010749523300010870SoilVPIRRSGVRVTARPGRQYPVRPAAARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL*
Ga0102750_1068221313300010870SoilMPRVRVPVRRSGIRYAARPGRRYPVRPAPPPRRGGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAATAYLGQIYRALRSSGPALYVNTGVLLAALCFAGFCKLRRSL*
Ga0102750_1084466623300010870SoilMPRVRVPIRRSGVRITARPGRQYPVRPVPVAPRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDARNNASGLYMNMAILLVALCFAGYHKIRRSL*
Ga0102750_1089819023300010870SoilPGRRYPVRPPVRPPQQSNRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGQISRALKRANGASGFYVNVFILLIALGFACFNKFRRSL*
Ga0102750_1090774813300010870SoilPRVRVPVRRSGYRYTARPGRRYPVRPAPPPRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLRRSL*
Ga0136897_1114835213300010872SoilPIRRSGVRITARPGRQYPVRPAVVPVRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDARNSASGLYINMIILLAALCFAGFHKLRRSL*
Ga0136897_1117076723300010872SoilPRVRVPIRRSGVRVTARPGRQYPVRPAAARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL*
Ga0136899_1017220013300010878SoilRIREPIRRSGVRITARPGRQYPVRPAVVPVRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDARNSASGLYINMIILLAALCFAGFHKLRRSL*
Ga0150983_1436443413300011120Forest SoilVRVTARPGRQYPVRPVAPRRGLAGLIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRYANNSASGLYINMTILLAALCFAGFHKLQRSL*
Ga0197907_1047013013300020069Corn, Switchgrass And Miscanthus RhizosphereMPPVRVPIRRSGYRYTRTPGHRYPVVTPLTPRPPPPARKSGGGLAGLIGGLAGLLLCLLCLATMGLLGLFAAFVAVVAYLGGVYRALRDANDNNTNGVTAFYVNMAILIAALCFASYHKLIRSL
Ga0197907_1118195713300020069Corn, Switchgrass And Miscanthus RhizosphereMPRVRVPVRRSGYRYTARPGRRYPIRPVPPPRRGGLAGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRDSGSSASGLYVNMAILLAALCFAGFYKLRRSL
Ga0206356_1106111313300020070Corn, Switchgrass And Miscanthus RhizospherePRVRVPVRRSGYRYTARPGIRYPPPAPPARRGGLLGLLGGLAGLLLCLLCLASLGLLALFSIFVAVVAYLGQVYNALKDANTASGLYVNMAVLLAALCFAGFYKLRRSI
Ga0206352_1047582433300020078Corn, Switchgrass And Miscanthus RhizosphereVRVPVRRSGVRVTARPGRRYPVQPVAPVRGGGLRGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVWRALRTANDSTPTFYVNMGVLLAALGFALYHKVQRSL
Ga0206352_1085330313300020078Corn, Switchgrass And Miscanthus RhizosphereMPRIRVPIRRAGVRYTARPGRPYPAQGGILGLLGGLAGLLLCLLCLATVGLLGLFGAFIGVTVRLGEIYRSLRDASGSAPDHYISMTMLLAALCLVGYHKFRRSL
Ga0206354_1056287713300020081Corn, Switchgrass And Miscanthus RhizosphereMPRVRVPIRRSGVRVTARPGRQYPVQPVIPVRPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDIYRALRDTNSASGHYMNMTVLLVALCFAGYHKLRRSL
Ga0242663_113310923300022523SoilMPRVRVPVRRSGYRYTARPGRRYPVRPIQPARRGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASVQYANMAILLAALCFAGFCKLRRSL
Ga0242658_124515513300022530SoilLKMPRYRVPIRRTGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATMGLLGLFATFIAVTAYLGDVYRALKDQDNSASGFYVNMAILLAALCFAGYHKLHRSL
Ga0302047_1003576223300028554SoilMPRVRVPIRRSGVRITARPGRQYPVRPVPVAPRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDARNNASGLYMNMAILLVALCFAGYHKIRRSL
Ga0302047_1008159623300028554SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAAARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL
Ga0302047_1056966013300028554SoilRVRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSNASGHYMNMTILLAALCFAGYHKLRRSL
Ga0302047_1059938413300028554SoilPRVRVPVRRSGYRYTARPGRRYPVRPAPPPRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLRRSL
Ga0302047_1084970423300028554SoilPGRRYPVRPPVRPPQQSNRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGQISRALKRANGASGFYVNVFILLIALGFACFNKFRRSL
Ga0302047_1102648513300028554SoilMPRVRVPVRRSGIRYAARPGRRYPVRPAPPPRRGGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAATAYLGQIYRALRSSGPALYVNTGVLLAALCFAGFCKLRRSL
Ga0210273_122163423300030525SoilVRRTGYRYTTRPGRQYPVRPVVAPPPARRGGLAGLIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGSNTASGLYVNMTILLAALCFAGFHKLRRSL
Ga0210267_108547113300030526SoilPVRRSGYRYTARPGRRYPVQPAKRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0210277_1021528813300030528SoilPRVRVPVRRSGYRYTARPGRRYPIRPPPPPAKRGGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGSVYRALKSVGNSAPGQYVNMAILLGALCFAGYHKLRRSL
Ga0210277_1073450813300030528SoilRVRVPVRRSGYRYAARPGRRYPVRPAAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHHMDMAILLAALCFVGFNKLRRSL
Ga0210277_1092342513300030528SoilRVRVPVRRSGYRYTARPGRRYPVRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGLYVNMAILLAALCFAGFS
Ga0210284_110102713300030529SoilMPRVRVPVRRSGYRYAARPGRRYPIRPPPPARSGLAGLIGGLAGLLLCLLCLAALGLLGLFAAFIATTAYLGGVYRALRSIGNSANVPVVNMAILLAALCFAGFYKLRRSL
Ga0210284_131648823300030529SoilMPRVRVPVRRSGYRYAARPGRRYPIRPVAPARSGLAGLIGGLAGLLLCLLCLAALGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFQKLRRSL
Ga0210284_160459523300030529SoilMPRVRVPVRRSGYRYTARPGRRYPIRPTVAVQPTGSARGLIGGLAGLLLCLLCLATLGLIGLFATFVAVTAYLGSVYRALRDVGQSSASGLYMNMTILLAALCFAGYHKLRRSL
Ga0210264_119829613300030530SoilRPGRRYPIRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHHMDMAILLAALCFVGFHKLRRSL
Ga0210274_119062613300030531SoilPRVRVPIRRSGVRYATRPGRRYPVRPPIRPYVAPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0210274_153898823300030531SoilMPRVRVPVRRSGYRYTARPGRRYPIRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRYAGNGASGHYVNMTILLAALCFAGYHKLRRSL
Ga0210274_160164913300030531SoilMPRVRVPIRRSGVRYTARPGRRYPAPPAPARGGRGLIGGLAGLLLCLLCLATMGLLGLFATFIAVTAYLGSVYRALRDTGSSASGHYMSMTMLLAALCFVGYHKLRRSL
Ga0210274_162336023300030531SoilRYTARPGRRYPIRPPPPPKARSGLAGLLGGLAGLLLCLLCLATLGLLGLFGAFIGVTAYLGGVYRALRNNRTGAASALSVNMVILLAAICFAGFHKLRRSL
Ga0210290_123706813300030532SoilMPRVRVPIRRSGVRYATRPGRRYPVRPPIRPYVAPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0210290_125819613300030532SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210285_116121123300030535SoilPRVRVPVRRSGYRYAARPGRRYPVRPAAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHHMDMAILLAALCFVGFHKLRRSL
Ga0210285_124593413300030535SoilMPRVRVPVRRSGYRYTARPGRRYPIRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNGASGHYVNMTILLAALCFAGYHKLRRSL
Ga0210281_114682013300030539SoilGYRYTARPGRRYPVRPPPPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0210281_116090513300030539SoilPRYRVPIRRTGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLFLATMGLLGLFATFIAVTAYLGDVYRALKDQDNSASGFYVNMAILLAALCFAGYHKLHRSL
Ga0210281_133417513300030539SoilMPRIRVPVRRSGYRYTARPGRRYPVRPQRSGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNGNGASGLYVNMAILLAALCFAGYHKLRRSL
Ga0210281_137369113300030539SoilMPRVRVPVRRSGYRYAARPGRRYPIRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFNKLRRSL
Ga0210249_100785313300030542SoilVPIRRSGYRRSVRPGRRYPVRPVVPVVPRPPSRGLAGIIGGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALRDAGNGASGHYVNMTILLAALCFAGYHKLRRSL
Ga0210289_129316413300030543SoilVRPPIRPYVAPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0210289_143223713300030543SoilVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALQATGSSASGLYMNMAILLAALCFAGFYKLRRSL
Ga0210289_144745333300030543SoilMPRYRVPIRRTGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATLGLPGLFATFIAVTAYLGDVYRALKNQDNGASGYYVNMAILLAALCFAGYHKLHRSL
Ga0210271_1071016913300030545SoilLRVRVPIRRSGVRYTARPGRLYPAPPAPARGGRGLIGGLAGLLLCLLCLATMGLLGLFATFIAVTAYLGSVYRALRDTGSSASGHYMSMTMLLAALCFVGYHKLRRSL
Ga0247646_105080123300030546SoilRVRVPVRRSGYRYTARPGRRYPVMPVAPPPRRGGAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALRDVNGAASGLYVNTTIMLAAVGFAVYHKLQRAL
Ga0247646_105794823300030546SoilVRVPVRRSGYRYTARPGRRYPVVPVAPPARGGNGLLGGLAGLLLCLLCLATLGLLGLFATYIAVTAYLGDVYRALRDTNGSASGLYVNMAILFAAVGFAVFHKLQRSL
Ga0247646_124370923300030546SoilMPRVRVPIRRSGVRYTARPSRPIPVAPARARGGIKGLLGGLAGLLLCLLCLGTLGLLGLFATMIALTAYLGDVWRALRDVNGSATGLYANMAILMGALFFAGYHKLRRSL
Ga0210257_1023131613300030549SoilRVRVPVRRSGYRYAARPGRRYPIRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFQKLRRSL
Ga0247654_102181113300030552SoilMPRYRVPIRRTGYRRSIRPGRRYPVRPVVPVVPPPSGRGLGGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRSLRDAGNAASGYNLNMAILLAALCFAGYHKLRRSL
Ga0247645_103938313300030553SoilGRRYPVRPVPPPAKKRGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGGDNGASGIYVNLAILLAALCFAGFHKLQRSL
Ga0247640_104450533300030554SoilRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDIGNNASGLYMNMGILLAALCFAGFHKLQRSL
Ga0247640_105185213300030554SoilPVRRSGYRYTARPGRRYPIRPVPPPAKGGRGLLGGLAGLLLCLLCLATLGLIALFATFIAVTAYLGDVYRALRDIGSSASGHYVNMAILLAALCFAGYHKLRRSL
Ga0257205_106027013300030559Host-AssociatedMPRVRVPVRRSGYRYTARPGRRYPVRPAPPPRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGHYVNMAILMAAVCFAGYHKIRRAL
Ga0247653_109632313300030563SoilQRVRVPIRRSGVRVTARPGRQYPVRPIPVAPRRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDVGNSASGHYMNMTILMVALCFAGYHKLRRSL
Ga0210256_1016115913300030564SoilRVRVPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMSIVLAALCFVGYHKLRRLL
Ga0210256_1030932613300030564SoilRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLAALGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFQKLRRSL
Ga0210256_1059717313300030564SoilMPIRRSGVRVSSRPGQVYPAPSRGGLLGLIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGNVYQALKAANSVPGLYVNMGILLIALCFAGYHKLRHLL
Ga0257206_101304623300030568Host-AssociatedMPRVRVPIRRSGVRVTARPGRQYPVRPVVAPARRRGLIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGKVYRALRAVGNNASGLNMNMTILLAALCFVGYHKLRRLL
Ga0257206_102309713300030568Host-AssociatedMPRVRVPIRRSGVRYATRPGRRYPVRPPIRPYVPPRQSSGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALHRANAASGLYVNVFILSIALGFACFNKFRRSL
Ga0257206_103833723300030568Host-AssociatedMPRVRVPIRRSGVRVTARPGRQYPVRPVVAPARRRGLIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGKVYRALKAVGNAASGLNVNMAILLAALCFAGFHKLRRSL
Ga0247647_106351723300030570SoilVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALSAIGNSANIPFVNMAILLAALCFAGFYKLRRSL
Ga0247647_128204313300030570SoilRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALSAIGNTASGHYMNMAILLAALCFVGFHKLRRSL
Ga0210258_1036168733300030572SoilRVRVPVRRSGIRYAARPGRRYPVRPAPPPRRSGLAGLLGGLAGLLLCLLCLATIGLLGLFAAFIAATAYLGQIYRALRSSGPALYVNTGVLLAALCFAGFCKLRRSL
Ga0210258_1056172313300030572SoilKMPRIRVPVRRSGYRYTARPGRRYPVPQKRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0210258_1082941613300030572SoilMPRYRVPIRRTGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATMGLLGLFATFIAVTAYLGDVYRALKDQDNSASGFYVNMAILLAALCFAGYHKLHRSL
Ga0210272_119484823300030573SoilMPRVRVPVRRSGYRYSARPGRRYPVVPVAPVAPRRGLTGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNGNGSGASGLYVNMAFLLAALCFAGYHKLRRSL
Ga0210272_130484613300030573SoilRIRVPVRRSGYRYTARPGRRYPVQPAKRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINITILLAALCFAGFHKLQRSL
Ga0210288_103800613300030575SoilPGRRYPVRPPIRPYVAPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0210288_105983723300030575SoilKMPRVRVPVRRSGYRYTARPGRRYPVQPAPVARGGRGLIGGLAGLLLCLLCLAAMGLLGLFAAFIAVTAYLGDVYRALRDAGSNGAPGLYMNMTILLAALCFAGYHKLRRSL
Ga0210260_1004677113300030577SoilMPRVRVPIRRSGVSYATRPGRRYPVRPPIRPYVAPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0210260_1008964423300030577SoilKMPRYRVPIRRSGYRRSVRPGRRYPVRPVVPVVPPPKSRGLAGLIGGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALKDAGNSASGYYMNMAILLAALCFAGYHKLRRSL
Ga0210260_1017829213300030577SoilPGRRYPVQPAPVAGGSRGLIGGLAGLLLCLLCLAAMGLLGLFAAFIAVTAYLGDVYRALKAAGSGASGLYLNTAILLAALCFAGFHKLQRSL
Ga0210260_1025728623300030577SoilPIRRTGYRYTARPGRRYPAPPPPVARRSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFQKLRRSL
Ga0210275_1015631213300030578SoilPGVRYATRPGRRYPVRPPVRPYVPPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALIRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0247633_1028138713300030579SoilMPRIRVPVQRRGVRVTAQPGRVYPVRQSRGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVNRALRDNSASGHYVNMTILLFALCFAGYHKLRHLL
Ga0210270_127392313300030581SoilMPRVRVPVRRSGYRYTARPGRQYPAASSAGLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYNALKSASGASGHYMNMAILLAALCFAGYHKLRRSI
Ga0210261_105205013300030582SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAPARSSGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGSVWRALRNNNSASGNYVNMTILLAALGFVGYQKLRRSL
Ga0210261_112651813300030582SoilRVRVPIRRSGVRVTARPGRQYPVRPPAPARRGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGSVWRALRNNNNNTAPGIYVNSFILIAALCFAGYYKLQRSL
Ga0210262_103643313300030583SoilMPRVRVPIRRTGYRYTARPGRRYPAPPVVPARRSGLIGIIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKAAGSGASGLYLNTAILLAALCFAGFHKLQRSL
Ga0210262_104594323300030583SoilMPRIRVPVRRSGYRYTARPGVTYPIRPPPPARGRSGLLGLLGGLAGLLLCLLCLAAMGLLGLFAAFVAVTAYLGGVYRALKNANAAPGLYVNMVILLAALSFAVYNKMRRSL
Ga0210262_112961413300030583SoilPRVRVPVRRSGYRYTARPGRRYPIRPPPPPKARSGLAGLLGGLAGLLLCLLCLATLGLLGLFGAFIGVTAYLGGVYRALRNNRTGAASALSVNMVILLAAICFAGFHKLRRSL
Ga0247639_117579613300030585SoilRIRVPVRRTGVRVTTAPGRQYPVRPAPRRGLLGLLGGLGGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRSNNSAAGLYINMTILLAALCFAGFHKLQRSL
Ga0265393_121026013300030586SoilRVRVPIRRSGVRVTARPGRQYPVRPAPARSSGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGSVWRALRNNNSASGNYVNMTILLAALGFVGYQKLRRSL
Ga0210283_131306813300030588SoilKMPRVRVPVRRSGYRYAARPGRRYPIRPVAPARSGLAGLIGGLAGLLLCLLCLAALGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFQKLRRSL
Ga0210283_147067413300030588SoilMPRVRVPVRRSGYRYTARPGRRYPVRPPPPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGAAGLYVNMAILLAALCFAGFHKLQRSL
Ga0210255_1005439813300030589SoilRIRVPVRRSGYRYTARPGRRYPIRPVAPVATGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFVAVVAYLGGVYRALKAVGNDASGLYINMGVLLAALCFAGFHKLQRSL
Ga0210255_1065923313300030589SoilRVRVPVRRSGYRYAARPGRRYPVRPAAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFQKLRRSL
Ga0247643_105346723300030590SoilMPRVRVPIRRSGVRVTARPGRQYPVRPMPVAPRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDIYKALRDTGNNASGLYMNMTILLVALCFAGYHKLRRSL
Ga0210263_104920823300030593SoilGYRYTARPGRRYPAPPVVPARRSGLIGIIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKAAGSGASGLYLNTAILLAALCFAGFHKLQRSL
Ga0210263_114241913300030593SoilLKMPRVRVPIRRSGVRVTARPGRQYPVRPAPARSSGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGSVWRALRNNNSASGNYVNMTILLAALGFVGYQKLRRSL
Ga0210280_103870823300030594SoilWTFKMPRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGGVYRALNAIGGASGHEVNMAILLAGLCFVGFYKLRRSL
Ga0210280_105906813300030594SoilRSGYRYTARPGRRYPVRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210278_102056613300030596SoilMPRIRVPIRRSGIRYATRPGSRYAAPRPIYIPPPMPVQSNRGLAGLLGGLGGLLLCLLCLASLGLLGLFATFIAVTAYLSSIHSALKRLNSTATGLYMNVFILICALGFAYFNKIRRS
Ga0210278_102875013300030596SoilPRIRVPIRRSGVRYASRPGARYAAAPRPYFPPPPAARSSGLVGLLGGLGGALVCLLCLATLGLLGLFGAFIGVTAYLGGIYRTLRKENSSSGLYVNVFILICALGFAYFNKIRRSI
Ga0210286_105057523300030597SoilMPRVRVPVRRSGYRYTARPGRRYPVRPIQPARRGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASVQYANMAILLAALCFAGYHKLRRSL
Ga0210286_106787413300030597SoilRRSGYRYAARPGRRYPIRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHHMDMAILLAALCFVGFHKLRRSL
Ga0210286_106802713300030597SoilVRVPVRRSGYRYTARPGRRYPVRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210286_106899223300030597SoilRVRVPRVRVPVRRSGYRYAARPGRRYPVRPPAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALRSIGNSANVPVANMAILLAALCFAGFCKLRRSL
Ga0210286_113097113300030597SoilVRVPVRRSGYRYTTRPGRRYPVRPMPPPRARGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210287_108837833300030598SoilYPVRPMPPPRARGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGDVYRALRDAGNSASGLYVNMIILLAALCFAGFHKLQRSL
Ga0210254_1007200023300030602SoilMPRVRVPVRRSGYRYAARPGRRYPVRPAAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFNKLRRSL
Ga0210254_1023416013300030602SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALKAAGSGASGLYLNTAILLAALCFAGFHKLQRSL
Ga0210254_1088812923300030602SoilMPTVRMPVRRTGVRVNRTPIVYPPPRSGGGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKDANAASGLYVNMGILLAALCFAGFHKLRRSL
Ga0210254_1090818513300030602SoilTAEMPRVRVPVRRSGIRYAARPGRRYPVRPAPPPRRSGLAGLLGGLAGLLLCLLCLATMGLLGLFAAFIAATAYLGQIYRALRSSGPALYVNTGVLLAALCFAGFCKLRRSL
Ga0210253_1003567713300030603SoilMPRYRVPIRRSGYRRSVRPGRRYPVRPVVPVVPRPPSRGLAGIIGGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALKDAGNSASGYYMNMAILLAALCFAGYHKLRRSL
Ga0210253_1004433523300030603SoilRVRVPVRRSGYRYTARPGRRYPIRPVVAPVARSGLAGLIGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGDVYRALRDAGNAGNSASSLYVNMAILLAALCFAGYHKLRRSL
Ga0210253_1068147213300030603SoilMRTLKMPRVRVPIRRTGYRYTARPGRRYPAPPVVPARRSGLIGIIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKAAGSGASGLYLNTAILLAALCFAGFHKLQRSL
Ga0210253_1097295213300030603SoilMPRVRVPVRRSGYRYTDRPGRRYPVRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0257182_105463013300030611Host-AssociatedMPRVRVPVRRSGYRYTARPGRRYPVQPVVQPAKGGRALIGGLAGLLLCLLCLATLGLIGLFATFIAVTAYLGDVYRALRDAGNSASGLYINMAILLAALCFAGFHKLQRSL
Ga0257182_107727223300030611Host-AssociatedMPRVRVPVRRSGYRYTARPGRRYPVQPVVQPVRGSRGLIGGLAGLLLCLLCLAALGLLGLFAAFIAVTAYLGDVYRALRDAGNSASGHYVNMAILLAALCFASYHKLRRSL
Ga0257196_107840113300030612Host-AssociatedNMPRVRVPIRRSGVRYATRPGRRYPVRPPIRPYVPPRQSSGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALHRANAASGLYVNVFILSIALGFACFNKFRRSL
Ga0257196_115057013300030612Host-AssociatedMPRVRVPIRRSGVRVTARPGRQYPVRPAVAARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKAIGNNASGQYMNMTILLAALCFAGYHKLRRSL
Ga0257196_117464813300030612Host-AssociatedPGRRYPIRPPPPPARRSGLAGLLGGLVGLLLCLLCLATLGLLGLFGAFIAVTAYLGGVYRALRNNRTGGASGLYMNMAILLAALCFVGYQKLRRSL
Ga0257185_1005013313300030615Host-AssociatedMPRVRVPIRRSGVRVTARPGRQYPVRPAPPPRRGGLIGLLGGLAGILLCLLCLATLGLLGLFATFIAVTAYLGDVWRALRDNNSASGNYVNMAVLLAALGFVSYQKLRRSL
Ga0257185_1008336923300030615Host-AssociatedMPRIRVPIRRSGVRVTSRPGRQYPIRPAPPARRGLAGLLGGSAGLLLCLLCLAALGLLGLFATFIAVTAYLGNVYRALRDTNSASAHHMNMAIMLGALCFVGYHKLRRLL
Ga0257185_1008576013300030615Host-AssociatedMPRVRVPVRRSGYRYTARPGRRYPIRPPPPARGGLAGLLGGLAGLLLCLLCLAALGLLALFATFIAVTAYLGGVYRALRNNRTGTASALNVNMIVLLAAVCFAGFHKLRRSL
Ga0257185_1008877623300030615Host-AssociatedSRVRVPIRRTGYRRSFRPGRRYPIRPIVPVVPIPPPRTRGLAGIIGGLSGLLLCLLCLATLGLLGLFATFIAVTAFLGDVYRALKDQDNSASGYYVNMAILLAALCFAGYHKLHRSL
Ga0247655_1005082913300030621SoilMPRVRVPVRRSGYRYTARPGRRYPVAPPPRRGGAGLLGGLAGLLLCLLCLATLGLLGLFGAFIAVTAYLGGVYRALRDGGSGASGLYVNMAILLASLCFAVYHKLQRSS
Ga0247655_1005616323300030621SoilMPRVRVPIRRSGVRVTARPGRQYPVRPIPVAPRRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDVGNSASGHYMNMTILLVALCFAGYHKLRRSL
Ga0265391_1003815813300030622SoilGRAPKMPRIRVPVRRSGYRYTARPGRRYPVQPAKRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0265392_101900813300030623SoilINMPRVRVPIRRSGVRYATRPGRRYPVRPPIRPYVAPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0265392_103969623300030623SoilPRIRVPVRRSGYRYTARPGVTYPIRPPPPARGRSGLLGLLGGLAGLLLCLLCLAAMGLLGLFAAFVAVTAYLGGVYRALKNANAAPGLYVNMVILLAALSFAVYNKMRRSL
Ga0210251_1005412713300030624SoilMPRVRVPIRRSGVRSTVRPGRQYPARPPPRSTGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDIYRALRNTGSSAPGLYMNMTILLAALGFAGYHKLRRSL
Ga0210251_1013691813300030624SoilMPRVRVPVRRSGYRYTARPGRRYPVRPQRSGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNGNGSGASGLYVNMAILLAALCFAGYHKLRRSL
Ga0210251_1042204123300030624SoilGYRYTARPGRRYPVRPAPPPRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNGASGHYVNMTILLAALCFAGYHKLRRSL
Ga0210251_1101782423300030624SoilMPRYRVPIRRSGYRRSVRPGRRYPVRPVVPVVPPPKSRGLAGLIGGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALKDAGNSASGYYMNMAILLAALCFAGYHKLRRSL
Ga0210259_1062470513300030625SoilRVRVPVRRSGYRYTARPGRRYPVRPIQPARRGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASVQYANMAILLAALCFAGYHKLRRSL
Ga0210291_1007311213300030626SoilRVRVPVRRSGYRYTARPGRRYPIRPPPPPARRSGLAGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGGVYRALRNNRTGGASGLYMNMAILLAALGFVGYQKLRRSL
Ga0210291_1133925913300030626SoilKMPRIRVPVRRSGYRYTARPGRRYPVQPAKRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0210291_1136525723300030626SoilTLKMPRVRVPVRRSGIRYTSRPGRRYPVRPVVPVAPSRGIGGLLGGLGALLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGGSGSGASGHYVNMAIVLAALCFAGYHKLRRSL
Ga0210291_1136635113300030626SoilTLKMPRVRVPIRRSGVRVTARPGRQYPVRPAVARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0210291_1186892913300030626SoilGVRVPVRRSGYRYAARPGRRYPIRPVAPARSGLAGLIGGLAGLLLCLLCLAALGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFNKLRRSL
Ga0210269_1007193713300030627SoilMPRVRVPVRRSGYRYAARPGRRYPVRPPAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALRSIGNSANVPVANMAILLAALCFAGFCKLRRSL
Ga0210269_1012921633300030627SoilMPRVRVPVRRSGYRYAARPGRRYPVRPAAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHHMDMAILLAALCFVGFHKLRRSL
Ga0210269_1021282813300030627SoilGVRYATRPGRRYPVRPAPPPAAGRGGLLGLLGGLAGLLLCLLCLATMGLLGLFAAFVAVTAYLGNIYSAIKNDGTALYTNMFVLLAALCFAGFCKLRRSL
Ga0210269_1035277013300030627SoilPRVRVPVRRSGYRYTTRPGRRYPVRPMPPPRARGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210268_125164813300030629SoilMPRVRVPVRRSAYRSTTRPGRRYPVRPMPPPRARGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASGLYVNMAILLAALCFAGFHKLQRSL
Ga0210268_126931013300030629SoilVRVPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMSIVLAALCFVGYHKLRRLL
Ga0210282_1003245613300030630SoilMPRVRVPIRRSGVRYATRPGRRYPVRPPVRPYVPPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0210282_1031674913300030630SoilRVRVPVRRSGYRYTARPGRRYPIRPVVQPKGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNGASGHYVNMTILLAALCFAGYHKLRRSL
Ga0210279_1007898213300030631SoilRVRVPIRRSGVRYATRPGRRYPVRPPIRPYVAPKQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0210279_1045432823300030631SoilPTVRMPVRRTGVRVNRTPIVYPPPRSGGGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKDANAASGLYVNMAILLAALCFAGFHKLRRSL
Ga0210250_1015239913300030632SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGAPDHYMNMSIVLAALCFVGYHKLRRLL
Ga0210250_1037903623300030632SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAVAPARRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKTLGNSAPGHYTNMTILVLALCFVGYHKLRRLL
Ga0210250_1135214713300030632SoilMPRIRVPVRRSGYRYTARPGRRYPVPQKRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDANNGNSASGLYINMTILLAALCFAGFHKLQRSL
Ga0247623_1006699033300030633SoilMPRVRVPIRRSGVRVTARPGRQYPVRPVVPVRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYKALRDTGSSASGHYMNMTILMVALCFAGYHKLRRSL
Ga0265462_1046943913300030738SoilMPRVRVPVRRSGYRYTARPGRRYPIRPPPPPKARSGLAGLLGGLAGLLLCLLCLATLGLLGLFGAFIGVTAYLGGVYRALRNNRTGAASALSVNMVILLAAICFAGFHKLRRSL
Ga0265462_1053107023300030738SoilMPRYRVPIRRTGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKDQDNSASGFYVNMAILLAALCFAGYHKLHRSL
Ga0265462_1055879723300030738SoilPRVRVPVRRSGYRYAARPGRRYPVRPPAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALRSIGNSANVPVANMAILLAALCFAGFCKLRRSL
Ga0265462_1062882123300030738SoilLRVRVPVRRSGYRYTTRPGRLYPVRPMPPPRARGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASGLYVNMAILLAALCFAGFHKLQRSL
Ga0265462_1063807423300030738SoilMPRVRVPVRRSGYRYTARPGRRYPIRPPPPPARRSGLAGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGGVYRALRNNRTGGASGLYMNMAILLVALGFVGYQKLRRSL
Ga0265462_1073770423300030738SoilRYRVPVRRSGIRYTARPPRMYPPVAPRRRGGLLALLGGLAGLLLCLLCLATIGLLGLFAAFIAVTAYLGDVYRALRRANAAPSLYFNMIVLLAALCFAGYHKVRRSL
Ga0265462_1074638113300030738SoilRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASGLYMNMAILLAALCFAGFYKLRRSL
Ga0265462_1075907723300030738SoilPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMSIVLAALCFVGYHKLRRLL
Ga0265462_1113258413300030738SoilRSGYRYTARPGRRYPVRPQRSGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNGNGASGLYVNMAILLAALCFAGYHKLRRSL
Ga0265462_1115766613300030738SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNGASGHYVNMTILLAALCFAGYHKLRRSL
Ga0265462_1244475223300030738SoilPRVRVPIRRSGVRVTARPGRQYPVRPAVARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0265460_1031290623300030740SoilMPRVRVPVRRSGYRYTTRPGRRYPVRPMPPPRARGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASGLYVNMAILLAALCFAGFHKLQRSL
Ga0265460_1079133613300030740SoilPGRRYPVQPAPVAGGSRGLIGGLAGLLLCLLCLAAMGLLGLFAAFIAVTAYLGDVYRALRDAGSNASGLYVNMAVLLAALCFAGFHKLQRSL
Ga0265460_1083048513300030740SoilRVRVPVRRSGIRYAARPGRRYPIRPVAPPPRRGGLAGLLGGLAGLLLCLLCLAAMGLLGLFAAFIAATAYLGNIYRDLNNSGPALYVNMSVLLVALCFASFYKLRRSL
Ga0265460_1086856943300030740SoilLKMPRYTRPSRRVGVRPIPRPVAARAQSGGLLGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGNVYRALRNLNAAPGLYINMGILMAALCFACYHKLQRSL
Ga0265460_1087512913300030740SoilLKMPRVRVPVRRSGYRYTARPGRRYPVRPIQPARRGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASVQYANMAILLAALCFAGYHKLRRSL
Ga0265460_1094679533300030740SoilRRSGVRATVRPGRQYPVRPPRQGTGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDIYRALRNTGSAAPGLYVNMTILLAALCFAGYHKLRRSL
Ga0265460_1096134523300030740SoilMPRVRVPIRRSGVRVTARPGRQYPVRPPAPARRGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGSVWRALRNNNNNTAPGIYVNSFILIAALCFAGYYKLQRSL
Ga0265460_1108808113300030740SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMSIVLAALCFVGYHKLRRLL
Ga0265460_1113816313300030740SoilKMPRYRVPIRRSGYRRSVRPGRRYPVRPVVPVVPPPKSRGLAGLIGGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALKDAGNSASGYYVNMVVLVAALCFAGYHKLRRSL
Ga0265460_1115618913300030740SoilLSFRRSGYRYTARPGRRYPIRPVAPARSGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFVAVTAYLAEVYHALRSVGNSASGHYVNMAILLGALCFAGYHKLRRSL
Ga0265460_1287091513300030740SoilMPRVRVPVRRSGYRYAARPGRRYPIRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFAAFIATTAYLGGVYRALRSIGNTASGHYVNMGILLAALCFVGFQKLRRSL
Ga0265459_1018195913300030741SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMTMLVAALCFVGYHKLRRLL
Ga0265459_1072058213300030741SoilMPRVRVPVRRSGYRYTTRPGRRYPVRPVPPPRARGGLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLAKVYHALQAAGSGASGLYVNMAILLAALCFAGFHKLQRSL
Ga0265459_1094483613300030741SoilMPRVRVPIRRSGVRATVRPGRQYPARPPPRSTGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDIYRALKNTGSSAPGLYMNMTILLAALCFAGYHKLRRSL
Ga0265459_1109610313300030741SoilGIRYAARPGRRYPVRPVAPPPKRGGLAGLLGGLAGLLLCLLCLATLGLLGLFGAFIAATAYLGSIYRALKNSGPALYVNMSVLLAALCFAGFCKLRRSL
Ga0265459_1120000533300030741SoilPRVRVPIRRSGVRVTARPGRQYPIRPAVAPARRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKTLGNGTPGLYANMAILLAALCFAGYHKLRRSL
Ga0265459_1120719113300030741SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASGLYMNMAILLAALCFAGFYKLRRSL
Ga0265459_1154333133300030741SoilSGIRYAARPGRRYPIRPVAPPPRRGGLAGLLGGLAGLLLCLLCLAAMGLLGLFAAFIAATAYLGNIYRDLNNSGPALYVNMSVLLVALCFASFYKLRRSL
Ga0265459_1184093413300030741SoilMPTVRMPVRRTGVRVNRTPIVYPPPRSGGGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKDANAASGLYVNMAILLAALCFAGFHKLRRSL
Ga0265459_1261686313300030741SoilRRSGYRYTARPGRRYPVRPAPPARGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYINMTILLAALCFAGLHKLRRSL
Ga0265461_1039774413300030743SoilMPRVRVPIRRSGVRYATRPGRRYPVRPPIRPYVAPNQSRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKRANGASGLYVNVFILLIALGFACFNKFRRSL
Ga0265461_1062164113300030743SoilMPRVRVPIRRSGVRYATRPGRRYPIRPQPYIPPRQNRGLAGILGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKRANGASGLYVNVFILFIALGFACFKKFRRSL
Ga0265461_1093456013300030743SoilMPRVRVPIRRTGYRRSVRPGRRYPVRPVVPVVPRAPSRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGNSASGYYVNMVVLVAALCFAGYHKLRRSL
Ga0265461_1095571713300030743SoilRVRVPIRRSGVRVTARPGRQYPVRPPAPARRGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKTLGNDTPGLYANMAILLAALCFAGYHKLRRSL
Ga0265461_1097534513300030743SoilPVRRSGYRYTARPGRRYPIRPPPPPKARSGLAGLLGGLAGLLLCLLCLATLGLLGLFGAFIGVTAYLGGVYRALRNNRTGAASALSVNMVILLAAICFAGFHKLRRSL
Ga0265461_1106254213300030743SoilRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGSNTASGLYVNMTILLAALCFAGYHKLRRSL
Ga0265461_1109618913300030743SoilLRVRVPIRRSGVRYTARPGRRYPAPPAPARGGRGLIGGLAGLLLCLLCLATMGLLGLFATFIAVTAYLGSVYRALRDTGSSASGHYMSMTMLLAALCFVGYHKLRRSL
Ga0265461_1216858213300030743SoilLPTVRMPVRRTGVRVNRTPIVYPPPRSGGGGLLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKDANAASGLYVNMAILLAALCFAGFHKLRRSL
Ga0265461_1240684913300030743SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMSIVLAALCFVGYHKLRRLL
Ga0074008_1005984223300030754SoilPRVRVPIRRSGVRVTARPGRQYPVRPAVAARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKAIGNNASGQYMNMTILLAALCFAGYHKLRRSL
Ga0315877_13444923300030768Plant LitterMPRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPARGGRGLLGGLAGLLLCLLCLATLGLLGLFASFIAVTAYLGDIYRALRDTGNSASGLYINMAILLAALCFAGFHKLQRAL
Ga0074007_1093199513300030774SoilKMPRVRVPIRRSGVRVTARPGRQYPVRPAVAARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKAIGNNASGQYMNMTILLAALCFAGYHKLRRSL
Ga0074021_100839113300030775SoilMPRVRVPIRRSGVRYATRPGRHIPVRPRPVIQPQSNRGLAGILGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKRANAASGLYVNVFILFIALGFACFNKFRRSL
Ga0074021_185592523300030775SoilMPRVRVPVRRSGYRYTARPGRRYPAASGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKSAGNSASGHYVNMAILLAALCFAGYHKLRRSI
Ga0075398_1208445713300030778SoilRVRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0075398_1210369313300030778SoilMPRVRVPVRRSGYRYTARPGRRYPVQPVVQPARGGRGLIGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGGVYRALRDAGNNASGHYVNMAILLAALCFAGYHKLRRSI
Ga0075398_1215925413300030778SoilRVRVPVRRSGYRYTARPGRRYPVRPPPPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGAAGLYVNMAILLAALCFAGFHKLQRSL
Ga0075398_1220857923300030778SoilRRSGYRYTARPGRRYPVQPVVQPARGGRGLIGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGGVYRALRDAGNSASGLYINMAILLAALCFAGFHKLQRSL
Ga0102754_105066533300030782SoilGVRVTARPGRQYPVRPAPARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL
Ga0102754_196146113300030782SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAVARSNRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0102758_1000771913300030784SoilLKMPRVRVPVRRSGIRYTARPGRRYPVRPAAPARGGRGLLGGLAGLLLCLLCLATLGLLGLFGAFIAVTAYLGDVYRALRDANSSASGLYMNMAILLAALCFAGYHKLRRSL
Ga0102758_1097868013300030784SoilVRVPVRRSGIRYTARPGRRYPVRPVAPARGGRGLLGGLAGLLLCLLCLATLGLLGLFGAFIAVTAYLGDVYRALRDANSSASGLYINMAILLAALCFAGYHKLQRLL
Ga0102758_1105835413300030784SoilRIRVPVRRSGYRYTARPGRRYPIRPVAPPRRSGLAGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDTGNAASGLYVNMAILLAALCFAGFYKLRRSL
Ga0102758_1108571813300030784SoilRRIRVPIRRSGVRITARPGRQYPVRPAVVPVRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDARNSASGLYINMIILLAALCFAGFHKLRRSL
Ga0074010_1107282113300030799SoilVRRSGYRYTARPGRRYPIRPPPPPARRSGLAGLIGGLAGLLLCLLCLATLGLLGLFGAFIAVTAYLGGVYRALRNNRTGAASGLYMNMAMLLAALCFVGYQKLRRSL
Ga0073999_1001352033300030839SoilPRVRVPVRRSGYRYTARPGRRYPVRPAPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYINMTILLAALCFAGLHKLRRSL
Ga0074020_1003444813300030840SoilMPRVRVPVRRSGLRYTTRPGRRYPRPPPPRPARGGLMGLLGGLAGLLLCLLCLAAMGLLGLFAAFIAVTAYLGGVYRALRDSNAASGLYVNMVILLAALCFAGFHKVRRSL
Ga0075403_1091410823300030846SoilGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGNVYRNLRDANGASGLYLNMAILLGALCFVGYHKLRRSL
Ga0075387_1013018813300030850SoilMPRVRVPLRRSGVRYATRPGRRYPVRPAPAPAAGRGGLLGLLGGLAGLLLCLLCLATMGLLGLFAAFVAVTAYLGNIYSAIKNDGTALYTNMFVLLAALCFAGFCKLRRSL
Ga0075387_1181040413300030850SoilMPRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNSASGLYVNMAILLAALCFAGFHKLRRSL
Ga0102759_171783413300030858SoilPRIRVPIRRSGVRITARPGRQYPVRPAVVPVRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDARNSASGLYINMIILLAALCFAGFHKLRRSL
Ga0315855_12660213300030864Plant LitterMPRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRDTGNSASGLYINMAILLAALCFAGFHKLQRAL
Ga0315855_12695713300030864Plant LitterMPRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPARSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRDTNGNTAASAHYVNMAIILAGLCFAGYHKLRRSL
Ga0102749_125808913300030867SoilEMPRVRVPVRRSGIRYAARPGRRYPVRPAPPPRRGGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAATAYLGQIYRALRSSGPALYVNTGVLLAALCFAGFCKLRRSL
Ga0074013_1005663623300030907SoilRRSGYRYTARPGRRYPVQPVVQPAKGGRALIGGLAGLLLCLLCLATLGLIGLFATFIAVTAYLGDVYRALRDAGNSASGLYINMAILLAALCFAGFHKLQRSL
Ga0074013_1162771023300030907SoilMPRVRVPVRRSGYRYTARPGRRYPVAQSSGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGSIYRALKSAGSNASGHYVNMAILLAALCFAGYHKLRRSI
Ga0074013_1183123913300030907SoilMPRVRVPIRRSGVRVTARPGRQYPVRPVVAPARRRGLIGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGKVYRALRAVGNDASGLNMNMTILLAALCFVGYHKLRRLL
Ga0074013_1192468133300030907SoilTLKMPRVRVPIRRSGYRYTARPGRRYPVRPAVVQPARGGLGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGQVYRALRDVNNGNSASGHYVNMTILLAALCFAGYHKLRRSL
Ga0074033_1001801323300030909SoilPRVRVPIRRSGVRVTARPGRQYPVRPAPARGSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASGLYMNMAILLAALCFAGFYKLRRSL
Ga0102763_1000346823300030911SoilGRRYPVRPAPPPRRGGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAATAYLGQIYRALRSSGPALYVNTGVLLAALCFAGFCKLRRSL
Ga0102763_1124113213300030911SoilPRVRVPIRRSGVRITARPGRQYPVRPVPVAPRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDARNNASGLYMNMAILLVALCFAGYHKIRRSL
Ga0138300_108576323300030922SoilMPRVRVPVRRSGYRYTARPGRRYPVAPPPAKGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKTAGGSANGLYVNMTILLAALCFAGFLKLRRSL
Ga0138300_122818113300030922SoilPRVRVPVRRSGYRYTARPGRRYPVAPVAPARGGKGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKSAGGVAPGLYVNMAVLFAALFFAVYHKLQRSL
Ga0138300_139239413300030922SoilMPRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALSAIGNTASGQYMNMGILLAALCFVGFYKLRRSL
Ga0138300_143900223300030922SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVVQPARGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGEVYRALRDANNSASGLYINTVILLAALCFAGFHKLQRSL
Ga0138300_168783623300030922SoilMPRVRVPVRRSGYRYTARPGRRYPIRPAPQRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGHYVNMAILMAAVCFAGYHKIRRAL
Ga0138300_172940013300030922SoilRYRVPIRRTGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSAPGHYVNMAILLAGLCFVGYHKLRRSL
Ga0138296_143499423300030923SoilMPRVRVPLPPRLGAPIPYPVRPSGGGGAAGLLGLLGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGWIYRAVRAAGNGTSVNYMNMAILLAALCFAGYHKLRRSL
Ga0074006_1005796913300030931SoilMPRVRVPVRRSGYRYTARPGRRYPVRPAPPPRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGHYVNMAILLAAVCFAGYHKIRRTL
Ga0074006_1153038513300030931SoilRIRVPIRRSGVRVTSRPGRQYPIRPAPPPRRGLAGLLGGLAGLLLCLLCLAALGLLGLFATFIAVTAYLGSVYRALRDTNGNAASGLYVNMAILLAALCFAGFYKLRRSL
Ga0074006_1155036113300030931SoilPVRRSGYRYTARPGRRYPVRPAPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYINMTILLAALCFAGLHKLRRSL
Ga0074039_1003378513300030933SoilRVPVRRTGVRVTTAPGRQYPVRPAPRRGLLGLLGGLGGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRSNNSAAGLYINMTILLAALCFAGFHKLQRSL
Ga0074039_1145501133300030933SoilKMPRVRVPVRRSGYRYTARPGRRYPIPPPAKRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRSAGNGASGLYINMVILLAALCFAGFHKLQRSL
Ga0074039_1151011113300030933SoilVRRSGYRYTARPGRRYPVRPAPARRGGRGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLRRSL
Ga0074039_1151882513300030933SoilRSGYRYTARLGRRYPIRPVTVVQPSRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDINNSASGLYINMAILMAALCFAGFHKLQRSL
Ga0074039_1166110513300030933SoilGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKDQDNSASGYYVNMVILLAALCFAGYHKLHRSL
Ga0075401_1150863813300030935SoilLRVRVPVRRSGYRYTARPGRRYPVPPPAPARGGLLGLLGGLAGLLLCLLCLAAIGLLALFSIFVAVVTYLGQVYRALKDANTASGLYVNMTILLAALCFAGFHKLRRSL
Ga0138299_1003485323300030938SoilRVRVPVRRSGYRYTARPGRRYPVRPAPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGHYVNMAILMAAVCFAGYHKIRRAL
Ga0138299_1003556313300030938SoilRVRVPVRRSGYRYTARPGRRYPVAPPPARGGRGLLGGLAGLLLCLLCLATLGLLGLFASFIAVTAYLGDVYRALKSAGGSANGLYVNMTILLAALCFAGFLKLRRSL
Ga0138299_1010038123300030938SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVVAAPARSGGRGLLGGLAGLLLCLLCLATLGLIGLFATFIAVTAYLGDVYRALRDAGNGSASGLFVNMAILMVALCFAGYHKLRRSL
Ga0138299_1051476513300030938SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVVQQRRGGLGLLGGLAGLLICLLCLAALGLLGLFAAFIAVTAYLGDVYRAVRDAGGNSASGLYMNMAILLAGLCFAGYHKLRRSL
Ga0138299_1060831413300030938SoilPRVRVPVRRSGYRYTARPGRRYPVRPVVQPARSGGGRGLLGGLAGLLLCLLCLATLGLIGLFATFIAVTAYLGDVYRALRDAGNGNASGLFVNMAILLAALCFAGFHKLQRSL
Ga0138299_1084608613300030938SoilKMPRVRVPVRRSGYRYTARPGRRYPVRPAPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYINMTILLAALCFAGLLKLRRSL
Ga0138299_1098938413300030938SoilMPRIRVPIRRSGYRYTTRPGRQYPVVPVAPPARSNRGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNAASGLYINMAILLAALCFAGFYKLQRSL
Ga0075379_1136240713300030946SoilRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNSASGLYVNMAILLAALCFAGFHKLRRSL
Ga0102747_1122176233300030959SoilRIRVPVRRSGYRYTARPGRRYPVRPIAPPRARSGLAGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDTGNAASGLYVNMVILLAALCFAGFYKLHRSL
Ga0075400_1147036913300030972SoilTRPGRRYPPRPLPPPKSNRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALHRANAASGLYVNVFILFIALGFACFNKFRRSL
Ga0075400_1181300013300030972SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0068589_1172460913300030979SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL
Ga0074040_1101615013300030992SoilRVRVPVRRSGYRYTARPGRRYPVRPVVQKRSGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALRDSGNSASGLYMNMAMLLAAVCFAGYHKLRRSL
Ga0074040_1127653113300030992SoilRRSGYRYTARPGRRYPVRPVQPRRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLQRSL
Ga0074040_1130483513300030992SoilAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGYYMNMAILLAALCFAGYHKLRRSL
Ga0074019_1088735313300030999SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAVAPARRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKAAGSGASGLYLNTAILLAALCFAGFHKLQRSL
Ga0074019_1103669513300030999SoilRVRVPVRRSGYRYTARPGRRYPVRPPPQRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGQVYRALRDVNGGNAASGLYVNMAILLAALCFAGYHKLRRSL
Ga0074038_1003295923300031008SoilRVTAQPGRQYPVRPQRRGLLGLLGGLGGLLLCLLCLATLGLIGLFATFIAVTAYLGDVYRALRDINNSASGLYINMAILMAALCFAGFHKLQRSL
Ga0074038_1168171623300031008SoilMPRVRVPIRRTGYRYTARPGRRYPVPPVAPRRSGLIGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLASVYHALRDAGSSASGLYVNMAILLAALCFAGYHKLRRSL
Ga0102765_1003301013300031021SoilRVRVPIRRSGVRVTARPGRQYPVRPAPARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL
Ga0102765_1003545513300031021SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGHYVNMAILLAALCFAGYHKLRRSL
Ga0102765_1005977523300031021SoilRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPVRSGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNAASGLYINMAILLAALCFAGFHKLQRSL
Ga0102765_1146741813300031021SoilRVRVPIRRSGVRVTARPGRQYPVRPAVARSNRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0073998_1111865313300031023SoilPRVRVPIRRSGVRYATRPGRRYPVRPPIRPYVPPRQSSGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALHRANAASGLYVNVFILSIALGFACFNKFRRSL
Ga0074012_1161760423300031029SoilMPRVRVPIRRSGYRYTARPGRRYPVRPAVVQPARGGLGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGKVYRALRSVGNDASGLNMNMTILLAALCFVGYHKLRRLL
Ga0074012_1162157433300031029SoilRRSGYRYTARPGRRYPVQPVVQPVRGSRGLIGGLAGLLLCLLCLAALGLLGLFAAFIAVTAYLGDVYRALRDAGNSASGHYVNMAILLAALCFASYHKLRRSL
Ga0074042_1135554323300031031SoilRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALNAIGGASGHEMNMAILVAALCFVGFYKLRRSL
Ga0074042_1143347623300031031SoilGRRYPIRPVTVVQPSRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDINNSASGLYINMAILMAALCFAGFHKLQRSL
Ga0074041_1129610713300031034SoilRPGRRYPIPPPAKRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRSAGNGASGLYINMVILLAALCFAGFHKLQRSL
Ga0074026_1099979713300031035SoilMPRVRVPIRRSGIRYATRPGARYAAPRPIYIPPPPQQSNRGLAALLGGLGGLLLCLLCLATLGLLGLFAAFIAVTAYLHDIYKALKRQNNSASGLYMNVFILIFALGFAYFNKIRRS
Ga0074036_1128194613300031049SoilVPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMTMLVAALCFVGYHKLRRLL
Ga0074018_174224013300031053SoilRVTARPGRQYPVRPAVAPARRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKTLGNSAPGHYTNMTILVLALCFVGYHKLRRLL
Ga0170834_10096853723300031057Forest SoilVPVRRSGYRYTARPGRRYPVRPVVQPARGGRGLLGGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALRDAGNSASGHYVNMAILLAALCFAGYHKLRRSL
Ga0170834_10518105623300031057Forest SoilMPRVRVPVRRSGYRYTARPGRRYPVRPPPPARRGGLGLLSGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGAAGLYVNMAILLAALCFAGFHKLQRSL
Ga0170834_10545095513300031057Forest SoilPRVRVPVRRSGYRYTARPGRRYPVRPVVQPRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGASGHYVNMAILLAALCFAGYHKLRRSL
Ga0170834_10576568313300031057Forest SoilLITTYQEXTLKMPRYRVPIRRTGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATMGLLGLFATFIAVTAYLGDVYRALKDQDNSASGFYVNMAILLAALCFAGYHKLHRSL
Ga0170834_10808548013300031057Forest SoilMPRIRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0170834_10836580213300031057Forest SoilRVRVPVRRSGYRYTARPGRRYPVRPVVQPARGGKGLLGGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLQRSL
Ga0170834_10877417813300031057Forest SoilMPRVRVPVRRTGYRYTTRPGRQYPVRPVAPPPARRGGLAGLIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGASSTASGLYVNMTILLAALCFAGFHKLRRSL
Ga0170834_11380136713300031057Forest SoilRPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNTASIPYVNMAILLAALCFAGFYKLRRSL
Ga0102748_1127476113300031089SoilTLKMPRVRVPIRRSGVRVTARPGRQYPVRPAVARSNRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSSASGHYMNMTILLAALCFAGYHKLRRSL
Ga0170822_1222593513300031122Forest SoilVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNTASIPYVNMAILLAALCFAGFYKLRRSL
Ga0170822_1330618513300031122Forest SoilLKMPRVRVPVRRSGYRYTARPGRRYPVRPVVQPKRGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALRDSGSSASGLYINMAILLAALCFAGFHKLQRSL
Ga0170822_1359352713300031122Forest SoilKMPRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNSASGLYVNMAILLAALCFAGFHKLRRSL
Ga0170823_1139815313300031128Forest SoilPRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNSASGLYVNMAILLAALCFAGFHKLRRSL
Ga0170823_1155562923300031128Forest SoilRVRVPVRRSGYRYTARPGRRYPVRPVVQPARGGRGLLGGLAGLLLCLLCLATMGLLGLFATFVAVTAYLGDVYRALRDAGNSASGHYVNMAILLAALCFAGYHKLRRSL
Ga0170823_1242608423300031128Forest SoilVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNTASIPYVNMAILLAALCFAGFYKLRRSL
Ga0170823_1518580233300031128Forest SoilLRVRVPVRRSGYRYTARPGRRYPVPPPAPARGGLLGLLGGLAGLLLCLLCLAAIGLLALFSIFVAVVAYLGQVYRALKDANTASGLYVNMAVLLAALCFAGFHKLRRSL
Ga0170823_1705808323300031128Forest SoilMPRVRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSSAPGLYMNMTILLAALCFAGYHKLRRSL
Ga0170823_1731238213300031128Forest SoilRRSGYRYTARPGRRYPVRPVVQPRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGASGHYVNMAILLAALCFAGYHKLRRSL
Ga0170824_10246623613300031231Forest SoilMPRVRVPVRRSGYRYTARPPIRYPARPPTPPRRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVVAYLGQVYHALRDAGSAAPGLYVNMGILLAALCFAGYHKLRRSL
Ga0170824_10502459813300031231Forest SoilMPRVRVPIRRTGYRSTIRPGRQYPVAPVAPPPARRGGIAGLIGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDSGSSAASGLYVNMTILLAALCFAGFHKLRRSL
Ga0170824_10599711723300031231Forest SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVVQPRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRDAGTGGASGHYVNMAILLAALCFAGYHKLRRSL
Ga0170824_10808169413300031231Forest SoilVRRSGYRYTARPPIRYPARPVPPRRGLAGLLGGLAGLLLCLLCLATLGLLGLFATFVAVVAYLGEVYHALRDAGSNASGHYVNMGILLAALCFAGYHKLRRSL
Ga0170824_11078830023300031231Forest SoilPRVRVPIRRSGVRVTARPGRQYPVRPVAPRRGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGNVYRNLRDANGASGLYLNMAILLGALCFVGYHKLRRSL
Ga0170824_11079595423300031231Forest SoilPRVRVPVRRSGYRYTARPGRRYPVAPVAPARGGKGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKSAGGAAPGLYVNMAVLFAALFFAVYHKLQRSL
Ga0170824_11100956423300031231Forest SoilMPRVRVPVRRSGYRYTARPGRRYPVQPIVQPARGGRGLIGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGGVYRALRDAGNSASGLYINMAILLAALCFAGFHKLQRSL
Ga0170824_12222791523300031231Forest SoilRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKAAGNTASIPYVNMAILLAALCFAGFYKLRRSL
Ga0170824_12686011123300031231Forest SoilKIRVPVRRSGVRYRARPGRRYPPPIIVPPKRRGLGGLIGGLAGLLLCLLCLATLGLLGLFGAFIAVTAYLGEICDALEEINGDDGASGLFLNMAMLLAALCFIGYYKLRRSL
Ga0170824_12710154123300031231Forest SoilRIRVPIRRSGVRVTARPGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL
Ga0170824_12819972523300031231Forest SoilMPRVRVPVRRSGYRYTARPGRRYPVRPPPPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGTGGAAGLYVNMAILLAALCFAGFHKLQRSL
Ga0102761_1008900413300031411SoilRVRVPIRRSGVRVTARPGRQYPVRPGAPARGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGNGAPGLYVNMGILLAALCFAGFYKLRRSL
Ga0102761_1012784213300031411SoilVPVRRSGIRYAARPGRRYPVRPAPPPRRGGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAATAYLGQIYRALRSSGPALYVNTGVLLAALCFAGFCKLRRSL
Ga0102761_1268018313300031411SoilMPRVRVPIRRSGVRVTARPGRQYPVRPGAPARGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGNSAPGLYLNMTILLAALCFAGYHKLRRSL
Ga0102761_1270211923300031411SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPKRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGHYVNMAILLAALCFAGYHKLRRSL
Ga0170819_1062645813300031469Forest SoilPRVRVPIRRSGVRYATRPGRRYPPRPLPPPKSNRGLAGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALHRANAASGLYVNVFILFIALGFACFNKFRRSL
Ga0170819_1194962913300031469Forest SoilGRQYPVRPAVARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSAAPGLYANMTILLAALCFAGFLKLRRSL
Ga0170819_1590735413300031469Forest SoilPRVRVPVRRSGYRYTARPGRRYPVRPPPPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGTGGAAGLYVNMAILLAALCFAGFHKLQRSL
Ga0170819_1728104223300031469Forest SoilPRVRVPVRRSGYRYTARPGRRYPVQPVVQPARGGRGLIGGLAGLLLCLLCLATMGLLGLFAAFIAVTAYLGGVYRALRDAGNSASGLYINMAILLAALCFAGFHKLQRSL
Ga0170818_10025497413300031474Forest SoilRAMRPGRRYPIRPIVPVVPVPPPRTRGLAGIIGGLAGLLLCLLCLATMGLLGLFATFIAVTAYLGDVYRALKDQDNSASGYYVNMAILLAALCFAGYHKLHRSL
Ga0170818_11204915813300031474Forest SoilPRVRVPIRRSGVRVTARPGRQYPVRPAVRPARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALRDTGSSAPGLYMNMTILLAALCFAGYHKLRRSL
Ga0257195_1011523743300032169Host-AssociatedARPGRRYPVRPAPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYINMTILLAALCFAGLHKLRRSL
Ga0257195_1038349213300032169Host-AssociatedPIRRSGVRVTARPGRQYPVRPAVRPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDIYRALRDTGSNASGLYMNMTILLAALCFAGYHNITPIIINNKFHLFLCSSKHRRC
Ga0314670_1028533013300032470SeawaterMPRIRVPVRRSGYRYTARPGIRYPVRPVARSRSGGGLLGLLGGLAGLLLCLLCLSTLGLLGLFASFIAVTAYLGQVARAVRDLGGNNASGLYMNMAILLAALCFAGFHKLHRSL
Ga0348332_1053211713300032515Plant LitterMPRVRVPVRRSGYRYTARPGRRYPIRPPPPARGGLAGLLGGLAGLLLCLLCLAALGLLGLFATFIAVTAYLGAVYRALRNNRTGTASGLNVNMIILLAAVCFAGYHKLRRSL
Ga0214500_109187313300032589Switchgrass PhyllosphereMPRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPARSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRDTGNSASGLYINMAILLAALCFAGFHKLQRAL
Ga0321338_113952213300032593Switchgrass PhyllosphereMPRVRVPIRRSGYRYNARPGRRYPVRPVTVVQPGSRGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALSTSGTVHTASYLNMIVLLAALCFAGYHKLRRSL
Ga0321338_117419713300032593Switchgrass PhyllosphereMPRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPARRGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRDTGNSASGLYINMAILLAALCFAGFHKLQRAL
Ga0321338_124067913300032593Switchgrass PhyllosphereMPRVRVPIRRSGIRYTARPGRPYPVAPKARTGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDVGGNASGLYANMAILLAALCFAGYHKLRRSL
Ga0321338_137896113300032593Switchgrass PhyllosphereMPRVRVPIRRSGYRYSARPGRRYPVRPVAVAPQRSGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVVAYLGDIYRAIRDGGINSSATGLYANMLILLAALCYAGFHKLQRAL
Ga0321338_138592423300032593Switchgrass PhyllosphereMPRVRVPVRRSGYRYTARPGRRYPVRPVTVVQPARGGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRDTGNSASAHYVNMAIILGALCFAGYHKLRRSL
Ga0214499_110347433300032697Switchgrass PhyllosphereRRSGYRYSARPGRRYPVRPVAVAPQRSGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVVAYLGDIYRAIRDGGINSSATGLYANMLILLAALCYAGFHKLQRAL
Ga0315741_1089358333300032739Forest SoilRVRVPIRRSGVRVTARPGRQYPIRPAVAPARRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKTLGNGTPGLYANMAILLAALCFAGYHKLRRSL
Ga0315741_1114921213300032739Forest SoilIMPRVRVPVRRSGYRYTARPGRRYPAASGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGGVYRALKSAGNGASGLYVNMAILLAALCFAVFHKLQRSL
Ga0315741_1202982023300032739Forest SoilMPRVRVPVRRSGYRYTARPGRRYPVRPPPQRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGQVYRALRDVNGGNAASGLYVNMAILLAALCFAGYHKLRRSL
Ga0315742_1053235823300032756Forest SoilMPRVRVPVRRSGYRYTARPGRRYPVRPVVQPSGGRGLLGGLAGLLLCLLCLATLGLLGLFATFVAVTAYLGDVYRALRNAGNSASGLYVNMAILLAALCFAGFHKLQRSL
Ga0315742_1066054433300032756Forest SoilMPRVRVPVRRSGYRYTARPGRRYPIPPPAKRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDIYRALRSAGNGASGLYINMVILLAALCFAGFHKLQRSL
Ga0315742_1067280813300032756Forest SoilMPRVRVPIRRSGIRYATRPGARYAAPRPIYIPPPPAQSNRGLAGLLGGLGGLLLCLLCLATLGLIGLFATFIAVTAYLGDIHKALRRNNNTATGLYMNVFILICALGFAYFNKIRRS
Ga0315742_1076024623300032756Forest SoilMPRVRVPVRRSGYRYTARPGRRYPVRPAPARRGGRGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGLYMNMAILLAALCFAGFHKLRRSL
Ga0315742_1090753413300032756Forest SoilMPRYRVPIRRTGYRRSVRPGRRYPVRPVVPVVPRPPSRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGNSASGYYMNMAILLAALCFAGYHKLRRSL
Ga0315742_1095197423300032756Forest SoilRVRVPRVRVPVRRSGYRYAARPGRRYPVRPVAPARSGLAGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALNAIGGASGHEMNMAILVAALCFVGFYKLRRSL
Ga0315742_1096106923300032756Forest SoilRVRVPVRRSGYRYSARPGRRYPVVTVAPVAPKRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGSNSASGLYVNMAILLVALCFAGFHKLQRSL
Ga0315742_1097516633300032756Forest SoilVRVPVRRSGYRYTARPGRRYPVPTAPARRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGLYINMTILLAALCFAGLHKLRRSL
Ga0315742_1103301313300032756Forest SoilRVRVPVRRSGYRYTARPGRRYPVAPVAPARGGKGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGSIYRALKTAGGAASGLYVNMGILFAALLFAVYHKLQRSL
Ga0315742_1106001723300032756Forest SoilRVRVPVRRSGYRYTARPGRRYPIRPVTVVQPSRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDINNSASGLYINMAILMAALCFAGFHKLQRSL
Ga0315742_1112953213300032756Forest SoilLKMPRVRVPIRRSGVRVTARPGRQYPVRPAPARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGSGASDHYMNMTMLVAALCFVGYHKLRRLL
Ga0315742_1116201313300032756Forest SoilRPGRRYPVRPAPAPAAGRGGLLGLLGGLAGLLLCLLCLATMGLLGLFAAFVAVTAYLGNIYSAIKNDGTALYTNMFVLLAALCFAGFCKLRRSL
Ga0315742_1163050723300032756Forest SoilRQYPVRPAVARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTKYLGDVYRALKATGTGGASGHYMNMTILLAALCFAGYHKLRRSL
Ga0315742_1180238813300032756Forest SoilMPRYRVPIRRTGYRRAMRPGRRYPIRPIVPVVPVAPPRTRGLAGIIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALKNQENGASGYYVNMAILLAALCFAGYHKLHRSL
Ga0315742_1182097313300032756Forest SoilVRRSGYRYTARPGRRYPIRPVAPARSGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFVAVTAYLAEVYHALRSVGNSASGHYVNMAILLGALCFAGYHKLRRSL
Ga0315742_1210253813300032756Forest SoilRRSGYRYTARPGRRYPVRPAPPPRRGGLGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDANNSASGHYVNMAILMAAVCFAGYHKIRRAL
Ga0315742_1215259813300032756Forest SoilLRVRVPIRRSGVRVTARPGRQYPVRPAVARSSRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDSGNSASGLYMNMAILLAALCFAGYHKLRRSL
Ga0315742_1257123613300032756Forest SoilRVRVPIRRSGVRYATRPGRRYPIRPQPYIRPQRSSGLAGILGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALKRANGASGLYVNVFILFIALGFACFNKFRRSL
Ga0315742_1288019023300032756Forest SoilMPRVRVPIRRSGYRYTTRPGRRYPVRPVAVVQPSRGRGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDAGSNASGHYVNMAVLLAALCFAGYHKLRRSL
Ga0315742_1289604623300032756Forest SoilRVRVPVRRSGYRYTARPGRRYPIRPAPPPARSGGRGLLGGLAGLLLCLLCLATLGLIGLFATFIAVVAYLGDVYRALRDVGNSASGQYVNMAILLVALCFAGYHKLRRSL
Ga0315742_1309206723300032756Forest SoilRRYPVRPTAPPPAKGRGGLMGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVVTYLGEVFRAVRDQNNASPALYVNTTILLAALCFAGFHKLRRSL
Ga0315742_1329129413300032756Forest SoilVRRSGYRYSARPGRRYPIRPPPPAGGGRGLLGGLAGLLLCLLCLATLGLLGLFAAFIAVTAYLGDVYRALRDANGASGHYVNMAILMAALCFAGYHKLLRSL
Ga0314768_123292013300033523Switchgrass PhyllosphereMPRIRVPIRRSGVRVTARPGRQYPVRPVVTPARSGLRGLIGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVWRALRNRNGSPAAQYLNITILVAALCFVGYHKLRRSL
Ga0314768_123444513300033523Switchgrass PhyllosphereMPRVRVPVRRSGIRYATRPGRRYPVVPVAPPRRRNGLLGGLAGLLLCLLCLATLGLLGLFATFIAVTAYLGDVYRALRDTNGSASGLYVNMAILFAAVGFAVFHKLQRSL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.