NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F006694

Metagenome / Metatranscriptome Family F006694

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F006694
Family Type Metagenome / Metatranscriptome
Number of Sequences 366
Average Sequence Length 40 residues
Representative Sequence MEAFVIAGTLLGSFAGAFALQKAALEGLFRMMNADRRVRQ
Number of Associated Samples 234
Number of Associated Scaffolds 366

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.05 %
% of genes near scaffold ends (potentially truncated) 21.86 %
% of genes from short scaffolds (< 2000 bps) 86.07 %
Associated GOLD sequencing projects 213
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.344 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(9.290 % of family members)
Environment Ontology (ENVO) Unclassified
(24.317 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.541 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 55.88%    β-sheet: 0.00%    Coil/Unstructured: 44.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 366 Family Scaffolds
PF05977MFS_3 16.94
PF02746MR_MLE_N 4.92
PF00753Lactamase_B 4.64
PF13378MR_MLE_C 4.64
PF06114Peptidase_M78 2.73
PF00578AhpC-TSA 1.09
PF01035DNA_binding_1 0.55
PF00005ABC_tran 0.55
PF03098An_peroxidase 0.55
PF02401LYTB 0.55
PF10816DUF2760 0.27
PF02113Peptidase_S13 0.27
PF10282Lactonase 0.27
PF12704MacB_PCD 0.27
PF02687FtsX 0.27
PF04519Bactofilin 0.27
PF07477Glyco_hydro_67C 0.27
PF01139RtcB 0.27
PF01432Peptidase_M3 0.27
PF02577BFN_dom 0.27
PF02769AIRS_C 0.27
PF00326Peptidase_S9 0.27
PF01474DAHP_synth_2 0.27
PF05853BKACE 0.27
PF00119ATP-synt_A 0.27
PF10543ORF6N 0.27
PF0563523S_rRNA_IVP 0.27
PF01081Aldolase 0.27
PF04055Radical_SAM 0.27
PF00275EPSP_synthase 0.27
PF13485Peptidase_MA_2 0.27
PF09527ATPase_gene1 0.27
PF00899ThiF 0.27
PF03279Lip_A_acyltrans 0.27
PF00117GATase 0.27
PF13280WYL 0.27
PF04389Peptidase_M28 0.27
PF16499Melibiase_2 0.27
PF07973tRNA_SAD 0.27
PF03899ATP-synt_I 0.27
PF09723Zn-ribbon_8 0.27
PF08757CotH 0.27
PF12681Glyoxalase_2 0.27

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 366 Family Scaffolds
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 16.94
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 9.84
COG07614-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspHLipid transport and metabolism [I] 1.09
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 0.55
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 0.55
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.27
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 0.27
COG08002-keto-3-deoxy-6-phosphogluconate aldolaseCarbohydrate transport and metabolism [G] 0.27
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.27
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 0.27
COG1560Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis)Lipid transport and metabolism [I] 0.27
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 0.27
COG1690RNA-splicing ligase RtcB, repairs tRNA damageTranslation, ribosomal structure and biogenesis [J] 0.27
COG2027D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.27
COG32003-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase, class IIAmino acid transport and metabolism [E] 0.27
COG3246Uncharacterized conserved protein, DUF849 familyFunction unknown [S] 0.27
COG3312FoF1-type ATP synthase accessory protein AtpIEnergy production and conversion [C] 0.27
COG3661Alpha-glucuronidaseCarbohydrate transport and metabolism [G] 0.27
COG4261Predicted acyltransferase, LPLAT superfamilyGeneral function prediction only [R] 0.27
COG5337Spore coat protein CotHCell wall/membrane/envelope biogenesis [M] 0.27


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.34 %
UnclassifiedrootN/A10.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104509568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium649Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104846495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales580Open in IMG/M
3300000567|JGI12270J11330_10269358Not Available541Open in IMG/M
3300001213|JGIcombinedJ13530_100683435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3142Open in IMG/M
3300001356|JGI12269J14319_10081632All Organisms → cellular organisms → Bacteria → Acidobacteria1707Open in IMG/M
3300001686|C688J18823_10401772All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300003324|soilH2_10048236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1000Open in IMG/M
3300004082|Ga0062384_100206301All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1163Open in IMG/M
3300004103|Ga0058903_1457697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales517Open in IMG/M
3300004104|Ga0058891_1532957All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300004114|Ga0062593_100349682All Organisms → cellular organisms → Bacteria1291Open in IMG/M
3300004140|Ga0058894_1466290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales558Open in IMG/M
3300004152|Ga0062386_100041174All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3463Open in IMG/M
3300004152|Ga0062386_101147040Not Available645Open in IMG/M
3300004631|Ga0058899_10694540All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300004631|Ga0058899_12022101All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300004631|Ga0058899_12151466All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300005177|Ga0066690_10614853All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300005177|Ga0066690_10772688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300005181|Ga0066678_10605259Not Available729Open in IMG/M
3300005329|Ga0070683_100000019All Organisms → cellular organisms → Bacteria192076Open in IMG/M
3300005329|Ga0070683_100828222All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300005329|Ga0070683_101837566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300005332|Ga0066388_102247285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia986Open in IMG/M
3300005335|Ga0070666_10551787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales838Open in IMG/M
3300005338|Ga0068868_102109753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales536Open in IMG/M
3300005344|Ga0070661_101085939All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005367|Ga0070667_100470212All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300005434|Ga0070709_11010640All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300005435|Ga0070714_101835691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300005436|Ga0070713_101891236All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300005458|Ga0070681_12010374All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005459|Ga0068867_100696117All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300005524|Ga0070737_10002111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia25047Open in IMG/M
3300005529|Ga0070741_10497306All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300005529|Ga0070741_10545958Not Available1042Open in IMG/M
3300005529|Ga0070741_10953771All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005530|Ga0070679_100833079All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300005531|Ga0070738_10015211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6294Open in IMG/M
3300005531|Ga0070738_10050744All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2597Open in IMG/M
3300005531|Ga0070738_10089262All Organisms → cellular organisms → Bacteria1689Open in IMG/M
3300005533|Ga0070734_10000153All Organisms → cellular organisms → Bacteria190557Open in IMG/M
3300005533|Ga0070734_10522561All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005534|Ga0070735_10251825All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300005535|Ga0070684_100118346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2381Open in IMG/M
3300005537|Ga0070730_10202516All Organisms → cellular organisms → Bacteria → Acidobacteria1324Open in IMG/M
3300005538|Ga0070731_10628908Not Available714Open in IMG/M
3300005541|Ga0070733_10167870All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300005542|Ga0070732_10074928All Organisms → cellular organisms → Bacteria1976Open in IMG/M
3300005542|Ga0070732_10701149All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300005544|Ga0070686_101745044All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300005548|Ga0070665_100653880All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300005563|Ga0068855_102086561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300005563|Ga0068855_102091002All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005591|Ga0070761_10658676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300005602|Ga0070762_10160975All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300005607|Ga0070740_10028375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3197Open in IMG/M
3300005640|Ga0075035_1451102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus576Open in IMG/M
3300005764|Ga0066903_101779724All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300005764|Ga0066903_102535984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia993Open in IMG/M
3300005764|Ga0066903_102969292All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300005764|Ga0066903_105497739All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300005899|Ga0075271_10070610All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300005921|Ga0070766_10489610All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300005921|Ga0070766_10613523Not Available731Open in IMG/M
3300005944|Ga0066788_10016554All Organisms → cellular organisms → Bacteria → Acidobacteria1606Open in IMG/M
3300006028|Ga0070717_11802295All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300006032|Ga0066696_11094155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300006052|Ga0075029_100003374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia8974Open in IMG/M
3300006052|Ga0075029_100547228All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300006102|Ga0075015_100310826All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300006800|Ga0066660_10365998All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300006804|Ga0079221_10345764All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia895Open in IMG/M
3300006893|Ga0073928_10193703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1598Open in IMG/M
3300006954|Ga0079219_10145142All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300009088|Ga0099830_10470604All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300009093|Ga0105240_10005595All Organisms → cellular organisms → Bacteria18668Open in IMG/M
3300009093|Ga0105240_12776060All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium504Open in IMG/M
3300009101|Ga0105247_11134058All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales619Open in IMG/M
3300009137|Ga0066709_103646869Not Available559Open in IMG/M
3300009156|Ga0111538_13748489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300009162|Ga0075423_11297090All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300009174|Ga0105241_11579124All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300009177|Ga0105248_13198979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300009523|Ga0116221_1009310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5790Open in IMG/M
3300009525|Ga0116220_10311110All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300009551|Ga0105238_12321244All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300009633|Ga0116129_1000068All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia76112Open in IMG/M
3300009637|Ga0116118_1140935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300009662|Ga0105856_1105759All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300009665|Ga0116135_1052297All Organisms → cellular organisms → Bacteria → Acidobacteria1421Open in IMG/M
3300009683|Ga0116224_10451243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300009698|Ga0116216_10734152Not Available593Open in IMG/M
3300009700|Ga0116217_10260559All Organisms → cellular organisms → Bacteria → Acidobacteria1123Open in IMG/M
3300009700|Ga0116217_10572814All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300009824|Ga0116219_10104724All Organisms → cellular organisms → Bacteria → Acidobacteria1650Open in IMG/M
3300009824|Ga0116219_10421901Not Available743Open in IMG/M
3300010037|Ga0126304_10686247All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300010046|Ga0126384_12114008Not Available540Open in IMG/M
3300010048|Ga0126373_10598383All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1155Open in IMG/M
3300010048|Ga0126373_10916177All Organisms → cellular organisms → Bacteria → Acidobacteria941Open in IMG/M
3300010048|Ga0126373_11421609All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales759Open in IMG/M
3300010048|Ga0126373_11671424Not Available701Open in IMG/M
3300010152|Ga0126318_10429947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales622Open in IMG/M
3300010152|Ga0126318_10978203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales637Open in IMG/M
3300010359|Ga0126376_12405742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300010359|Ga0126376_13135828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales511Open in IMG/M
3300010361|Ga0126378_11053639All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300010361|Ga0126378_12064538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales650Open in IMG/M
3300010362|Ga0126377_10369583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1436Open in IMG/M
3300010362|Ga0126377_10703874All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300010362|Ga0126377_10999394Not Available903Open in IMG/M
3300010366|Ga0126379_13819232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300010373|Ga0134128_10000085All Organisms → cellular organisms → Bacteria125765Open in IMG/M
3300010376|Ga0126381_100868943All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300010376|Ga0126381_103844111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales586Open in IMG/M
3300010379|Ga0136449_103641103Not Available583Open in IMG/M
3300010397|Ga0134124_10981132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales856Open in IMG/M
3300010398|Ga0126383_13559735Not Available509Open in IMG/M
3300010399|Ga0134127_11570857All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300010399|Ga0134127_13587304Not Available509Open in IMG/M
3300010400|Ga0134122_12209216All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300011077|Ga0138572_1094937All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300011119|Ga0105246_10833328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae821Open in IMG/M
3300011120|Ga0150983_10315278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales768Open in IMG/M
3300011120|Ga0150983_10929717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus537Open in IMG/M
3300011120|Ga0150983_11834056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales689Open in IMG/M
3300011120|Ga0150983_11928993All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300011120|Ga0150983_12817570All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6539Open in IMG/M
3300011120|Ga0150983_13544088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales699Open in IMG/M
3300011120|Ga0150983_13824225All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300011120|Ga0150983_13859166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales590Open in IMG/M
3300011120|Ga0150983_15074256All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales583Open in IMG/M
3300011120|Ga0150983_15872433All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales560Open in IMG/M
3300011120|Ga0150983_15949172Not Available617Open in IMG/M
3300011120|Ga0150983_16145162All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300011332|Ga0126317_10535537Not Available556Open in IMG/M
3300012096|Ga0137389_11623251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales543Open in IMG/M
3300012210|Ga0137378_10127750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2349Open in IMG/M
3300012212|Ga0150985_100508560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales537Open in IMG/M
3300012212|Ga0150985_103284386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales569Open in IMG/M
3300012212|Ga0150985_103646887All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae658Open in IMG/M
3300012212|Ga0150985_104776279Not Available590Open in IMG/M
3300012212|Ga0150985_106097882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales803Open in IMG/M
3300012212|Ga0150985_108711515Not Available558Open in IMG/M
3300012212|Ga0150985_110382401All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300012212|Ga0150985_110696335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales543Open in IMG/M
3300012212|Ga0150985_110886853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales565Open in IMG/M
3300012212|Ga0150985_112407493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales705Open in IMG/M
3300012212|Ga0150985_112959667Not Available874Open in IMG/M
3300012212|Ga0150985_115185796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1038Open in IMG/M
3300012212|Ga0150985_115686333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales570Open in IMG/M
3300012212|Ga0150985_117637494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales514Open in IMG/M
3300012212|Ga0150985_118148546All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales568Open in IMG/M
3300012212|Ga0150985_118667791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300012212|Ga0150985_120397576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae747Open in IMG/M
3300012212|Ga0150985_120474578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae918Open in IMG/M
3300012212|Ga0150985_121059731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300012212|Ga0150985_121110226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales873Open in IMG/M
3300012212|Ga0150985_121268304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales713Open in IMG/M
3300012350|Ga0137372_10790905All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300012469|Ga0150984_109072784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales544Open in IMG/M
3300012469|Ga0150984_111808327All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300012469|Ga0150984_114109831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1315Open in IMG/M
3300012469|Ga0150984_114280634All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales611Open in IMG/M
3300012469|Ga0150984_115284723All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300012469|Ga0150984_116597903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium541Open in IMG/M
3300012469|Ga0150984_123084060All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300012929|Ga0137404_11038608All Organisms → cellular organisms → Bacteria → Acidobacteria750Open in IMG/M
3300012930|Ga0137407_12372845Not Available507Open in IMG/M
3300012958|Ga0164299_11308640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300013100|Ga0157373_11323660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia546Open in IMG/M
3300013104|Ga0157370_11366004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales638Open in IMG/M
3300013105|Ga0157369_12358422All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae539Open in IMG/M
3300013297|Ga0157378_12211270All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales601Open in IMG/M
3300013297|Ga0157378_12428471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales576Open in IMG/M
3300013297|Ga0157378_12505955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales568Open in IMG/M
3300013306|Ga0163162_11903008All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300013307|Ga0157372_10578707All Organisms → cellular organisms → Bacteria1309Open in IMG/M
3300013307|Ga0157372_11161951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales892Open in IMG/M
3300014152|Ga0181533_1045120All Organisms → cellular organisms → Bacteria → Acidobacteria2339Open in IMG/M
3300014326|Ga0157380_12128184Not Available624Open in IMG/M
3300014326|Ga0157380_13097489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales530Open in IMG/M
3300014326|Ga0157380_13445322Not Available506Open in IMG/M
3300014501|Ga0182024_10090429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4507Open in IMG/M
3300014501|Ga0182024_10496226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1554Open in IMG/M
3300014501|Ga0182024_10621621All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300014501|Ga0182024_11419283All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300014745|Ga0157377_11741012All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales504Open in IMG/M
3300014969|Ga0157376_11077723All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300015197|Ga0167638_1002771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3994Open in IMG/M
3300015242|Ga0137412_10484668All Organisms → cellular organisms → Bacteria → Proteobacteria948Open in IMG/M
3300015371|Ga0132258_13904657All Organisms → cellular organisms → Bacteria → Acidobacteria1013Open in IMG/M
3300015373|Ga0132257_101441625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales877Open in IMG/M
3300016422|Ga0182039_11713998Not Available575Open in IMG/M
3300016445|Ga0182038_11889454Not Available540Open in IMG/M
3300017823|Ga0187818_10387534All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300017955|Ga0187817_10174451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1369Open in IMG/M
3300017970|Ga0187783_10530093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus853Open in IMG/M
3300017970|Ga0187783_11014886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300017973|Ga0187780_10187075All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1442Open in IMG/M
3300018047|Ga0187859_10507515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300018062|Ga0187784_11691615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales501Open in IMG/M
3300018431|Ga0066655_10890363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales608Open in IMG/M
3300018468|Ga0066662_12018126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus604Open in IMG/M
3300018482|Ga0066669_10388733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1176Open in IMG/M
3300019263|Ga0184647_1307713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales641Open in IMG/M
3300019789|Ga0137408_1310504All Organisms → cellular organisms → Bacteria → Acidobacteria1457Open in IMG/M
3300020069|Ga0197907_10246361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales507Open in IMG/M
3300020069|Ga0197907_11275668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300020070|Ga0206356_11330249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales730Open in IMG/M
3300020215|Ga0196963_10019833All Organisms → cellular organisms → Bacteria2902Open in IMG/M
3300020581|Ga0210399_10487056All Organisms → cellular organisms → Bacteria → Acidobacteria1026Open in IMG/M
3300020583|Ga0210401_10113239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2546Open in IMG/M
3300021171|Ga0210405_10776163Not Available736Open in IMG/M
3300021180|Ga0210396_10924145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales743Open in IMG/M
3300021384|Ga0213876_10038763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2516Open in IMG/M
3300021384|Ga0213876_10124621All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300021406|Ga0210386_11510594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales560Open in IMG/M
3300021407|Ga0210383_11521096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales553Open in IMG/M
3300021432|Ga0210384_11082925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales704Open in IMG/M
3300021432|Ga0210384_11662954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6544Open in IMG/M
3300021478|Ga0210402_10323253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1430Open in IMG/M
3300021559|Ga0210409_11299821All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300021560|Ga0126371_10248480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1892Open in IMG/M
3300021560|Ga0126371_10777737All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300021560|Ga0126371_11035544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium962Open in IMG/M
3300021560|Ga0126371_11380796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales836Open in IMG/M
3300021560|Ga0126371_11981999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300021560|Ga0126371_12650104Not Available607Open in IMG/M
3300021560|Ga0126371_13368242All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300021861|Ga0213853_11120441Not Available700Open in IMG/M
3300022467|Ga0224712_10294392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales758Open in IMG/M
3300022467|Ga0224712_10465582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales608Open in IMG/M
3300022504|Ga0242642_1096510All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales513Open in IMG/M
3300022508|Ga0222728_1047386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales714Open in IMG/M
3300022510|Ga0242652_1050682All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales525Open in IMG/M
3300022523|Ga0242663_1117837All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300022530|Ga0242658_1125654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales639Open in IMG/M
3300022531|Ga0242660_1066942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales819Open in IMG/M
3300022531|Ga0242660_1175537All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300022532|Ga0242655_10335277All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300022533|Ga0242662_10093552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales847Open in IMG/M
3300022533|Ga0242662_10099140All Organisms → cellular organisms → Bacteria → Acidobacteria828Open in IMG/M
3300022557|Ga0212123_10272476Not Available1200Open in IMG/M
3300022722|Ga0242657_1029825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1094Open in IMG/M
3300022722|Ga0242657_1204647All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300022724|Ga0242665_10041226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1189Open in IMG/M
3300022724|Ga0242665_10360232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6523Open in IMG/M
3300025463|Ga0208193_1000122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus54754Open in IMG/M
3300025900|Ga0207710_10476365All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300025905|Ga0207685_10438499All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300025912|Ga0207707_10716912Not Available839Open in IMG/M
3300025913|Ga0207695_10011171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus10893Open in IMG/M
3300025915|Ga0207693_10192100All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300025944|Ga0207661_10000019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales235900Open in IMG/M
3300025944|Ga0207661_11648186All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300025949|Ga0207667_10420328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1360Open in IMG/M
3300025949|Ga0207667_10817197All Organisms → cellular organisms → Bacteria → Acidobacteria928Open in IMG/M
3300025949|Ga0207667_11754321All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales586Open in IMG/M
3300026035|Ga0207703_10307564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1448Open in IMG/M
3300026118|Ga0207675_101279404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus754Open in IMG/M
3300026555|Ga0179593_1086765All Organisms → cellular organisms → Bacteria → Acidobacteria2471Open in IMG/M
3300027570|Ga0208043_1065510All Organisms → cellular organisms → Bacteria → Acidobacteria1031Open in IMG/M
3300027667|Ga0209009_1105259Not Available716Open in IMG/M
3300027706|Ga0209581_1029046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2559Open in IMG/M
3300027825|Ga0209039_10019441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3502Open in IMG/M
3300027826|Ga0209060_10000379All Organisms → cellular organisms → Bacteria → Acidobacteria88329Open in IMG/M
3300027842|Ga0209580_10048447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1975Open in IMG/M
3300027854|Ga0209517_10048826All Organisms → cellular organisms → Bacteria3224Open in IMG/M
3300027862|Ga0209701_10608309All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300027867|Ga0209167_10232092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae988Open in IMG/M
3300027889|Ga0209380_10298562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales946Open in IMG/M
3300027898|Ga0209067_10006480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6439Open in IMG/M
3300027898|Ga0209067_10014541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales4095Open in IMG/M
3300027905|Ga0209415_10038236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6591Open in IMG/M
3300027908|Ga0209006_10639855All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300027911|Ga0209698_11040058All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300027965|Ga0209062_1081620All Organisms → cellular organisms → Bacteria → Acidobacteria1414Open in IMG/M
3300027968|Ga0209061_1001639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus34962Open in IMG/M
3300028379|Ga0268266_11143524All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.753Open in IMG/M
3300028792|Ga0307504_10221835All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300029636|Ga0222749_10264724Not Available879Open in IMG/M
3300029636|Ga0222749_10641543All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300029943|Ga0311340_10205798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1976Open in IMG/M
3300029999|Ga0311339_11197436All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300030659|Ga0316363_10069378All Organisms → cellular organisms → Bacteria → Acidobacteria1623Open in IMG/M
3300030659|Ga0316363_10297222Not Available646Open in IMG/M
3300030730|Ga0307482_1267043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales541Open in IMG/M
3300030730|Ga0307482_1271340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300030730|Ga0307482_1284467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales528Open in IMG/M
3300030991|Ga0073994_10117973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300031057|Ga0170834_100979641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1145Open in IMG/M
3300031058|Ga0308189_10522667Not Available514Open in IMG/M
3300031231|Ga0170824_110434497All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300031231|Ga0170824_122913904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae714Open in IMG/M
3300031231|Ga0170824_128781264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1095Open in IMG/M
3300031234|Ga0302325_10267028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2825Open in IMG/M
3300031234|Ga0302325_10553382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1715Open in IMG/M
3300031234|Ga0302325_10896222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1232Open in IMG/M
3300031234|Ga0302325_11466632All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300031236|Ga0302324_102170005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales690Open in IMG/M
3300031236|Ga0302324_103512170All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300031546|Ga0318538_10637272All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300031681|Ga0318572_10950663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia510Open in IMG/M
3300031708|Ga0310686_109534053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2995Open in IMG/M
3300031708|Ga0310686_114324719All Organisms → cellular organisms → Bacteria2181Open in IMG/M
3300031716|Ga0310813_12078202Not Available536Open in IMG/M
3300031718|Ga0307474_11558814All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae519Open in IMG/M
3300031770|Ga0318521_10493907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales735Open in IMG/M
3300031819|Ga0318568_11028626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales509Open in IMG/M
3300031890|Ga0306925_12095017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300031910|Ga0306923_10373061All Organisms → cellular organisms → Bacteria → Acidobacteria1626Open in IMG/M
3300031910|Ga0306923_12140984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales563Open in IMG/M
3300031938|Ga0308175_101193437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales846Open in IMG/M
3300031939|Ga0308174_10011518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5127Open in IMG/M
3300031939|Ga0308174_10018062All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales4296Open in IMG/M
3300031939|Ga0308174_10340642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1193Open in IMG/M
3300031954|Ga0306926_12408406All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae580Open in IMG/M
3300031962|Ga0307479_10826833All Organisms → cellular organisms → Bacteria → Acidobacteria901Open in IMG/M
3300031996|Ga0308176_11171936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales814Open in IMG/M
3300031996|Ga0308176_12062408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales609Open in IMG/M
3300032055|Ga0318575_10658821Not Available530Open in IMG/M
3300032119|Ga0316051_1021289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300032160|Ga0311301_11529125All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300032515|Ga0348332_10211855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300032515|Ga0348332_12428984All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales796Open in IMG/M
3300032515|Ga0348332_13537243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales594Open in IMG/M
3300032770|Ga0335085_10006652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia18154Open in IMG/M
3300032770|Ga0335085_10050856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5604Open in IMG/M
3300032770|Ga0335085_10086230All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4103Open in IMG/M
3300032770|Ga0335085_10134404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3133Open in IMG/M
3300032770|Ga0335085_10193153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2501Open in IMG/M
3300032770|Ga0335085_10636564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1195Open in IMG/M
3300032782|Ga0335082_10335831All Organisms → cellular organisms → Bacteria → Acidobacteria1380Open in IMG/M
3300032782|Ga0335082_11140237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales646Open in IMG/M
3300032783|Ga0335079_10056859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4466Open in IMG/M
3300032783|Ga0335079_10116657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3016Open in IMG/M
3300032783|Ga0335079_11829851Not Available590Open in IMG/M
3300032805|Ga0335078_10287156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2221Open in IMG/M
3300032805|Ga0335078_10396816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1812Open in IMG/M
3300032805|Ga0335078_10432249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1716Open in IMG/M
3300032805|Ga0335078_10444173All Organisms → cellular organisms → Bacteria → Acidobacteria1686Open in IMG/M
3300032805|Ga0335078_11882447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales646Open in IMG/M
3300032805|Ga0335078_12368442Not Available553Open in IMG/M
3300032828|Ga0335080_10822929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300032829|Ga0335070_10369761All Organisms → cellular organisms → Bacteria → Acidobacteria1377Open in IMG/M
3300032829|Ga0335070_11218841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales690Open in IMG/M
3300032893|Ga0335069_11548144All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300032897|Ga0335071_10178912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2074Open in IMG/M
3300032897|Ga0335071_10588988All Organisms → cellular organisms → Bacteria → Acidobacteria1064Open in IMG/M
3300032897|Ga0335071_11831741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales551Open in IMG/M
3300032898|Ga0335072_11218279All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300032955|Ga0335076_11474304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium567Open in IMG/M
3300033004|Ga0335084_10021411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6575Open in IMG/M
3300033134|Ga0335073_10207129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2428Open in IMG/M
3300033134|Ga0335073_11681576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium600Open in IMG/M
3300033289|Ga0310914_10472690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1135Open in IMG/M
3300033402|Ga0326728_10000772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia120930Open in IMG/M
3300033402|Ga0326728_10016362All Organisms → cellular organisms → Bacteria15153Open in IMG/M
3300033405|Ga0326727_10846718All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales695Open in IMG/M
3300033513|Ga0316628_101592309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae870Open in IMG/M
3300033513|Ga0316628_103050521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales612Open in IMG/M
3300033755|Ga0371489_0473635Not Available560Open in IMG/M
3300033977|Ga0314861_0430433All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales574Open in IMG/M
3300034268|Ga0372943_0246683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1120Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.28%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil6.01%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere5.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.46%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.73%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.19%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.91%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.64%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.37%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.37%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.09%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.09%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.09%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.09%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.09%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.09%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.09%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.09%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.82%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.55%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.55%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.55%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.55%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.55%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.27%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.27%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.27%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.27%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.27%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.27%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.27%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.27%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.27%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.27%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.27%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.27%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.27%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.27%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004103Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF242 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004140Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005524Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005531Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005640Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005899Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011077Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027968Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10450956823300000364SoilMEALLIGATLIGSFWGAVMLQKVALEGLFRAMNADRRAREL*
INPhiseqgaiiFebDRAFT_10484649513300000364SoilMEAVLITATLFGSFATAFYIQRAALEGLFRMMDSNRRDRH*
JGI12270J11330_1026935813300000567Peatlands SoilMDALVIAATLVGSCAGAFVLQKAALEGLFRIMRTERRARH*
JGIcombinedJ13530_10068343533300001213WetlandMEAVVIAGAFIGSFLGALAIQKAALEGLFRIMDLERRGRR*
JGI12269J14319_1008163223300001356Peatlands SoilMDALVIAATLVGSCAGAFVLQKAALEGLFRIMLTERRDRH*
C688J18823_1040177223300001686SoilMEAVVITATLFGSFATAWAIQKTALEALFRAMAPSRRERQ*
soilH2_1004823633300003324Sugarcane Root And Bulk SoilMEAAVITVTLIGSFWGAFALQKAALEGLFRVMDVNRRARQ*
Ga0062384_10020630133300004082Bog Forest SoilMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRQ*
Ga0058903_145769733300004103Forest SoilTMDALLITATLAGSFLGAFALQKAALEGLFRIMSAERRERQ*
Ga0058891_153295723300004104Forest SoilMDAVVIASTLVGTFVGAFVIQKAALEGLFRMMNAERRNHR*
Ga0062593_10034968223300004114SoilMEAVVITATLFGSFATAWAIQKTALEALFRMMSPNRRARE*
Ga0058894_146629023300004140Forest SoilMEAIVIAATLVGSFAGAFAIQKAALEGLFRIMGAPRRARQ*
Ga0062386_10004117443300004152Bog Forest SoilMEDLLLIGATVFGSFVDAFVLQKAALKGFFRIMGTERRARR*
Ga0062386_10114704023300004152Bog Forest SoilMETVVVIGALVGSFAGAFALQKAALEGLFRIMNNDRRLRQ
Ga0058899_1069454023300004631Forest SoilMETLVIAATLVGSFAGAFVLQKAALEGLFRIMGADRASSHRHRA*
Ga0058899_1202210123300004631Forest SoilMDAVLIASTLVGSFVGAFVIQKAALEGLIRMMNADRRNQR*
Ga0058899_1215146623300004631Forest SoilMEALVIAVTLIGSFLGALALQKAALEGLFRIMGAPRARQ*
Ga0066690_1061485323300005177SoilMEAFVIATTVLGSFLGAFALQKFALEGLFRVMSWERRERQ*
Ga0066690_1077268813300005177SoilMDALLIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRE*
Ga0066678_1060525923300005181SoilMEAVVITATLLGSFVGALAIQKAALEGLIRAMDADRRSRE*
Ga0070683_1000000191143300005329Corn RhizosphereMEAVVITATLAGSFATAFVIQKFALEGLFRMMSPNRRARE*
Ga0070683_10082822233300005329Corn RhizosphereMEAFVIGVTLFGSFLGAFILQKAALEGLFRMMQTDRRARQ*
Ga0070683_10183756623300005329Corn RhizosphereMDALVIAATLFGSLAGAYALLKAALAGLFRAIDPERRARQ*
Ga0066388_10224728533300005332Tropical Forest SoilMEALLIGATLIGSFWGAMVLQKAALERLFRAMSAGRRARE*
Ga0070666_1055178733300005335Switchgrass RhizosphereMEAVVIASTLVGSFFGAFLIQKAALEGLFRMMNAERRTHE*
Ga0068868_10210975323300005338Miscanthus RhizosphereMEAFVITATLFGSFATAFYIQRAALEGLFRMMDPNRRERP*
Ga0070661_10108593923300005344Corn RhizosphereMEAVLITAALAGSFATAFVIQKFALEGLFRMMSPNRRVRE*
Ga0070667_10047021233300005367Switchgrass RhizosphereMDAFIITAALFGSFAGAFILQKAALEGLFRIMQMERRARQ*
Ga0070709_1101064023300005434Corn, Switchgrass And Miscanthus RhizosphereMEAFVIAGTLVGSFATAFVIQKVALEGLFRIMDPNRRAR*
Ga0070714_10183569113300005435Agricultural SoilEPMEAVVITATLFGSFATAFVIQKAALEGLFRMMATNRRERE*
Ga0070713_10189123623300005436Corn, Switchgrass And Miscanthus RhizosphereMEALLISATLVGSFFGAFVLQKAALEGLFRVMNAERRRE*
Ga0070681_1201037413300005458Corn RhizospherePMDALLIGATLLSSFVGAFALQKAALEGLFRAMDADRRARQ*
Ga0068867_10069611723300005459Miscanthus RhizosphereLLYTRLERLDPMEVVVITATLVGSFATAWAIQKTALEALFRVMAPNRRARE*
Ga0070737_10002111273300005524Surface SoilMNALLIGATLAGSLVGAFAIQKAALQGLLHVMNAGRRTRR*
Ga0070741_1049730623300005529Surface SoilMETLVLGATLAGSFIGAFVLQKAALEGLFRILSGERRVRD*
Ga0070741_1054595823300005529Surface SoilMDAFLIGATVFGSFLGAWALQKAALEGLFRMMDPGRRARH*
Ga0070741_1095377123300005529Surface SoilMEAVVITATLAGSFATAFVIQKFALEGLFRIMSPNRRARQ*
Ga0070679_10083307913300005530Corn RhizosphereMEAVLITAALAGSFATAFVIQKFALEGLFRMMSPNRRIRE*
Ga0070738_1001521113300005531Surface SoilMEAFVIAGALIGSFATAFFIQKAALEGLFRVIGPERADANSP
Ga0070738_1005074463300005531Surface SoilFVIAGALIGSFATAFFIQKAALEGLFRVIGPERRGRQ*
Ga0070738_1008926223300005531Surface SoilMEAFVIAGTLIGSLATAFFIQKAALEGLFRIMSDPDRRARQ*
Ga0070734_10000153703300005533Surface SoilMDAFLIASTLVGSFVGAFVLQKAALEGLFRMMNAERRNQR*
Ga0070734_1052256123300005533Surface SoilMEALVITGTLLGSLAAAFALQKAALEGLFRFMKAERRSRH*
Ga0070735_1025182523300005534Surface SoilMDALLISATVVGSFLGAFALQKAALEGLFRMMDTDRRDRRQSS*
Ga0070684_10011834643300005535Corn RhizosphereMEAFVIGVTLFGSFLGAFVLQKAALEGLFRMMQTDRRARQ*
Ga0070730_1020251623300005537Surface SoilMDALVIAATLVGTCAGAFVLQKAALEGLFRMMQAERRERR*
Ga0070731_1062890823300005538Surface SoilMDAFVIAATLFGSFAGAFALQKVALEGLLRILNADAAQAIN
Ga0070733_1016787023300005541Surface SoilMDALLISATLFGSFLGAFALQKAALEGLFRIMDNERRDRH*
Ga0070732_1007492833300005542Surface SoilMDGFVIGATVLGSFVGAFVIQKAALEGLFRIMITGRRPRH*
Ga0070732_1070114923300005542Surface SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRMMDADRRHHR*
Ga0070686_10174504433300005544Switchgrass RhizospherePMEAVVITATLFGSFATAWAIQKTALEALFRMMSPNRRARE*
Ga0070665_10065388023300005548Switchgrass RhizosphereMEAFVIGATLFGSFFGAFAIQKAALEGLFRMMTPERRTRE*
Ga0068855_10208656113300005563Corn RhizosphereITAALFGSFASAFVIQKAALEGLFRMMSPNRRARG*
Ga0068855_10209100223300005563Corn RhizosphereMAAVLITAAVAGSFATAFVIQKAALEGLFRMMTPNRRARQ*
Ga0070761_1065867623300005591SoilMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRR*
Ga0070762_1016097523300005602SoilMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRARH*
Ga0070740_1002837563300005607Surface SoilMEAFVIAGALIGSFATAFFIQKAALEGLFRVIGPERRGRQ*
Ga0075035_145110223300005640Permafrost SoilMEAFVIAGTLLGSFVGAFALQKAALEGLFRVMNSGARRVRQ*
Ga0066903_10177972413300005764Tropical Forest SoilMEAVVVTATLVGSFATAWAIQRTALEALLRVMATNRRDHE*
Ga0066903_10253598423300005764Tropical Forest SoilMEALLIGATLIGSFWGAMVLQKAALERLFRAMNAGRRTRE*
Ga0066903_10296929223300005764Tropical Forest SoilMEAFVIAWALIASFATAFVIQKAALQGLFRIINPDRRARQ*
Ga0066903_10549773923300005764Tropical Forest SoilMEAFVITATLFGSFLGAFYIQKAALEGLFRVMDPQRRVRD*
Ga0075271_1007061033300005899Rice Paddy SoilLPVDSFVIAAILVGSVAGAFLLQKVALQGLFRIMGAGRRARQ*
Ga0070766_1048961023300005921SoilMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRR
Ga0070766_1061352323300005921SoilMDAFVIASTLVGSFVGAFVIQKAALEGLFRMMNSDRRHHK*
Ga0066788_1001655433300005944SoilMEAIVIAATLVGSFVGALALQKAALEGLFRIMGAPRSDRQ*
Ga0070717_1180229523300006028Corn, Switchgrass And Miscanthus RhizosphereMEAVVITATLFGSFATAFVIQKAALEGLFRMMATNRRERE*
Ga0066696_1109415533300006032SoilMEAFVITATLVGSFATAFVIQKAALEGLFRMIDPNRRERQ*
Ga0075029_100003374113300006052WatershedsMDAFVISATLVGSFLAAFVLQKAALEGLFRMMGRTRH*
Ga0075029_10054722833300006052WatershedsMEAFVVAATLVGSFAGAFALQKVALEGLIRLMSSPRRARQ*
Ga0075015_10031082623300006102WatershedsMETVVVTVTLLGSFAGAFALQKVALEGLIRLMSSPRRARQ*
Ga0066660_1036599833300006800SoilPVIARMGTMDALLIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRE*
Ga0079221_1034576423300006804Agricultural SoilMDAFVVGTAVIGSFLGAFAIQKAALEGLLRLMDGGRRRTSQS*
Ga0073928_1019370323300006893Iron-Sulfur Acid SpringMEAFVIGATLLGSFVGAFALQKAALEGLFRIMDTGRRARD*
Ga0079219_1014514233300006954Agricultural SoilMEAFVIGATLFGSFLGAFAIQKAALEGLFRMMTPERRPHE*
Ga0099830_1047060423300009088Vadose Zone SoilMDAVVIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRD*
Ga0105240_10005595123300009093Corn RhizosphereMEAFVIGATLFGSFLGAFILQKAALEGLFRMMQTDRRARQ*
Ga0105240_1277606023300009093Corn RhizosphereMEAVVITATLFTSFAAAFAIQKAALEGLFRMMDPNRRTRN*
Ga0105247_1113405813300009101Switchgrass RhizosphereKGFSTMEAVVIASTLVGSFFGAFLIQKAALEGLFRMMNAERRTHE*
Ga0066709_10364686923300009137Grasslands SoilMEAVVITATLLGSFVGALAIQKAALEGLIRAMDADR
Ga0111538_1374848923300009156Populus RhizosphereMEAVVITATLVGSFATAWAIQKTALEALFRAMSPNRRARQ*
Ga0075423_1129709013300009162Populus RhizosphereMEAVVITATLVGSFATAWAIQKTALEALFRVMSPNRRARE*
Ga0105241_1157912423300009174Corn RhizosphereMEAFVIGATLFGSFFGAFAIQKAALEGLFRMMTVERRPRE*
Ga0105248_1319897933300009177Switchgrass RhizosphereMETFVIAATLAGSFLGAFAIQKVALESLFRMMTSDRRIRQ*
Ga0116221_100931063300009523Peatlands SoilMDALVIAATLVGSCAGAFVLQKAALEGLFRIMQTERRDRH*
Ga0116220_1031111023300009525Peatlands SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRIMNADRRNHR*
Ga0105238_1232124423300009551Corn RhizosphereMPGDSSTMEAFVIGATLFGSFLGAFAIQKAALEGLFRIMTPERRPRE*
Ga0116129_1000068273300009633PeatlandMAMEAIVIVGTMVGSFAGAFVLQKAALEGLFRMMNADRRTRH*
Ga0116118_114093523300009637PeatlandMEAVIIGATLLSSFVGAFAIQKVALEGLFRIMETERRA
Ga0105856_110575923300009662Permafrost SoilMEAFVIAGTLLGSFVGAFALQKAALDGLFRMMNSGARRVRQ*
Ga0116135_105229713300009665PeatlandEGMAMEAIVIVGTMVGSFAGAFVLLKAALEGLFRMMNADRRTRH*
Ga0116224_1045124333300009683Peatlands SoilVIGATLVGCFAGAFAIQKAALEGLFRIMDRDLRASRH*
Ga0116216_1073415223300009698Peatlands SoilMDVIVIGATLVGCFAGAFAIQKAALEGLFRIMDRDLRASRH*
Ga0116217_1026055923300009700Peatlands SoilMDAFLIGATLVGSFLGAFALQKAALEGLFRIMDTGRRARH*
Ga0116217_1057281413300009700Peatlands SoilMDALVIAATLVGSCAGDFVLQKAALEGLFRIMLTERRDRH*
Ga0116219_1010472423300009824Peatlands SoilMDAFLIGATLVGSFQGAFALQKAALEGLFRIMDTGRRARH*
Ga0116219_1042190113300009824Peatlands SoilMTMDALVIAATLVGTCAGAFLLQKAALEGLLRIMVTEERRSRH*
Ga0126304_1068624713300010037Serpentine SoilMEAVVITATLIGSFATAWAIQKTALEALFRMMAPNRRARE*
Ga0126384_1211400813300010046Tropical Forest SoilMMDALVVGTTVVGSFLGAFLLQKAALQKLFRMMNAERRARH*
Ga0126373_1059838313300010048Tropical Forest SoilMEAVIIMGAVVASFAGAFALQKAALEGLFRMMNHDRRVRQ*
Ga0126373_1091617733300010048Tropical Forest SoilMEAFVIAGALIASFATAFVIQKAALQGLFRIINPDRRARQ*
Ga0126373_1142160913300010048Tropical Forest SoilMDALLIGGTLLGSLVGAFVIQKAALEGLFRVMNLDRRLRN*
Ga0126373_1167142413300010048Tropical Forest SoilMEAVIIIGAVVGSFAGAFALQKAALEGLFRMMNHDRRVRQ*
Ga0126318_1042994713300010152SoilIGATLVGSFAGAFMLQKVALEGLFRLMDTGRRARQ*
Ga0126318_1097820323300010152SoilVIGATLVGSFAGAFVLQKAALEGLFRLMDTGRRARH*
Ga0126376_1240574223300010359Tropical Forest SoilMEAIVITATLVGSFVGALALQKAALEGLFRAMDAGRRSTRE*
Ga0126376_1313582813300010359Tropical Forest SoilSATLFGSFVGAFVLQKAALEGLFRVMSAERRPRE*
Ga0126378_1105363933300010361Tropical Forest SoilMEALLIGATVIGSFWGAMVLQKAALERLFRAMNAGRRTRE*
Ga0126378_1206453813300010361Tropical Forest SoilVGAVVASFAGAFALQKAALEGLFRMMNHDRRVRQ*
Ga0126377_1036958333300010362Tropical Forest SoilMETLVIAATLIGSFAGAFAIQKAALEGFFRYMDSGRRARHQ*
Ga0126377_1070387423300010362Tropical Forest SoilMETLLIAVTLFGSFLGAVAIQKMALEGLFRAMNMDRRTRE*
Ga0126377_1099939433300010362Tropical Forest SoilMETLVIAVTLIGSVAGAFALQKAALEGIFRFMDADRRARQ*
Ga0126379_1381923223300010366Tropical Forest SoilMEAFVIAGTLIGSFATAFWIQKAALEGLFRIMDPNRRTR*
Ga0134128_10000085953300010373Terrestrial SoilMDAFVIGATLVGSFAGAFVLQKVALEGLFRLMDSGRRARQ*
Ga0126381_10086894333300010376Tropical Forest SoilMEALLIGATLIGSFWGAMVLQKAALERLFRAMSAGRRAR*
Ga0126381_10384411113300010376Tropical Forest SoilREVRAMEAVIVVGTVIGSFAAAFWLQKAAREGLFRIITTERRVRD*
Ga0136449_10364110323300010379Peatlands SoilMDALVIAATLVGSCAGAFVLQKAALEGLFHIMRTER
Ga0134124_1098113223300010397Terrestrial SoilMDAVVIASTLVGSFLGAFVIQKAALEGLIRMMNIERRTQK*
Ga0126383_1355973523300010398Tropical Forest SoilMEAVMIVGAVVVSFAGAFALQKAALEGLFRMMNHDRRVRQ*
Ga0134127_1157085723300010399Terrestrial SoilMEVVVITATLVGSFATAWAIQKTALEALFRVMAPTRRARE*
Ga0134127_1358730413300010399Terrestrial SoilMDALVVATTLIASFLGAFVLQKAALQKFFRMMDSGRRRE*
Ga0134122_1220921633300010400Terrestrial SoilDALVIAATVVGSFAGAFALQRVALEGLLRMMQVDRRARQ*
Ga0138572_109493723300011077Peatlands SoilMDALVIAATLVGSCAGAFVLQKATLEGLFRIMQTERRDRH*
Ga0105246_1083332823300011119Miscanthus RhizosphereMEVVVITATLVGSFATAWAIQKTALEALFRVMAPNRRARE*
Ga0150983_1031527813300011120Forest SoilVKAEGMAMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRTRH*
Ga0150983_1092971723300011120Forest SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNAERRNHR*
Ga0150983_1183405633300011120Forest SoilMDALLITATLAGSFLGAFALQKAALEGLFRIMGAERRERQ*
Ga0150983_1192899323300011120Forest SoilMDAVVIASTLVGSFVGAFVIQKAALEGLFRIMNTERRTRR*
Ga0150983_1281757013300011120Forest SoilMDAVLIASTLVGSFYGAFVIQKAALEGLFRIMDADRRTRH*
Ga0150983_1354408813300011120Forest SoilMDALLISATLFGSFVGAFALQKMALEGLFRMMGSERRERH*
Ga0150983_1382422513300011120Forest SoilMDALLITATLAGSFLGAFALQKAALEGLFRIMSAERRERQ*
Ga0150983_1385916623300011120Forest SoilVMETVVVIGALVGSFAGAFALQKAALEGLFRIMNSDRRLRQ*
Ga0150983_1507425613300011120Forest SoilRMDALVIAATLVGSCAGAFVLQKAALEGLFRMMQVERRERR*
Ga0150983_1587243333300011120Forest SoilMDALVIAATLVGSCAGAFVLQKAALEGLFRIMQTERRPRR*
Ga0150983_1594917213300011120Forest SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNSERRNHR*
Ga0150983_1614516223300011120Forest SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNADRRNHR*
Ga0126317_1053553713300011332SoilEMEAVLIVATLFASFAGAFAIQKAALEGLFRMMDTDRHIRH*
Ga0137389_1162325113300012096Vadose Zone SoilGTMDAVVIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRD*
Ga0137378_1012775023300012210Vadose Zone SoilMDALLIAATLVGSCAGAFVLQKAALEGLFRMMQTERRARR*
Ga0150985_10050856013300012212Avena Fatua RhizosphereMEAFVITATLVGSFATAFYIQRAALEGLFRMMDPNRRERQ*
Ga0150985_10328438623300012212Avena Fatua RhizosphereMEAVVITATLFGSFATAWAIQKTALEALFRMMSPDRRARQ*
Ga0150985_10364688713300012212Avena Fatua RhizosphereMEAVVITATLAGSLATAFVIQKFALEGLFRMMSPNRRARQ*
Ga0150985_10477627913300012212Avena Fatua RhizosphereMEAFVITATLVGSFATAFFIQRAALEGLFRMMDPNRRERQ*
Ga0150985_10609788213300012212Avena Fatua RhizosphereMEAFVITATLFGSFATAFVIQRAALEGLFRMMDPNRRERQ*
Ga0150985_10871151533300012212Avena Fatua RhizosphereVVIASTLVGSFLGAFVIQKAALEGLMRMMNAERRTEK*
Ga0150985_11038240123300012212Avena Fatua RhizosphereMDTLLIAATLFSSFLGACALQKAALEGLFRAMNADRRARE*
Ga0150985_11069633523300012212Avena Fatua RhizosphereMEAFVITATLFGSFATAFFIQRAALEGLFRMMDPNRRERQ*
Ga0150985_11088685323300012212Avena Fatua RhizosphereMETLVIAGTLLGSLAAAFALQKAALESLFRIMDADRRARD*
Ga0150985_11240749333300012212Avena Fatua RhizosphereMEAFVITAALFGSFATAFYIQRAALEGLFRMMDPNRRERS*
Ga0150985_11295966723300012212Avena Fatua RhizosphereMEAAVITVTLIGSFWAAFALQKAALEGLFRVMDVNRRARD*
Ga0150985_11518579633300012212Avena Fatua RhizosphereMEALLISATLVGSFFGAFVLQKAALEGLFRVMNAERRFRE*
Ga0150985_11568633323300012212Avena Fatua RhizosphereMEAVVITATLFGSFATAWAIQKTALEALFRAMSPERRARE*
Ga0150985_11763749423300012212Avena Fatua RhizosphereMEAVLITGALFGSFATAFVIQKAALEGLFRMMSPSRRARQ*
Ga0150985_11814854633300012212Avena Fatua RhizosphereMEAIVIGATLLSSFVGAFALQKAALEGLFRAMNADRRARQ*
Ga0150985_11866779113300012212Avena Fatua RhizosphereMDTLVIAGTLLGSLAAAFGLQKMALESLFRIMDAERRSRQ*
Ga0150985_12039757623300012212Avena Fatua RhizosphereMETVVITAALFGSFATAWAIQKTALEALFRMMSPDRRARQ*
Ga0150985_12047457823300012212Avena Fatua RhizosphereMDAFLITATLFGSFATAFYIQRAALEGLFRMMDPNRRERQ*
Ga0150985_12105973123300012212Avena Fatua RhizosphereALPICLNREAFVIGATLFGSFFGAFAIQKAALEGLFRMMTPERRPRE*
Ga0150985_12111022613300012212Avena Fatua RhizosphereTATLFGSFATAWAIQKTALEALFRMMNPDRRARQ*
Ga0150985_12126830423300012212Avena Fatua RhizosphereMEAIVIAGTLVGSAAAAFVLQKAALESIFRLMAAGQGRRDRA*
Ga0137372_1079090513300012350Vadose Zone SoilMEAIVITATLVGSFVGALAIQRAALEGLFRAMDADRRSGRE*
Ga0150984_10907278413300012469Avena Fatua RhizosphereQMDAVVIAGTLLGSVVAAFALQKAALEGLFRIMDAERRTRL*
Ga0150984_11180832723300012469Avena Fatua RhizosphereMEAAVITVTLIGSLWGAFALQKAALEGLFRVMDVNRRARE*
Ga0150984_11410983123300012469Avena Fatua RhizosphereMEALLISATLVGSFFGAFVLQKAALEGLFRVMNAERHLRE*
Ga0150984_11428063433300012469Avena Fatua RhizosphereFVITAALFGSFATAFYIQRAALEGLFRMMDPNRRERP*
Ga0150984_11528472323300012469Avena Fatua RhizosphereMEALVIGATLLSSFVGAFALQKAALEGLFRAMNADRRARQ*
Ga0150984_11659790323300012469Avena Fatua RhizosphereMDALLIAATLFSSFLGAFALQKAALEGLFRAMNADRRTRE*
Ga0150984_12308406023300012469Avena Fatua RhizosphereMEAFVIGATVFGSFLGAFAIQKAALEGLFRMMTPERRLRE*
Ga0137404_1103860823300012929Vadose Zone SoilMDALLIAVTLFSSFLGAFVLQKAALEGLFRAMNADRRERE*
Ga0137407_1237284513300012930Vadose Zone SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNAERRNQR*
Ga0164299_1130864023300012958SoilMEAVVITATLVGSFATAWAIQKTALEALFRVMSPDRRARQ*
Ga0157373_1132366023300013100Corn RhizosphereTMEAFVIGATLFGSFLGAFAIQKAALEGLFRMMTPERRPHE*
Ga0157370_1136600413300013104Corn RhizosphereMEAVVITAALFGSFASAFVIQKAALEGLLRMMSPNRRARG*
Ga0157369_1235842213300013105Corn RhizosphereMAGEVKPMEAVVITAALFGSFASAFVIQKAALEGLLRMMSPNRRARG*
Ga0157378_1221127023300013297Miscanthus RhizosphereMEVVVITATLVGSFATAWAIQKTALEALFRVLAPNRRARE*
Ga0157378_1242847123300013297Miscanthus RhizosphereMEAFVITATLFGSFATAFFIQRAALEGLFRMMDPNRRERP*
Ga0157378_1250595523300013297Miscanthus RhizosphereMGEEGNPMETLVIAGTLFGSLAAAFALQKAALEGLFRFMEADRRSRD*
Ga0163162_1190300823300013306Switchgrass RhizosphereMGEEGNPMETLVIAGTLFGSLAAAFALQKAALEGLF
Ga0157372_1057870723300013307Corn RhizosphereMPGDSSTMEAFVIGATLFGSFLGAFAIQKAALEGLFRMMTPERRPHE*
Ga0157372_1116195133300013307Corn RhizosphereVIGATLLGRFVGAFALQKAALEGLFRMMETDRRARH*
Ga0181533_104512023300014152BogMEAFVIGATLLGSFVGAFLLQKVALEGLFRWMDASRRARQ*
Ga0157380_1212818423300014326Switchgrass RhizosphereMEAIIITTTVFGSFFGAFLLQKAALQGFFRMMETERRARQ*
Ga0157380_1309748923300014326Switchgrass RhizosphereMEAVVITAALAGSFATAWAIQKTALEALFRVLSPNRRARQ*
Ga0157380_1344532213300014326Switchgrass RhizosphereWKMEAIVIATTVFGSAFGAFLLQKAALEGLFRMLNADRRARY*
Ga0182024_1009042963300014501PermafrostMDAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRARH*
Ga0182024_1049622633300014501PermafrostMAMAAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRRE*
Ga0182024_1062162133300014501PermafrostMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRARR*
Ga0182024_1141928333300014501PermafrostMEAIVVVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRH*
Ga0157377_1174101223300014745Miscanthus RhizosphereMEAVVITATLVGSFATAWAIQKTALEALFRMMSPDRRARQ*
Ga0157376_1107772313300014969Miscanthus RhizosphereMDAFVITAALFGSFAGAFILQKAALEGLFRIMQMERRARQ*
Ga0167638_100277113300015197Glacier Forefield SoilMEAFVIAGTLLGSFAGAFALQKVALEGLFRLMNVDRRIRQ*
Ga0137412_1048466843300015242Vadose Zone SoilMDAVLIASTLVGSFFGAFLIQKAALEGLFRMMNAERRTHE*
Ga0132258_1390465733300015371Arabidopsis RhizosphereMEAFVIGATLFGSFLGAFAIQKAALEGLFRIMNAERRPRE*
Ga0132257_10144162523300015373Arabidopsis RhizosphereMEAVVITATLFGSIAAAWAIQKTALEALFRVMSPDRRARQ*
Ga0182039_1171399813300016422SoilMETFVVATTLFGSFVGAFALQKVALEGFLRLIEDRRTRE
Ga0182038_1188945423300016445SoilMEALVITGTLLGSLAAAFALQKVALEGLFRFMKTERRSRQ
Ga0187818_1038753423300017823Freshwater SedimentMDALVIAATLVGSCAGAFVLQKAALEGLFRIMQTERRDRH
Ga0187817_1017445133300017955Freshwater SedimentMETFVIAATLVGSFVGAFVVQKAALGGLMRLLNGRRTRE
Ga0187783_1053009323300017970Tropical PeatlandMEAFVIGATAIGSFAAAFVIQKAALEGLFRILSGERRIRQ
Ga0187783_1101488613300017970Tropical PeatlandMEAVIVIGTVIGSFAGAFWLQKAALEGLFRIMHTDRRVRH
Ga0187780_1018707543300017973Tropical PeatlandMEAFVIAGVLIGSFATAFFIQKAALEGLFRIIDPERRARQ
Ga0187859_1050751523300018047PeatlandVQEDEDMDAVVVVGAVIGSFAGAFVLQKAALEGLFRMMNADRRLKQ
Ga0187784_1169161513300018062Tropical PeatlandMDALLIGGTLVGSVIGAFVIQKAALEGLLRIMHGDRRLRS
Ga0066655_1089036323300018431Grasslands SoilMEAFVITATLFGSFATAFFIQRAALEGLFRMMDPNRRERQ
Ga0066662_1201812623300018468Grasslands SoilMEAFVIATTVLGSFLGAFALQKFALEGLFRVMSWERRERQ
Ga0066669_1038873333300018482Grasslands SoilMEAVLITATLFGSFATAFYIQRAALEGLFRMMDSNRRDRH
Ga0184647_130771323300019263Groundwater SedimentMEAVVITAALVGSFATAWAIQKTALEALFRVMSPDRRARQ
Ga0137408_131050423300019789Vadose Zone SoilMDALLIAVTLFSSFLGAFVLQKAALEGLFRAMNADRRERE
Ga0197907_1024636123300020069Corn, Switchgrass And Miscanthus RhizosphereMEAVLITAALAGSFATAFVIQKFALEGLFRMMSPNRRVRE
Ga0197907_1127566813300020069Corn, Switchgrass And Miscanthus RhizospherePMEAVVITAALFGSFASAFVIQKAALEGLFRMMSPNRRARG
Ga0206356_1133024923300020070Corn, Switchgrass And Miscanthus RhizosphereMAGEVKPMEAVVITAALFGSFASAFVIQKAALEGLLRMMSPNRRARG
Ga0196963_1001983343300020215SoilMEAVVVTATLVGSFATAWAIQKSALEALFRAMSPNRRRRE
Ga0210399_1048705633300020581SoilMETIVIAATLVGSFAGAFALQKAALEGLFRIMAAPRPSEAQAFRRR
Ga0210401_1011323923300020583SoilMEALIISATVFGSFLGAFALQKAALEGLFRMMGTDRRSRQ
Ga0210405_1077616323300021171SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNADRRNHR
Ga0210396_1092414533300021180SoilMDALVISATLFGSFLGAFALQKAALEGLFRMMGSERRHRQ
Ga0213876_1003876323300021384Plant RootsMDAFVIGATLVGSLAGAFAIQKVALEGLFRLMTVERRARH
Ga0213876_1012462123300021384Plant RootsMDAFVIGATLVGSLAGAFAIQKVALEGLFRLMTVERRARD
Ga0210386_1151059433300021406SoilMDAFVIGATLFGSFVGAFALQKAALEGLFRIMDTGRRTRH
Ga0210383_1152109613300021407SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRMMNAERRNHR
Ga0210384_1108292523300021432SoilMEALVITGTLLGSLAAAFALQKAALEGLFRFMKAERRSRQ
Ga0210384_1166295423300021432SoilMEAVIVIGTVIGSFAGAFWLQKAALEGLFRIMHAERRVRD
Ga0210402_1032325323300021478SoilMEALVIAGTLLGSVAAAFALQKVTLASLLRMMDADRRSRE
Ga0210409_1129982123300021559SoilMEAFVIAGTLLGSFAGAFALQKAALEGLFRMMNADRRVRQ
Ga0126371_1024848033300021560Tropical Forest SoilREVRAMEAVIIIGAVVGSFAGAFALQKAALEGLFRMMNHDRRVRQ
Ga0126371_1077773723300021560Tropical Forest SoilMDALVIAGTLVASFAAAVALQRAALEGLFRAMNAERRTRE
Ga0126371_1103554413300021560Tropical Forest SoilMDTLVIGGTLLGSFVGAFVIQKAALEGLFRMLKAERRARR
Ga0126371_1138079633300021560Tropical Forest SoilREGKMETVVIAAALVGSFAGAFVIQKAALEGLFRIMDPNRRAR
Ga0126371_1198199913300021560Tropical Forest SoilMEAVIIIGAVVGSFAGAFALQKAALEGLFRMMNHDRRVRQ
Ga0126371_1265010413300021560Tropical Forest SoilMEAFVIAGTLIGSFATAFWIQKAALEGLFRIMNPN
Ga0126371_1336824223300021560Tropical Forest SoilMETVVIAATLLGSFAGAFLLQKVALEGLFRMMDPGRRVRQ
Ga0213853_1112044113300021861WatershedsMEAFVIAATLVGSFVGALALQKAALEGLFRIMGAPRRARQ
Ga0224712_1029439213300022467Corn, Switchgrass And Miscanthus RhizosphereTMEAFVIGVTLFGSFLGAFVLQKAALEGLFRMMQTDRRARQ
Ga0224712_1046558213300022467Corn, Switchgrass And Miscanthus RhizosphereEMEAVLITAALAGSFATAFVIQKFALEGLFRMMSPNRRVRE
Ga0242642_109651013300022504SoilALVISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ
Ga0222728_104738633300022508SoilDALVISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ
Ga0242652_105068233300022510SoilLVISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ
Ga0242663_111783713300022523SoilIASTLVGSFVGAFVLQKAALEGLFRVMNAERRNQR
Ga0242658_112565433300022530SoilDALLISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ
Ga0242660_106694213300022531SoilKMDALLISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ
Ga0242660_117553713300022531SoilAVLIVATLIASFAGAFAIQKAALEGLFRMMDTDRHIRH
Ga0242655_1033527723300022532SoilMDAFVIASTLVGTFVGAFVIQKAALEGLFRMMNADRRHQR
Ga0242662_1009355233300022533SoilISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ
Ga0242662_1009914023300022533SoilMDAFLIAATLVGSFAGAFVLQKAALEGLLRMMDLDRRSRH
Ga0212123_1027247633300022557Iron-Sulfur Acid SpringMEAFVIGATLLGSFVGAFALQKAALEGLFRIMDTGRRARD
Ga0242657_102982513300022722SoilKMDALVISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ
Ga0242657_120464713300022722SoilMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRH
Ga0242665_1004122613300022724SoilMDALLIIARLFGSFLGAFALQKAALEGLFRMMGSERRHRQ
Ga0242665_1036023223300022724SoilTMEAFVIASTLVGSFYGAFVIQKAALEGLFRIMDADRRTRH
Ga0208193_1000122283300025463PeatlandMEAIVIVGTMVGSFAGAFVLQKAALEGLFRMMNADRRTRH
Ga0207710_1047636513300025900Switchgrass RhizosphereKGFSTMEAVVIASTLVGSFFGAFLIQKAALEGLFRMMNAERRTHE
Ga0207685_1043849923300025905Corn, Switchgrass And Miscanthus RhizosphereMETFVITATLFGSFATAFFIQRAALEGLFRMMDSNRRERQ
Ga0207707_1071691213300025912Corn RhizosphereMEALLIGVTLFGSFLGAFAIQKAALEGLFRVMDAERRARH
Ga0207695_1001117163300025913Corn RhizosphereMEAFVIGATLFGSFLGAFILQKAALEGLFRMMQTDRRARQ
Ga0207693_1019210013300025915Corn, Switchgrass And Miscanthus RhizosphereMEAVLITAALAGSFATAFVIQKAALEGLFRMMTPNRRARQS
Ga0207661_100000191683300025944Corn RhizosphereMEAVVITATLAGSFATAFVIQKFALEGLFRMMSPNRRARE
Ga0207661_1164818623300025944Corn RhizosphereMEAFVIGVTLFGSFLGAFVLQKAALEGLFRMMQTDRRARQ
Ga0207667_1042032823300025949Corn RhizosphereMEAVVITATLAGSFATAFVIQKFALEGLFRIMSPNRRARQ
Ga0207667_1081719713300025949Corn RhizosphereITAALFGSFASAFVIQKAALEGLFRMMSPNRRARG
Ga0207667_1175432123300025949Corn RhizosphereMAAVLITAAVAGSFATAFVIQKAALEGLFRMMTPNRRARQ
Ga0207703_1030756433300026035Switchgrass RhizosphereMEVVVITATLVGSFATAWAIQKTALEALFRVMAPNRRARE
Ga0207675_10127940433300026118Switchgrass RhizosphereMDAVVIASTLVGSFLGAFVIQKAALEGLMRMMNTERRTEK
Ga0179593_108676523300026555Vadose Zone SoilMEAFVIASTLVGSFLGAFLVQKAALEGLFRIMNAERRTHR
Ga0208043_106551023300027570Peatlands SoilMDALVIAATLVGSCAGAFVLQKAALEGLFRIMLTERRDRH
Ga0209009_110525913300027667Forest SoilMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRTRQ
Ga0209581_102904623300027706Surface SoilMEAFVIAGALIGSFATAFFIQKAALEGLFRVIGPERRGRQ
Ga0209039_1001944143300027825Bog Forest SoilMEDLLLIGATVFGSFVDAFVLQKAALKGFFRIMGTERRARR
Ga0209060_1000037963300027826Surface SoilMDAFLIASTLVGSFVGAFVLQKAALEGLFRMMNAERRNQR
Ga0209580_1004844723300027842Surface SoilMDGFVIGATVLGSFVGAFVIQKAALEGLFRIMITGRRPRH
Ga0209517_1004882633300027854Peatlands SoilMDALVIAATLVGTCAGAFLLQKAALEGLLRIMVTEERRSRH
Ga0209701_1060830913300027862Vadose Zone SoilFPRIGTMDAVVIAATLLSSFLGAFALQKAALEGLFRAMQANRRVRD
Ga0209167_1023209233300027867Surface SoilMDALLISATLFGSFLGAFALQKAALEGLFRIMDNERRDRH
Ga0209380_1029856223300027889SoilMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRARR
Ga0209067_1000648033300027898WatershedsMEAFVVAATLVGSFAGAFALQKVALEGLIRLMSSPRRARQ
Ga0209067_1001454123300027898WatershedsMDAFVISATLVGSFLAAFVLQKAALEGLFRMMGRTRH
Ga0209415_1003823633300027905Peatlands SoilMDVIVIGATLVGCFAGAFAIQKAALEGLFRIMDRDLRASRH
Ga0209006_1063985523300027908Forest SoilMEAIVIVGTIVGSFAGAFVLQKAALEGLFRMMNADRRT
Ga0209698_1104005823300027911WatershedsMETVVVTVTLLGSFAGAFALQKAALEGLIRLMGSPRRARQ
Ga0209062_108162023300027965Surface SoilMEAFVIAGTLIGSLATAFFIQKAALEGLFRIMSDPDRRARQ
Ga0209061_1001639103300027968Surface SoilMNALLIGATLAGSLVGAFAIQKAALQGLLHVMNAGRRTRR
Ga0268266_1114352433300028379Switchgrass RhizosphereMEAFVIGATLFGSFFGAFAIQKAALEGLFRMMTPERRTRE
Ga0307504_1022183523300028792SoilMEAFVITTTLLGSFVGAFALQKAALEGLFRMMDPERRAAGSTPR
Ga0222749_1026472423300029636SoilMEAFVIGATLVGSFLGAFALQKAALEGLFRLMGPPRRQ
Ga0222749_1064154313300029636SoilMDAFVIASTLVGSFVGAFIIQKAALEGLFRMMNAERRTHR
Ga0311340_1020579823300029943PalsaMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRARH
Ga0311339_1119743633300029999PalsaMDAVVIVGAVVGSFAGAFILQKAALEGLFRIMNADRRMRH
Ga0316363_1006937823300030659Peatlands SoilMDALVIAATLVGSCAGAFVLQKAALEGLFRIMRTERRARH
Ga0316363_1029722213300030659Peatlands SoilMDAFLIGATLVGSFLGAFALQKAALEGLFRIMDTGRRARH
Ga0307482_126704313300030730Hardwood Forest SoilSGEVKTMEAFVIGATLVGSFVGAFALQKAALEGLFRIMDTGRRARH
Ga0307482_127134033300030730Hardwood Forest SoilMEAIVIVGTIVGSFAGAFVLQKAALEGLFRMMNADRRTRQ
Ga0307482_128446723300030730Hardwood Forest SoilMDALLITATLAGSFLGAFALQKAALEGLFRIMGAERRERQ
Ga0073994_1011797313300030991SoilMDGVVIGATVIGSFVGALMIQKAALEGLFRIMQTGRRARQ
Ga0170834_10097964133300031057Forest SoilGTKMDALLISATLFGSFLGAFALQKAALEGLFRMMGSERRQRQ
Ga0308189_1052266713300031058SoilTIVIAATLVGSFAGALALQKAALEGLFRMMGATRRTRD
Ga0170824_11043449723300031231Forest SoilMDAFVIASTVVGSFLGAFLVQKAALEGLFRIMNAERRTHR
Ga0170824_12291390423300031231Forest SoilMDALVIAGTLLGSAAAAFALQKAALESLFRIMDAGRRARE
Ga0170824_12878126433300031231Forest SoilGTKMDALLISATLFGSFLGAFALQKAALDGLFRMMGSERRQRQ
Ga0302325_1026702823300031234PalsaMEAIVVVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRG
Ga0302325_1055338233300031234PalsaMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRTRQ
Ga0302325_1089622233300031234PalsaMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRTRR
Ga0302325_1146663223300031234PalsaMEAVLIAGAFVGSFAGAFVIQKAALEGLFRMMNADRRSRL
Ga0302324_10217000513300031236PalsaEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMDADRRARH
Ga0302324_10351217033300031236PalsaMDAVVVIGAVVGSFAGAFLLQKAALEGLFRMMNADRRLRQ
Ga0318538_1063727223300031546SoilMEAFVIAGALIASFATAFVIQKAALQGLFRIINPDRRARQ
Ga0318572_1095066333300031681SoilITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ
Ga0310686_10953405353300031708SoilMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRSRN
Ga0310686_11432471923300031708SoilMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRR
Ga0310813_1207820223300031716SoilMEAVVITATLFGSFATAWAIQKTALEALFRMMSPNRRARE
Ga0307474_1155881423300031718Hardwood Forest SoilMDALLISATLFGSFLGAFALQKAALEGLFRMMGSERRHRQ
Ga0318521_1049390713300031770SoilVITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ
Ga0318568_1102862623300031819SoilMEALVITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ
Ga0306925_1209501713300031890SoilMDTVVIGAALVGSFAGAFVIQKLALESLLRMMTTERRNRQ
Ga0306923_1037306123300031910SoilMEAFVIAGALIASFFAAFVIQKAALEGLFRIINPDRRARQ
Ga0306923_1214098433300031910SoilNTMDALVITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ
Ga0308175_10119343723300031938SoilMEAVVITATLFGSFATAWAIQKTALEALFRMMAPNRRVRE
Ga0308174_1001151823300031939SoilMEAFVIGATLLGSFVGAFALQKAALEGLFRMMETDRRARH
Ga0308174_1001806223300031939SoilMDAFVIGATLVGSFAGAFVLQKVALEGLFRLMDSGRRARQ
Ga0308174_1034064233300031939SoilGKGPTMEAFVITATLFGSFATAFFIQRAALEGLFRMMDPNRRERQ
Ga0306926_1240840623300031954SoilMDALVIAGTLLGSAAAAFALQKAALESLFRIMDAGRRTRQ
Ga0307479_1082683323300031962Hardwood Forest SoilMEAFVIAGTLIGSFATAFVIQKVALEGIFRIMDSERRPRQ
Ga0308176_1117193633300031996SoilMEAFVITATLFGSFATAFFIQRAALEGLFRMMAPNRRERQ
Ga0308176_1206240833300031996SoilKMEAFVIGATLLGSFVGAFALQKAALEGLFRMMETDRRARH
Ga0318575_1065882123300032055SoilMDALVITGTLLGSLAAAFALQKAALEGLFRFMKTE
Ga0316051_102128913300032119SoilMAMEAIVIVGTVVGSFAGAFVLQKAALEGLFRMMNADRRARR
Ga0311301_1152912533300032160Peatlands SoilMDAVLIASTLVGSFVGAFVIQKAALEGLFRIMNADRRNHR
Ga0348332_1021185523300032515Plant LitterMDAIMIVGAVVGSFAGAFILQKAALEGMFRMMNADRRLRH
Ga0348332_1242898433300032515Plant LitterMEAIVIVGAVVGSFAGAFVLQKAALEGLFRMMNADRRARR
Ga0348332_1353724323300032515Plant LitterMEMDAVVIVGAVVGSFAGAFVLQRAALEGLFRIMNADRRTRH
Ga0335085_10006652123300032770SoilMAAFVIGATLVGSFAGAFVLQKAALEGLFRWMDTGRRARQ
Ga0335085_1005085643300032770SoilMDAVVIAGALAASFATAFAIQKAALEGLFRIIGLGRRARQ
Ga0335085_1008623033300032770SoilMEAIVIAGALVCSFVTGFLIQKAALKGLFRIIDPDRRARQ
Ga0335085_1013440453300032770SoilMEEAFVILGALVGSFATAFFIQKVALEGLFRIINPDRRARQ
Ga0335085_1019315333300032770SoilMETLVIAATLFGSFLGALALQKAALEGLFRLMGAERRVRQ
Ga0335085_1063656433300032770SoilMEAVVIAGAFIGSFLGALAIQKAALEGLFRIMDLERRGRR
Ga0335082_1033583123300032782SoilMEAIVITATLVGSFVGALALQKAALEGLFRVMDVGRRSTRE
Ga0335082_1114023723300032782SoilMDAIVIAATLVGSFAGAFALQKAALEGLLRILDTGRRARH
Ga0335079_1005685943300032783SoilMDAFVIASTLVGSFVGAFVIQKAALEGLFRIMNADRRNHQR
Ga0335079_1011665733300032783SoilMETLLIVATVFGSFLGAFALQKAALEGLFRLMDAERRVRQ
Ga0335079_1182985123300032783SoilMETVVIAATLVGSFWGAFVIQKAALEGLFRVMDAGRRTRQ
Ga0335078_1028715643300032805SoilSISVWREETAMAAFVIGATLVGSFAGAFVLQKAALEGLFRWMDTGRRARQ
Ga0335078_1039681643300032805SoilMDALVIAATLVGTCAGAFVLQKAALEGLLRIIETGERRVRQ
Ga0335078_1043224923300032805SoilMATFIIGATLAGSLAGAFALQKAVLEAFFRLMDPQARR
Ga0335078_1044417313300032805SoilMAAFVIGATLVGSFAGAFVLQKAALEGLFRWMDTGR
Ga0335078_1188244733300032805SoilMDALLISATVFGSFLGAFALQKAALEGLFRILGADRRPRR
Ga0335078_1236844223300032805SoilMDTVIIGATLFGSFVGAMVIQKAALEGLFRIMETGR
Ga0335080_1082292923300032828SoilMEAFVIAGTLIGSFATAFFIQKAALEGLFRILNDPDRRARQ
Ga0335070_1036976123300032829SoilMDAVVLGTTLAGCFVGAFVIQKAALEGLLRIMNAGRRVRR
Ga0335070_1121884113300032829SoilMEAIVIAGTLVGSLAAAFVLQKAALESIFRLMAAGRRDRV
Ga0335069_1154814423300032893SoilMEAVLIAATVLGSFLGALAIQKAALEGLLRMMEADRRARQ
Ga0335071_1017891213300032897SoilVDTVLIAATLLGSFAGAVVLQKAALEGLFRVMEAGRRAPR
Ga0335071_1058898823300032897SoilMDAVIIGATVISSFFGAFVIQKAALEGLFRIMGTGRRARQ
Ga0335071_1183174123300032897SoilMGAILISAALAGSFLGAFALQKAALEGLFRIMGADRRPRH
Ga0335072_1121827923300032898SoilMDAFVIGATVLGSFLGAFALQKVALEGLFRIMDTGRRGRH
Ga0335076_1147430423300032955SoilMTEMDAIVITATLVGSFVGAWALQKAALEGLFRVMDAGRRSTRE
Ga0335084_1002141123300033004SoilMEAIVITATLVGSFVGALALQKAALEGLFRAMDAGRRSTRE
Ga0335073_1020712933300033134SoilMDAVIIGATLISSFVGAFVIQKAALEGLFRIMETGRRSRQ
Ga0335073_1168157613300033134SoilMGAFVIGATLLGSFAGAFLLQKAALEGLFRWMGAGRRARQ
Ga0310914_1047269023300033289SoilMDALVITGTLLGSLAAAFALQKAALEGLFRFMKTERRSRQ
Ga0326728_10000772683300033402Peat SoilMEAVVIGTALLGSFVGAFVIQKAALEGLLRWMDSGRRARR
Ga0326728_1001636253300033402Peat SoilMDALVIAATLVGTCAGAFVLQKAALEGLFRIIATGERRTRH
Ga0326727_1084671833300033405Peat SoilMEAFVIGATLFGSFLGAFALEKAAMEGLFRIMDTGRRARH
Ga0316628_10159230913300033513SoilMETFLIGTTLLGSFIGAFMLQKAALEGLFRLMNAERCARE
Ga0316628_10305052133300033513SoilEAVVITAALLGSFATAWAIQKTALEALFRMMSPDRRARD
Ga0371489_0473635_1_1113300033755Peat SoilMDALVIAATLVGTCAGAFVLQKAALEGLFRIIATGER
Ga0314861_0430433_123_2423300033977PeatlandMETFVIAATLVGSFVGAWVVQKAALEGLMRFLNGRRTRE
Ga0372943_0246683_897_10193300034268SoilMEAFVITATLVGSFATAFIIQKAALEGLFRMMDPSRRARD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.