Metagenome Family F007098

Basic Information
Family ID	F007098
Family Type	Metagenome
Number of Sequences	357
Average Sequence Length	37 residues
Representative Sequence	MKDGEMVLIAQPLLESRTGAYLEWLANEVIMTANKT
Number of Associated Samples	80
Number of Associated Scaffolds	357

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	4.30 %
% of genes near scaffold ends (potentially truncated)	21.57 %
% of genes from short scaffolds (< 2000 bps)	97.48 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Unclassified (98.599 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.398 % of family members)
Environment Ontology (ENVO)	Unclassified (94.958 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (94.958 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 357 Family Scaffolds
PF00004	AAA	0.28

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
All Organisms	root	All Organisms	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
cellular organisms	root	All Organisms → cellular organisms	1.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.12 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1.12 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	1.12 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	1.12 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1.12 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	1.12 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1.12 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.60 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.56 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.28 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300009148\|Ga0105243_11050170	Not Available	820	Open in IMG/M
3300009148\|Ga0105243_11406159	Not Available	718	Open in IMG/M
3300009148\|Ga0105243_12129256	Not Available	597	Open in IMG/M
3300009148\|Ga0105243_13012195	Not Available	511	Open in IMG/M
3300011119\|Ga0105246_11566863	Not Available	621	Open in IMG/M
3300013296\|Ga0157374_11297944	Not Available	750	Open in IMG/M
3300013296\|Ga0157374_11958372	Not Available	612	Open in IMG/M
3300013296\|Ga0157374_12226985	Not Available	575	Open in IMG/M
3300013297\|Ga0157378_11054321	Not Available	849	Open in IMG/M
3300013297\|Ga0157378_11885180	Not Available	647	Open in IMG/M
3300013297\|Ga0157378_12849901	Not Available	536	Open in IMG/M
3300014969\|Ga0157376_11058421	Not Available	836	Open in IMG/M
3300014969\|Ga0157376_11772314	Not Available	653	Open in IMG/M
3300014969\|Ga0157376_12735717	Not Available	533	Open in IMG/M
3300015267\|Ga0182122_1040241	Not Available	593	Open in IMG/M
3300015267\|Ga0182122_1048196	Not Available	565	Open in IMG/M
3300015267\|Ga0182122_1056868	Not Available	539	Open in IMG/M
3300015267\|Ga0182122_1062767	Not Available	523	Open in IMG/M
3300015267\|Ga0182122_1070316	Not Available	506	Open in IMG/M
3300015268\|Ga0182154_1022586	Not Available	696	Open in IMG/M
3300015268\|Ga0182154_1040948	Not Available	595	Open in IMG/M
3300015268\|Ga0182154_1062568	Not Available	527	Open in IMG/M
3300015269\|Ga0182113_1030749	Not Available	710	Open in IMG/M
3300015269\|Ga0182113_1034263	Not Available	688	Open in IMG/M
3300015269\|Ga0182113_1057981	Not Available	590	Open in IMG/M
3300015269\|Ga0182113_1082943	Not Available	529	Open in IMG/M
3300015274\|Ga0182188_1021471	Not Available	664	Open in IMG/M
3300015274\|Ga0182188_1055563	Not Available	519	Open in IMG/M
3300015275\|Ga0182172_1000162	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	3106	Open in IMG/M
3300015275\|Ga0182172_1039080	Not Available	613	Open in IMG/M
3300015275\|Ga0182172_1050194	Not Available	571	Open in IMG/M
3300015275\|Ga0182172_1055971	Not Available	553	Open in IMG/M
3300015275\|Ga0182172_1069302	Not Available	518	Open in IMG/M
3300015276\|Ga0182170_1013691	Not Available	814	Open in IMG/M
3300015276\|Ga0182170_1014855	Not Available	796	Open in IMG/M
3300015276\|Ga0182170_1018957	Not Available	747	Open in IMG/M
3300015276\|Ga0182170_1030057	Not Available	660	Open in IMG/M
3300015276\|Ga0182170_1031889	Not Available	649	Open in IMG/M
3300015276\|Ga0182170_1059231	Not Available	545	Open in IMG/M
3300015277\|Ga0182128_1019393	Not Available	746	Open in IMG/M
3300015277\|Ga0182128_1023447	Not Available	710	Open in IMG/M
3300015277\|Ga0182128_1027592	Not Available	680	Open in IMG/M
3300015277\|Ga0182128_1066540	Not Available	530	Open in IMG/M
3300015279\|Ga0182174_1021685	Not Available	746	Open in IMG/M
3300015279\|Ga0182174_1037286	Not Available	643	Open in IMG/M
3300015279\|Ga0182174_1046492	Not Available	604	Open in IMG/M
3300015279\|Ga0182174_1049955	Not Available	592	Open in IMG/M
3300015279\|Ga0182174_1071577	Not Available	532	Open in IMG/M
3300015281\|Ga0182160_1030066	Not Available	673	Open in IMG/M
3300015281\|Ga0182160_1044201	Not Available	606	Open in IMG/M
3300015281\|Ga0182160_1084866	Not Available	500	Open in IMG/M
3300015282\|Ga0182124_1011129	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	873	Open in IMG/M
3300015282\|Ga0182124_1022266	Not Available	725	Open in IMG/M
3300015282\|Ga0182124_1027477	Not Available	686	Open in IMG/M
3300015282\|Ga0182124_1032527	Not Available	656	Open in IMG/M
3300015282\|Ga0182124_1059439	Not Available	554	Open in IMG/M
3300015282\|Ga0182124_1072502	Not Available	523	Open in IMG/M
3300015283\|Ga0182156_1036404	Not Available	651	Open in IMG/M
3300015283\|Ga0182156_1037533	Not Available	646	Open in IMG/M
3300015283\|Ga0182156_1045089	Not Available	613	Open in IMG/M
3300015283\|Ga0182156_1056630	Not Available	574	Open in IMG/M
3300015283\|Ga0182156_1056889	Not Available	574	Open in IMG/M
3300015283\|Ga0182156_1063554	Not Available	555	Open in IMG/M
3300015283\|Ga0182156_1087713	Not Available	502	Open in IMG/M
3300015285\|Ga0182186_1040885	Not Available	620	Open in IMG/M
3300015285\|Ga0182186_1049624	Not Available	587	Open in IMG/M
3300015285\|Ga0182186_1060933	Not Available	552	Open in IMG/M
3300015285\|Ga0182186_1070680	Not Available	528	Open in IMG/M
3300015285\|Ga0182186_1071417	Not Available	526	Open in IMG/M
3300015286\|Ga0182176_1048598	Not Available	602	Open in IMG/M
3300015286\|Ga0182176_1058473	Not Available	568	Open in IMG/M
3300015286\|Ga0182176_1085859	Not Available	500	Open in IMG/M
3300015287\|Ga0182171_1061182	Not Available	562	Open in IMG/M
3300015288\|Ga0182173_1036041	Not Available	647	Open in IMG/M
3300015288\|Ga0182173_1052788	Not Available	582	Open in IMG/M
3300015288\|Ga0182173_1057061	Not Available	569	Open in IMG/M
3300015288\|Ga0182173_1063215	Not Available	552	Open in IMG/M
3300015288\|Ga0182173_1086197	Not Available	502	Open in IMG/M
3300015289\|Ga0182138_1020352	Not Available	765	Open in IMG/M
3300015289\|Ga0182138_1054070	Not Available	584	Open in IMG/M
3300015291\|Ga0182125_1040672	Not Available	645	Open in IMG/M
3300015291\|Ga0182125_1064589	Not Available	565	Open in IMG/M
3300015291\|Ga0182125_1091890	Not Available	507	Open in IMG/M
3300015291\|Ga0182125_1094766	Not Available	502	Open in IMG/M
3300015292\|Ga0182141_1038278	Not Available	655	Open in IMG/M
3300015292\|Ga0182141_1044786	Not Available	626	Open in IMG/M
3300015292\|Ga0182141_1056260	Not Available	587	Open in IMG/M
3300015292\|Ga0182141_1063153	Not Available	567	Open in IMG/M
3300015292\|Ga0182141_1065796	Not Available	561	Open in IMG/M
3300015292\|Ga0182141_1093302	Not Available	504	Open in IMG/M
3300015292\|Ga0182141_1093894	Not Available	503	Open in IMG/M
3300015294\|Ga0182126_1018152	Not Available	812	Open in IMG/M
3300015294\|Ga0182126_1032346	Not Available	692	Open in IMG/M
3300015295\|Ga0182175_1021266	Not Available	785	Open in IMG/M
3300015295\|Ga0182175_1035922	Not Available	678	Open in IMG/M
3300015295\|Ga0182175_1055978	Not Available	597	Open in IMG/M
3300015295\|Ga0182175_1057945	Not Available	591	Open in IMG/M
3300015296\|Ga0182157_1011070	Not Available	957	Open in IMG/M
3300015296\|Ga0182157_1045527	Not Available	644	Open in IMG/M
3300015296\|Ga0182157_1095965	Not Available	514	Open in IMG/M
3300015298\|Ga0182106_1023370	Not Available	779	Open in IMG/M
3300015298\|Ga0182106_1028677	Not Available	735	Open in IMG/M
3300015298\|Ga0182106_1045032	Not Available	646	Open in IMG/M
3300015298\|Ga0182106_1047050	Not Available	638	Open in IMG/M
3300015298\|Ga0182106_1050012	Not Available	627	Open in IMG/M
3300015298\|Ga0182106_1083587	Not Available	537	Open in IMG/M
3300015298\|Ga0182106_1092189	Not Available	520	Open in IMG/M
3300015298\|Ga0182106_1098826	Not Available	509	Open in IMG/M
3300015299\|Ga0182107_1039362	Not Available	675	Open in IMG/M
3300015299\|Ga0182107_1041346	Not Available	665	Open in IMG/M
3300015299\|Ga0182107_1061179	Not Available	594	Open in IMG/M
3300015299\|Ga0182107_1069312	Not Available	571	Open in IMG/M
3300015300\|Ga0182108_1073537	Not Available	565	Open in IMG/M
3300015300\|Ga0182108_1089729	Not Available	531	Open in IMG/M
3300015300\|Ga0182108_1097357	Not Available	517	Open in IMG/M
3300015302\|Ga0182143_1069915	Not Available	570	Open in IMG/M
3300015302\|Ga0182143_1081466	Not Available	543	Open in IMG/M
3300015302\|Ga0182143_1098666	Not Available	511	Open in IMG/M
3300015303\|Ga0182123_1037933	Not Available	662	Open in IMG/M
3300015303\|Ga0182123_1044111	Not Available	635	Open in IMG/M
3300015303\|Ga0182123_1048697	Not Available	618	Open in IMG/M
3300015304\|Ga0182112_1048891	Not Available	635	Open in IMG/M
3300015304\|Ga0182112_1083136	Not Available	542	Open in IMG/M
3300015304\|Ga0182112_1090890	Not Available	527	Open in IMG/M
3300015304\|Ga0182112_1098821	Not Available	514	Open in IMG/M
3300015304\|Ga0182112_1099658	Not Available	512	Open in IMG/M
3300015305\|Ga0182158_1031274	Not Available	718	Open in IMG/M
3300015305\|Ga0182158_1035465	Not Available	692	Open in IMG/M
3300015305\|Ga0182158_1063017	Not Available	587	Open in IMG/M
3300015305\|Ga0182158_1083546	Not Available	539	Open in IMG/M
3300015305\|Ga0182158_1089765	Not Available	527	Open in IMG/M
3300015305\|Ga0182158_1091411	Not Available	524	Open in IMG/M
3300015305\|Ga0182158_1096966	Not Available	514	Open in IMG/M
3300015305\|Ga0182158_1097191	Not Available	514	Open in IMG/M
3300015305\|Ga0182158_1102075	Not Available	506	Open in IMG/M
3300015307\|Ga0182144_1010915	Not Available	976	Open in IMG/M
3300015307\|Ga0182144_1014370	Not Available	907	Open in IMG/M
3300015307\|Ga0182144_1056516	Not Available	614	Open in IMG/M
3300015307\|Ga0182144_1073381	Not Available	568	Open in IMG/M
3300015307\|Ga0182144_1074058	Not Available	567	Open in IMG/M
3300015307\|Ga0182144_1106238	Not Available	506	Open in IMG/M
3300015308\|Ga0182142_1063644	Not Available	605	Open in IMG/M
3300015308\|Ga0182142_1064375	Not Available	603	Open in IMG/M
3300015308\|Ga0182142_1081581	Not Available	560	Open in IMG/M
3300015308\|Ga0182142_1102201	Not Available	522	Open in IMG/M
3300015313\|Ga0182164_1129610	Not Available	514	Open in IMG/M
3300015314\|Ga0182140_1014303	Not Available	925	Open in IMG/M
3300015314\|Ga0182140_1022530	Not Available	816	Open in IMG/M
3300015314\|Ga0182140_1041482	Not Available	688	Open in IMG/M
3300015314\|Ga0182140_1066104	Not Available	599	Open in IMG/M
3300015314\|Ga0182140_1075718	Not Available	575	Open in IMG/M
3300015321\|Ga0182127_1095525	Not Available	548	Open in IMG/M
3300015321\|Ga0182127_1096330	Not Available	547	Open in IMG/M
3300015321\|Ga0182127_1102771	Not Available	535	Open in IMG/M
3300015321\|Ga0182127_1107522	Not Available	527	Open in IMG/M
3300015321\|Ga0182127_1119615	Not Available	509	Open in IMG/M
3300015322\|Ga0182110_1090763	Not Available	556	Open in IMG/M
3300015322\|Ga0182110_1092605	Not Available	553	Open in IMG/M
3300015322\|Ga0182110_1102495	Not Available	535	Open in IMG/M
3300015322\|Ga0182110_1126014	Not Available	500	Open in IMG/M
3300015323\|Ga0182129_1025536	Not Available	787	Open in IMG/M
3300015323\|Ga0182129_1028934	Not Available	759	Open in IMG/M
3300015323\|Ga0182129_1047657	Not Available	658	Open in IMG/M
3300015323\|Ga0182129_1068399	Not Available	591	Open in IMG/M
3300015323\|Ga0182129_1084363	Not Available	555	Open in IMG/M
3300015323\|Ga0182129_1117572	Not Available	500	Open in IMG/M
3300015341\|Ga0182187_1042007	Not Available	866	Open in IMG/M
3300015341\|Ga0182187_1094359	Not Available	659	Open in IMG/M
3300015341\|Ga0182187_1154396	Not Available	553	Open in IMG/M
3300015341\|Ga0182187_1166114	Not Available	539	Open in IMG/M
3300015341\|Ga0182187_1175841	Not Available	527	Open in IMG/M
3300015341\|Ga0182187_1188555	Not Available	514	Open in IMG/M
3300015342\|Ga0182109_1075736	Not Available	751	Open in IMG/M
3300015342\|Ga0182109_1079285	Not Available	739	Open in IMG/M
3300015342\|Ga0182109_1126321	Not Available	625	Open in IMG/M
3300015342\|Ga0182109_1133102	Not Available	612	Open in IMG/M
3300015342\|Ga0182109_1207436	Not Available	517	Open in IMG/M
3300015343\|Ga0182155_1150550	Not Available	585	Open in IMG/M
3300015343\|Ga0182155_1164322	Not Available	566	Open in IMG/M
3300015344\|Ga0182189_1123773	Not Available	634	Open in IMG/M
3300015344\|Ga0182189_1125292	Not Available	632	Open in IMG/M
3300015344\|Ga0182189_1135671	Not Available	614	Open in IMG/M
3300015344\|Ga0182189_1168558	Not Available	566	Open in IMG/M
3300015344\|Ga0182189_1172204	Not Available	561	Open in IMG/M
3300015344\|Ga0182189_1216342	Not Available	513	Open in IMG/M
3300015344\|Ga0182189_1222103	Not Available	508	Open in IMG/M
3300015344\|Ga0182189_1229827	Not Available	501	Open in IMG/M
3300015345\|Ga0182111_1082294	Not Available	760	Open in IMG/M
3300015345\|Ga0182111_1090172	Not Available	736	Open in IMG/M
3300015345\|Ga0182111_1092154	Not Available	730	Open in IMG/M
3300015345\|Ga0182111_1095857	Not Available	719	Open in IMG/M
3300015345\|Ga0182111_1102626	Not Available	701	Open in IMG/M
3300015345\|Ga0182111_1124098	Not Available	654	Open in IMG/M
3300015345\|Ga0182111_1146266	Not Available	614	Open in IMG/M
3300015345\|Ga0182111_1152645	Not Available	605	Open in IMG/M
3300015345\|Ga0182111_1181392	Not Available	565	Open in IMG/M
3300015345\|Ga0182111_1185406	Not Available	560	Open in IMG/M
3300015345\|Ga0182111_1214216	Not Available	530	Open in IMG/M
3300015345\|Ga0182111_1218266	Not Available	526	Open in IMG/M
3300015345\|Ga0182111_1235683	Not Available	510	Open in IMG/M
3300015345\|Ga0182111_1241769	Not Available	504	Open in IMG/M
3300015345\|Ga0182111_1244881	Not Available	502	Open in IMG/M
3300015345\|Ga0182111_1246415	Not Available	500	Open in IMG/M
3300015346\|Ga0182139_1038285	Not Available	999	Open in IMG/M
3300015346\|Ga0182139_1107920	Not Available	689	Open in IMG/M
3300015346\|Ga0182139_1165695	Not Available	586	Open in IMG/M
3300015346\|Ga0182139_1170933	Not Available	579	Open in IMG/M
3300015346\|Ga0182139_1187647	Not Available	559	Open in IMG/M
3300015346\|Ga0182139_1190114	Not Available	556	Open in IMG/M
3300015347\|Ga0182177_1036844	Not Available	1018	Open in IMG/M
3300015347\|Ga0182177_1068303	Not Available	818	Open in IMG/M
3300015347\|Ga0182177_1068736	Not Available	816	Open in IMG/M
3300015347\|Ga0182177_1122154	Not Available	660	Open in IMG/M
3300015347\|Ga0182177_1142720	Not Available	623	Open in IMG/M
3300015347\|Ga0182177_1168184	Not Available	585	Open in IMG/M
3300015347\|Ga0182177_1177510	Not Available	573	Open in IMG/M
3300015347\|Ga0182177_1244999	Not Available	505	Open in IMG/M
3300015351\|Ga0182161_1064936	Not Available	872	Open in IMG/M
3300015351\|Ga0182161_1076033	Not Available	822	Open in IMG/M
3300015351\|Ga0182161_1103826	Not Available	730	Open in IMG/M
3300015351\|Ga0182161_1137805	Not Available	655	Open in IMG/M
3300015351\|Ga0182161_1151430	Not Available	631	Open in IMG/M
3300015351\|Ga0182161_1232280	Not Available	532	Open in IMG/M
3300015355\|Ga0182159_1054843	Not Available	1086	Open in IMG/M
3300015355\|Ga0182159_1140709	Not Available	746	Open in IMG/M
3300015355\|Ga0182159_1180073	Not Available	672	Open in IMG/M
3300015355\|Ga0182159_1204887	Not Available	636	Open in IMG/M
3300015355\|Ga0182159_1209838	Not Available	630	Open in IMG/M
3300015355\|Ga0182159_1218673	Not Available	618	Open in IMG/M
3300015355\|Ga0182159_1230171	Not Available	605	Open in IMG/M
3300015355\|Ga0182159_1243735	Not Available	590	Open in IMG/M
3300015355\|Ga0182159_1264171	Not Available	569	Open in IMG/M
3300015355\|Ga0182159_1273891	Not Available	561	Open in IMG/M
3300015355\|Ga0182159_1308442	Not Available	532	Open in IMG/M
3300015355\|Ga0182159_1308767	Not Available	532	Open in IMG/M
3300015361\|Ga0182145_1045297	Not Available	814	Open in IMG/M
3300015361\|Ga0182145_1047953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	800	Open in IMG/M
3300017404\|Ga0182203_1078074	Not Available	640	Open in IMG/M
3300017404\|Ga0182203_1109131	Not Available	575	Open in IMG/M
3300017404\|Ga0182203_1134606	Not Available	537	Open in IMG/M
3300017404\|Ga0182203_1140571	Not Available	529	Open in IMG/M
3300017404\|Ga0182203_1161321	Not Available	505	Open in IMG/M
3300017404\|Ga0182203_1162803	Not Available	503	Open in IMG/M
3300017407\|Ga0182220_1036407	Not Available	681	Open in IMG/M
3300017409\|Ga0182204_1034573	Not Available	730	Open in IMG/M
3300017409\|Ga0182204_1071161	Not Available	590	Open in IMG/M
3300017409\|Ga0182204_1095153	Not Available	540	Open in IMG/M
3300017409\|Ga0182204_1102406	Not Available	528	Open in IMG/M
3300017410\|Ga0182207_1063692	Not Available	706	Open in IMG/M
3300017410\|Ga0182207_1118774	Not Available	576	Open in IMG/M
3300017410\|Ga0182207_1140987	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	543	Open in IMG/M
3300017410\|Ga0182207_1143180	Not Available	540	Open in IMG/M
3300017411\|Ga0182208_1071220	Not Available	607	Open in IMG/M
3300017411\|Ga0182208_1076185	Not Available	594	Open in IMG/M
3300017411\|Ga0182208_1123607	Not Available	510	Open in IMG/M
3300017411\|Ga0182208_1125068	Not Available	508	Open in IMG/M
3300017413\|Ga0182222_1052454	Not Available	608	Open in IMG/M
3300017413\|Ga0182222_1096940	Not Available	517	Open in IMG/M
3300017415\|Ga0182202_1066465	Not Available	638	Open in IMG/M
3300017415\|Ga0182202_1129866	Not Available	514	Open in IMG/M
3300017415\|Ga0182202_1138638	Not Available	503	Open in IMG/M
3300017415\|Ga0182202_1139441	Not Available	502	Open in IMG/M
3300017417\|Ga0182230_1046186	Not Available	764	Open in IMG/M
3300017417\|Ga0182230_1047953	Not Available	750	Open in IMG/M
3300017417\|Ga0182230_1068687	Not Available	632	Open in IMG/M
3300017424\|Ga0182219_1037032	Not Available	760	Open in IMG/M
3300017424\|Ga0182219_1053339	Not Available	679	Open in IMG/M
3300017424\|Ga0182219_1062523	Not Available	646	Open in IMG/M
3300017424\|Ga0182219_1102584	Not Available	555	Open in IMG/M
3300017424\|Ga0182219_1120386	Not Available	527	Open in IMG/M
3300017424\|Ga0182219_1137681	Not Available	505	Open in IMG/M
3300017425\|Ga0182224_1031946	Not Available	839	Open in IMG/M
3300017425\|Ga0182224_1055190	Not Available	712	Open in IMG/M
3300017425\|Ga0182224_1080682	Not Available	633	Open in IMG/M
3300017425\|Ga0182224_1088363	Not Available	616	Open in IMG/M
3300017425\|Ga0182224_1094649	Not Available	603	Open in IMG/M
3300017425\|Ga0182224_1112835	Not Available	570	Open in IMG/M
3300017425\|Ga0182224_1144240	Not Available	526	Open in IMG/M
3300017425\|Ga0182224_1158659	Not Available	509	Open in IMG/M
3300017427\|Ga0182190_1075199	Not Available	658	Open in IMG/M
3300017427\|Ga0182190_1137185	Not Available	536	Open in IMG/M
3300017427\|Ga0182190_1156645	Not Available	511	Open in IMG/M
3300017427\|Ga0182190_1158217	Not Available	509	Open in IMG/M
3300017430\|Ga0182192_1049128	Not Available	775	Open in IMG/M
3300017430\|Ga0182192_1059765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	726	Open in IMG/M
3300017430\|Ga0182192_1103288	Not Available	602	Open in IMG/M
3300017430\|Ga0182192_1138712	Not Available	544	Open in IMG/M
3300017430\|Ga0182192_1154835	Not Available	523	Open in IMG/M
3300017430\|Ga0182192_1160012	Not Available	517	Open in IMG/M
3300017430\|Ga0182192_1162477	Not Available	514	Open in IMG/M
3300017430\|Ga0182192_1162583	Not Available	514	Open in IMG/M
3300017433\|Ga0182206_1052203	Not Available	716	Open in IMG/M
3300017433\|Ga0182206_1094179	Not Available	595	Open in IMG/M
3300017433\|Ga0182206_1110224	Not Available	566	Open in IMG/M
3300017433\|Ga0182206_1124177	Not Available	545	Open in IMG/M
3300017433\|Ga0182206_1137902	Not Available	527	Open in IMG/M
3300017433\|Ga0182206_1140596	Not Available	523	Open in IMG/M
3300017433\|Ga0182206_1158970	Not Available	502	Open in IMG/M
3300017433\|Ga0182206_1160520	Not Available	501	Open in IMG/M
3300017436\|Ga0182209_1038409	Not Available	810	Open in IMG/M
3300017436\|Ga0182209_1048781	Not Available	753	Open in IMG/M
3300017436\|Ga0182209_1132112	Not Available	550	Open in IMG/M
3300017438\|Ga0182191_1163514	Not Available	522	Open in IMG/M
3300017438\|Ga0182191_1167761	Not Available	518	Open in IMG/M
3300017442\|Ga0182221_1066768	Not Available	672	Open in IMG/M
3300017442\|Ga0182221_1138744	Not Available	537	Open in IMG/M
3300017442\|Ga0182221_1162135	Not Available	510	Open in IMG/M
3300017442\|Ga0182221_1165170	Not Available	507	Open in IMG/M
3300017443\|Ga0182193_1123076	Not Available	593	Open in IMG/M
3300017443\|Ga0182193_1124397	Not Available	591	Open in IMG/M
3300017443\|Ga0182193_1132631	Not Available	578	Open in IMG/M
3300017443\|Ga0182193_1137924	Not Available	570	Open in IMG/M
3300017443\|Ga0182193_1157225	Not Available	545	Open in IMG/M
3300017443\|Ga0182193_1176398	Not Available	522	Open in IMG/M
3300017443\|Ga0182193_1193046	Not Available	506	Open in IMG/M
3300017680\|Ga0182233_1039844	Not Available	827	Open in IMG/M
3300017681\|Ga0182226_1073140	Not Available	632	Open in IMG/M
3300017681\|Ga0182226_1116464	Not Available	510	Open in IMG/M
3300017682\|Ga0182229_1046699	Not Available	734	Open in IMG/M
3300017683\|Ga0182218_1020963	Not Available	912	Open in IMG/M
3300017683\|Ga0182218_1086265	Not Available	602	Open in IMG/M
3300017683\|Ga0182218_1103871	Not Available	568	Open in IMG/M
3300017683\|Ga0182218_1110466	Not Available	558	Open in IMG/M
3300017683\|Ga0182218_1125744	Not Available	535	Open in IMG/M
3300017683\|Ga0182218_1128102	Not Available	532	Open in IMG/M
3300017683\|Ga0182218_1137852	Not Available	520	Open in IMG/M
3300017683\|Ga0182218_1143111	Not Available	514	Open in IMG/M
3300017683\|Ga0182218_1151425	Not Available	505	Open in IMG/M
3300017683\|Ga0182218_1153259	Not Available	503	Open in IMG/M
3300017684\|Ga0182225_1100312	Not Available	564	Open in IMG/M
3300017684\|Ga0182225_1102210	Not Available	560	Open in IMG/M
3300017685\|Ga0182227_1061400	Not Available	682	Open in IMG/M
3300017685\|Ga0182227_1063143	Not Available	674	Open in IMG/M
3300017685\|Ga0182227_1079711	Not Available	615	Open in IMG/M
3300017685\|Ga0182227_1085863	Not Available	598	Open in IMG/M
3300017685\|Ga0182227_1087325	Not Available	594	Open in IMG/M
3300017685\|Ga0182227_1123583	Not Available	521	Open in IMG/M
3300017686\|Ga0182205_1047629	Not Available	768	Open in IMG/M
3300017686\|Ga0182205_1100679	Not Available	603	Open in IMG/M
3300017689\|Ga0182231_1065173	Not Available	688	Open in IMG/M
3300017689\|Ga0182231_1071175	Not Available	659	Open in IMG/M
3300017690\|Ga0182223_1023178	Not Available	793	Open in IMG/M
3300017690\|Ga0182223_1033559	Not Available	720	Open in IMG/M
3300017690\|Ga0182223_1108817	Not Available	522	Open in IMG/M
3300021060\|Ga0182232_1080886	Not Available	528	Open in IMG/M
3300025899\|Ga0207642_10872364	Not Available	575	Open in IMG/M
3300025899\|Ga0207642_11020420	Not Available	533	Open in IMG/M
3300025908\|Ga0207643_10958641	Not Available	554	Open in IMG/M
3300025940\|Ga0207691_11121556	Not Available	654	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	94.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.20%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.84%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	94.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.92%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.84%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.28%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	94.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.28%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	94.40%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.40%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.28%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	0.28%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.28%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105243_110501701	3300009148	Miscanthus Rhizosphere	MKDGEMDLFAQLLLESRIGAYIEWLDNELIMTANKSHT*
Ga0105243_114061591	3300009148	Miscanthus Rhizosphere	MESDEIELFAQLLLESRTGAYIEWLDNELIMNANN*
Ga0105243_121292561	3300009148	Miscanthus Rhizosphere	MMKDGEMDLIAQLLLKSRTGAYTEWLNNELIMTANKKHT*
Ga0105243_130121952	3300009148	Miscanthus Rhizosphere	MKDGKMVLIDQPLLESRTGAYLEWLANEVIMTANKT*
Ga0105246_115668631	3300011119	Miscanthus Rhizosphere	MKNGEMDLFAQLLLESRTGAYLEWLVNELIMTANKKHT*
Ga0157374_112979441	3300013296	Miscanthus Rhizosphere	MKGDEIELFAQLLLDSKTGAYIEWLDNELIMTANKKHT*
Ga0157374_119583721	3300013296	Miscanthus Rhizosphere	MKDGKMVLIAQPLLESRTGAYLKWLANEVIMTAN*
Ga0157374_122269851	3300013296	Miscanthus Rhizosphere	MKDGEMNIFVQPLLESRTCAYKEWLENEQIIIANSKHT*
Ga0157378_110543211	3300013297	Miscanthus Rhizosphere	MKGDEIELFAQPLLESRTDAYIEWLDNELIMTANNN
Ga0157378_118851802	3300013297	Miscanthus Rhizosphere	MKDGEMDLIAQLLLESRTGAYIEWLANELIMTANKTHT*
Ga0157378_128499012	3300013297	Miscanthus Rhizosphere	MKDGKIVLIAQPLLESRAGAYLEWLANEVIMIAN*
Ga0157376_110584211	3300014969	Miscanthus Rhizosphere	MKYGKLVLIAQPLLESRTGAYLEWLANEEIMTAN*
Ga0157376_117723141	3300014969	Miscanthus Rhizosphere	MKDGEMDLFAQLLLESRTGAYLEWLNNELIMTANKKHT*
Ga0157376_127357171	3300014969	Miscanthus Rhizosphere	MKEGEMILIAQPLLESRTVAYLEWLANEVIMTANK
Ga0182122_10402411	3300015267	Miscanthus Phyllosphere	MKDGEMILIAQSLLESRTGAYLEWLVNKVIMTAK*
Ga0182122_10481961	3300015267	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRTGAYLEWLANELIMTANKNHT*
Ga0182122_10568681	3300015267	Miscanthus Phyllosphere	MKDDKMVLFAQPLLEGRTGAYLERLANKVIMTASKT*
Ga0182122_10627672	3300015267	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRTGAYKEWLDNELIMTANKKHT*
Ga0182122_10703161	3300015267	Miscanthus Phyllosphere	MKDDEMDLIAQLLLESRTGAYIEWLDNELIMTANKKHT*
Ga0182154_10225861	3300015268	Miscanthus Phyllosphere	MKGGEMDMIAQLLLESRTGAYIEWLANELIMTANKTHT*
Ga0182154_10409482	3300015268	Miscanthus Phyllosphere	MKGDKMVMFAQPLLEGRTGAYLEWLANKVIMTANKT*
Ga0182154_10625681	3300015268	Miscanthus Phyllosphere	KMKDGEMDLIAQLLLESRAGAYIEWLDNELIMTANKKHT*
Ga0182113_10307491	3300015269	Miscanthus Phyllosphere	MKDGKLVLIAQPLLESRTGAYLEWLANEEIMTAN*
Ga0182113_10342631	3300015269	Miscanthus Phyllosphere	MKDGKMILIAQPLLESKTGAYLEWLANKVIMTANKT*
Ga0182113_10579811	3300015269	Miscanthus Phyllosphere	MKGGEMELFAKLLLESRAGAYIEWLGNELIMTANNKHT*
Ga0182113_10829431	3300015269	Miscanthus Phyllosphere	MKDGKMVLMPQPLLESRIGAYLEWLANEVIMIAHKT*
Ga0182188_10214711	3300015274	Miscanthus Phyllosphere	MKDDKMVLIAQPLLEGSTGAYLEWLANEVIMTAN*
Ga0182188_10555632	3300015274	Miscanthus Phyllosphere	MKDDKIVLIAQPLLKSRIGAYLEWLANEVIMTAKKI*
Ga0182172_10001626	3300015275	Miscanthus Phyllosphere	MKGGEMELFAQLLLESRTGAYIEWLDKVIIMTAKNKHT*
Ga0182172_10390801	3300015275	Miscanthus Phyllosphere	MKGGEIDLIAQLLLESRTGAYIEWLANELIMTANKMKIRLHF*
Ga0182172_10501941	3300015275	Miscanthus Phyllosphere	MKDGEIDLIAQLLLESRTSAYIEWLANELIMTSNKTHT*
Ga0182172_10559711	3300015275	Miscanthus Phyllosphere	MKGDEMELIAQPLLESRSGAYIEWLANELIITANKMHT*
Ga0182172_10693021	3300015275	Miscanthus Phyllosphere	MKNGEIVLIAQPLLESRTCAYLEWLANEVIMTANKT*
Ga0182170_10136911	3300015276	Miscanthus Phyllosphere	DGEMDLFAQLLLESRTCAYLEWLDNELIMTANKKQT*
Ga0182170_10148551	3300015276	Miscanthus Phyllosphere	MKDGEIDLLAQLLLESRIGAYIEWLANELMMTANKHIHKDYY*
Ga0182170_10189571	3300015276	Miscanthus Phyllosphere	MKDGEMVLIAQPLLKSRTNSYLEWLANEVIMTANKT*
Ga0182170_10300571	3300015276	Miscanthus Phyllosphere	MKNGEMVLIAQPLLKSRTGAYLEWLVNEVIMTAN*
Ga0182170_10318891	3300015276	Miscanthus Phyllosphere	MKDSEIVLIAQPLLESKTVAYLECLANEVIMTANKT*
Ga0182170_10592311	3300015276	Miscanthus Phyllosphere	MKDGEIDLFAQLLLESRTGAYIEWLDNKLIMTANKKH
Ga0182170_10722182	3300015276	Miscanthus Phyllosphere	MKEDEMIRIAQPLLTNKIGAYLAWSANEVIMTANKIGL*
Ga0182128_10193931	3300015277	Miscanthus Phyllosphere	MKDGKMVLIAQPLLEGRIGAYLEWLANKVIMTANKT*
Ga0182128_10234471	3300015277	Miscanthus Phyllosphere	MKDRKIVSIAQPLLESRTGAYLEWLANEVIMTANKT*
Ga0182128_10275922	3300015277	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTGAYLEWLVNEVIMTANKH*
Ga0182128_10665401	3300015277	Miscanthus Phyllosphere	MKGGKMLLIAQLLLEGRTGAYLEWLTNKVIMTANKT*
Ga0182174_10216851	3300015279	Miscanthus Phyllosphere	MKGGEMELFAKLLLESRAGAYIEWLDNELIMTANNKHT*
Ga0182174_10372861	3300015279	Miscanthus Phyllosphere	MKDGEIVLIAQPLLESRTGAYLEWLANEEIMTVNKT*
Ga0182174_10464921	3300015279	Miscanthus Phyllosphere	MKDGEMILIVSPLLESRTGAYLEWLANEVIMTANKT*
Ga0182174_10499551	3300015279	Miscanthus Phyllosphere	MKDGKMFLIAQPLLEGSTGAYLEWLANEVIMTAN*
Ga0182174_10715771	3300015279	Miscanthus Phyllosphere	MKDSKIVLIAYHLLESSIGAYIEWLVNELMMTANKI
Ga0182160_10300661	3300015281	Miscanthus Phyllosphere	MKDDKMVLIAQPLLESRTGAYLEWLANEVIMTAS*
Ga0182160_10442011	3300015281	Miscanthus Phyllosphere	MKGGEIDLIAQLLLESRTSAYIEWLANELIMTANKTHT*
Ga0182160_10848661	3300015281	Miscanthus Phyllosphere	MKNGEMVLIAQPLLESRTCAYLEWLANEVIMTANKT*
Ga0182124_10111291	3300015282	Miscanthus Phyllosphere	MKDGEVVLIAQPLLESRAGAYLKWLANEVIVTANKT*
Ga0182124_10222662	3300015282	Miscanthus Phyllosphere	MKNGKMVLIAQPMLESRTGAYLEWLANEVIMTAN*
Ga0182124_10274771	3300015282	Miscanthus Phyllosphere	MKGGEMDMIAQLLLESRTGAYIEWLDNKRIMTAN*
Ga0182124_10325271	3300015282	Miscanthus Phyllosphere	KDGKMDLIAPLLLESRTGAYIEWLANELIRTANKEHT*
Ga0182124_10594391	3300015282	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRAGVYLEWLDNELLMPANKKHT*
Ga0182124_10725021	3300015282	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRTGACLEWLDNELIMTANKKHT*
Ga0182156_10364042	3300015283	Miscanthus Phyllosphere	MKDGKMVLIAQLLLESRTNAYLEWLATEVIMTANKT*
Ga0182156_10375331	3300015283	Miscanthus Phyllosphere	MKDGKMVLFAQSLLEGRTGAYLERLANKVIMTASKT*
Ga0182156_10450891	3300015283	Miscanthus Phyllosphere	MKDGKMVLIAQLLLEGRTGAYLEWLANKVIMTANKT*
Ga0182156_10566301	3300015283	Miscanthus Phyllosphere	MKDGEIDLFAQLLLESRTGAYLEWLDNELIMTANKKHA*
Ga0182156_10568891	3300015283	Miscanthus Phyllosphere	MKDGELDMIAQLLLESRTGAYIEWLDNELIMTVNKKHT*
Ga0182156_10635541	3300015283	Miscanthus Phyllosphere	MKDGKIVLIAQPLLESRIGAYLEWLANEVIMTANKT*
Ga0182156_10877131	3300015283	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTSAYLEWLANEVIMTAN*
Ga0182186_10408852	3300015285	Miscanthus Phyllosphere	MKDSEMDLIAQLLLESRTGAYIEWLANELIMTANKTHT*
Ga0182186_10496241	3300015285	Miscanthus Phyllosphere	MKDGEKDLFAQLLLESRIGAYLEWLDNELIMTANKKHA*
Ga0182186_10609331	3300015285	Miscanthus Phyllosphere	MKDGKLVLIAQPLLESRTGAYLEGLANEVIMTASKTQS*
Ga0182186_10706801	3300015285	Miscanthus Phyllosphere	MNGDEMELFAQLLLKSRTCAYIEWLDNELIMTANNK
Ga0182186_10714171	3300015285	Miscanthus Phyllosphere	MKDDEIDLIAQLLLKSRTDAYLEWLANELIMTANKIHT*
Ga0182186_10762461	3300015285	Miscanthus Phyllosphere	MKEDEMIWIAQPLLTNRTGAYVEWSAIEVIMTANKT*
Ga0182176_10485981	3300015286	Miscanthus Phyllosphere	MEGEEIELIAQLLLESRTCAYLEWLDNELIMTANNNINR
Ga0182176_10584731	3300015286	Miscanthus Phyllosphere	KNWNMKDGKLVLIAQPLLKSRTGAYLEWLANKVIMTAN*
Ga0182176_10858591	3300015286	Miscanthus Phyllosphere	MKGGKMILFAQPLLGGRIGAYLEWLANKVIMTANKTWP*
Ga0182171_10611821	3300015287	Miscanthus Phyllosphere	MKDGKLVLIAQPLLESRIDAYLEWLASEVIMTANKT*
Ga0182173_10360412	3300015288	Miscanthus Phyllosphere	MKDGKMVLIAQPLLESRTGAYLEWLANKVIMTAN*
Ga0182173_10527882	3300015288	Miscanthus Phyllosphere	MKGDQMELIAQLLLESRIGAYLEWLAKELIMTANKIHT*
Ga0182173_10570612	3300015288	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTSAYLEWLANEVIMTANKT*
Ga0182173_10632152	3300015288	Miscanthus Phyllosphere	MKCGEIDLIAQLLLESITGAYIEWLDNELIMNAYN*
Ga0182173_10861971	3300015288	Miscanthus Phyllosphere	MKGDEMELLVQLLLEGRIGAYIELLNNKLILTANNKH
Ga0182138_10203521	3300015289	Miscanthus Phyllosphere	MKGGKMVLIAQLLLEGRIGAYLEWLSNKVIMTANKT*
Ga0182138_10540701	3300015289	Miscanthus Phyllosphere	MKDGKLVLIAQPLLESRTGVYLEWLANEVIMTANKT*
Ga0182125_10406721	3300015291	Miscanthus Phyllosphere	MKDGKLVLIAQPLLESRTGAYLEWLANEVIMTAN*
Ga0182125_10645891	3300015291	Miscanthus Phyllosphere	MKGGEMELFAQLLLEIRTGAYIEWLDNELIMTANNKHT*
Ga0182125_10918902	3300015291	Miscanthus Phyllosphere	KDGEMDLIAQLLHESRILAYIEWLANELIITANKIHT*
Ga0182125_10947662	3300015291	Miscanthus Phyllosphere	MKDGKMVLIAQPLLESRTCAYLEWLANEVIMTAKKT*
Ga0182141_10382781	3300015292	Miscanthus Phyllosphere	MEDDEMKLIAQPLLESRTYAYLDWLANEVIMTANKT*
Ga0182141_10447861	3300015292	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTSVYLEWLANKVIMTAN*
Ga0182141_10562602	3300015292	Miscanthus Phyllosphere	MKDGKMVLIAEPLLESRTSAYIEWLDNKLIMTANNKHT*
Ga0182141_10631532	3300015292	Miscanthus Phyllosphere	MKDGKMILIAQPLLESKTGAYLEWLANKVIMTANKTWP*
Ga0182141_10657961	3300015292	Miscanthus Phyllosphere	MKDGEIDLIAQLLLESRTSAYKEWLDNELIMTANKKHT*
Ga0182141_10933021	3300015292	Miscanthus Phyllosphere	MKDGEIDLIAQLLTKSRTDAYIE*LANELIRTANKKH
Ga0182141_10938941	3300015292	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRTGAYLEWLDNELIMTANKKHT*
Ga0182126_10181521	3300015294	Miscanthus Phyllosphere	MKDGKMVLIAQLLLESGISTYLEWLANELIMTANKT*
Ga0182126_10323461	3300015294	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRIGAYIEWLDNELIMTANKKHT*
Ga0182175_10212661	3300015295	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRTFAYIEWLANELIMAANKMPT*
Ga0182175_10359221	3300015295	Miscanthus Phyllosphere	MDGDEIELIAQLLLESRIGAYIEWLDNKLIMAANNN
Ga0182175_10559781	3300015295	Miscanthus Phyllosphere	MKYGKMVLMAYHLLESNTGAYIEWLVNELIMTVNEIEHKDA
Ga0182175_10579451	3300015295	Miscanthus Phyllosphere	MKDDKMVLIAQPLLESRTYAYLEWLANEVIMTANKT*
Ga0182157_10110701	3300015296	Miscanthus Phyllosphere	MKDEKLVLIAQPLLKNRIGAYLEWLANEVIMNAN*
Ga0182157_10455272	3300015296	Miscanthus Phyllosphere	MKDDKLVLIAQPLLESRTGAYLEWLANEVIMTTNKT*
Ga0182157_10959651	3300015296	Miscanthus Phyllosphere	MKDGKMVLFAQPLLEGRAGAYLERLTNKVIMTASKT*
Ga0182106_10233701	3300015298	Miscanthus Phyllosphere	MKGDEIELIAQLLLESKTGAYIEWLDNQLIMAINNYINKD
Ga0182106_10286771	3300015298	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRIGAYIEWLANELIMNANKTHT*
Ga0182106_10450321	3300015298	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTGAYLEWLVNEVIMTANKT*
Ga0182106_10470501	3300015298	Miscanthus Phyllosphere	MKYDKMVLIAQPLLEGRTCAYLEWLANEVIMTANKI*
Ga0182106_10500121	3300015298	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESGTGAYIEWLANELIRTTNKKHT*
Ga0182106_10835871	3300015298	Miscanthus Phyllosphere	HRSTKWKMKDGKMVLIAEPLLESRTSAYLEWLVNEVIMTAN*
Ga0182106_10921891	3300015298	Miscanthus Phyllosphere	MKGGKMVLIAQLLLEARTGAYLEWLANKVIMTTNKT*
Ga0182106_10988261	3300015298	Miscanthus Phyllosphere	MKDGEMILIAQPLLESRTGAYLEWLANEVIMTANKT*
Ga0182106_11018941	3300015298	Miscanthus Phyllosphere	MKDGKIVLIAYHLLESSTGAYIEWLVNELMMTANKI
Ga0182107_10393621	3300015299	Miscanthus Phyllosphere	MDLIAQLLLESRTGAYIEWLANELIMIANKTYIRIHY*
Ga0182107_10413461	3300015299	Miscanthus Phyllosphere	SKNRKIKDGGIVLIAQPLLESRISAYLEWLANEVIMTANKT*
Ga0182107_10611791	3300015299	Miscanthus Phyllosphere	MKGGEMDLIAQLLLESRTGAYIEWLANELIMTANKTHA*
Ga0182107_10693122	3300015299	Miscanthus Phyllosphere	MKGGKLVLIAQPLLESRTGGHLEWLANEVIMTANKT*
Ga0182108_10735371	3300015300	Miscanthus Phyllosphere	MKYGKLVLIAQPLLESRTCAYLEWLANKVIMTANKI*
Ga0182108_10897291	3300015300	Miscanthus Phyllosphere	MKGDEMELFAQLLLESRTGAYIEWLDKVIIMIAKNKHT*
Ga0182108_10973572	3300015300	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRIGAYIEWLANKLIMTANKKHT*
Ga0182143_10699151	3300015302	Miscanthus Phyllosphere	MKDGEIVLIAQPLLESRTGDYLEWLANEVIMTVNKT*
Ga0182143_10814661	3300015302	Miscanthus Phyllosphere	MKDDEMVLIAQPLHENRACAYLEWLANEVIMTAN*
Ga0182143_10986662	3300015302	Miscanthus Phyllosphere	MKDGEMDLFAQPLLESRTGAYLEWLANELIMTANKLQT*
Ga0182123_10379332	3300015303	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRIGAYLEWLGNEVIMTAN*
Ga0182123_10441111	3300015303	Miscanthus Phyllosphere	MEGDEIELIVQLLLESRTGAYLEWLDNELIMNANKKHT*
Ga0182123_10486971	3300015303	Miscanthus Phyllosphere	MKGGEMELFAQLLLESRIGAYIEWLASELIMTANKTHT*
Ga0182112_10488912	3300015304	Miscanthus Phyllosphere	MKDDEMDLFAQLLLESRTGAYLEWLDNELIMTTNKKHT*
Ga0182112_10831362	3300015304	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTSAYLEWLANEVIMNANKT*
Ga0182112_10908901	3300015304	Miscanthus Phyllosphere	MKDGEMDLFAQLLLECRTCAYLEWLANEVIMAANKT*
Ga0182112_10988211	3300015304	Miscanthus Phyllosphere	MKDGKLVLIAQPLLESRTGAYLEWLANEEIMIAN*
Ga0182112_10996581	3300015304	Miscanthus Phyllosphere	RSKNWKMKDGEIDLFAQLLLENRTDAYIEWLDNELIMTANKKHT*
Ga0182158_10312741	3300015305	Miscanthus Phyllosphere	MKGDEIELIAQLLLESRTGVYLEWLANEVIMTANKI*
Ga0182158_10354651	3300015305	Miscanthus Phyllosphere	MEGDEMELIAQLLLESRTGAYIEWLGNELIMNANN*
Ga0182158_10630172	3300015305	Miscanthus Phyllosphere	MKDGKMVLMAQPLLESRTGAYLEWLVSEVIMTTNKT*
Ga0182158_10835461	3300015305	Miscanthus Phyllosphere	MKDDKLVLIAQPLLESRTGAYLVWLANEEIMTAN*
Ga0182158_10897651	3300015305	Miscanthus Phyllosphere	MKDDKIVLMAESLLESRTDAYLKWLANDVIMTANKI*
Ga0182158_10914111	3300015305	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTGAYLEWLANEVIMTGNKT*
Ga0182158_10969662	3300015305	Miscanthus Phyllosphere	MKDGKIVLIAQPLLEGRTGAYLEWLTNKVIMTANK
Ga0182158_10971911	3300015305	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRIGAYLEWLANEVIMTANKT*
Ga0182158_11020752	3300015305	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESKTCAYLEWLANEVIMTANKT*
Ga0182144_10109151	3300015307	Miscanthus Phyllosphere	KDGKLVLIAQHLLEGRTSAYLEWLANKVIMTANKT*
Ga0182144_10143701	3300015307	Miscanthus Phyllosphere	MKGGEMELFAQLLLQSRTGAYIEWLDKVIIMTAKNKHT*
Ga0182144_10565161	3300015307	Miscanthus Phyllosphere	MKDGEMILIAQPLLETRTSAYLEWLANEVIMTAKKT*
Ga0182144_10733811	3300015307	Miscanthus Phyllosphere	MKEGEMDLFAQLLLESRIGAYLEWLDNELIMTTNKEHT*
Ga0182144_10740582	3300015307	Miscanthus Phyllosphere	MKDDEMDLIAQLLLENRTCAYIEWLANKLIMIANKTHA*
Ga0182144_11062381	3300015307	Miscanthus Phyllosphere	KDGKMVLIAQPLLKSRTCAYLKWLANKVIMTANKT*
Ga0182142_10636442	3300015308	Miscanthus Phyllosphere	YSLARSKNWKIKDGEIDLFAQLLHESRTCAYIEWLDNELNMTANNKLT*
Ga0182142_10643751	3300015308	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTDAYLEWLANEVIMTVNKT*
Ga0182142_10815811	3300015308	Miscanthus Phyllosphere	MKDAEMGLVAQLLLESKIGPYIEWLASEQFMTANKTHT*
Ga0182142_11022011	3300015308	Miscanthus Phyllosphere	MIDGEMDLIAQLLLESRTGAYIERLANELIMTANKTHA*
Ga0182164_11296101	3300015313	Switchgrass Phyllosphere	MKGGKMVLIAKPLLEGRTGAYLEWLDNKVIMTANKT*
Ga0182140_10143031	3300015314	Miscanthus Phyllosphere	MKGGKMVLIAQLLLEGRIGAYIEWLANKVIMTANKT*
Ga0182140_10225302	3300015314	Miscanthus Phyllosphere	MKDGEIDLIAQLLLESRIGAYIEWLANELIMNANKI*
Ga0182140_10414821	3300015314	Miscanthus Phyllosphere	MKDDEIDLIAQLLLESKIGAYIEWLANELIMAANKIHT*
Ga0182140_10661041	3300015314	Miscanthus Phyllosphere	MKDGEMNLIAQLLLESRTGAYIEWLANELTMTANKTHT*
Ga0182140_10757182	3300015314	Miscanthus Phyllosphere	MKDDKLVLIAQPLLESRTGAYLEWLANELIMTAN*
Ga0182127_10955251	3300015321	Miscanthus Phyllosphere	EIDLIAQLLLEIRTCAYIEWLANKLIMTTNKTYT*
Ga0182127_10963301	3300015321	Miscanthus Phyllosphere	MKDGETDLIAQLLLENRTGAYIEWLDNELIRTANK
Ga0182127_11027711	3300015321	Miscanthus Phyllosphere	MKYGKMVLIAQPLLESRTGAYQEWLSSEVIMIANKT*
Ga0182127_11075222	3300015321	Miscanthus Phyllosphere	MKDGEMVLIAQPFLESRTGAYLEWLANEVIMTANKT*
Ga0182127_11196151	3300015321	Miscanthus Phyllosphere	MKDGKLVLIAQPLLESRTGAYLEWLANEVIMTAI*
Ga0182110_10907631	3300015322	Miscanthus Phyllosphere	MKDGEIVLIAQPLLESRIGAYQEWLSSEVIMIANKT*
Ga0182110_10926051	3300015322	Miscanthus Phyllosphere	MKGGEMDLFAQLFLESRTDAYQEWLDNELIMTANKKYT*
Ga0182110_11024951	3300015322	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRIGAYIEWLDNELIMTANKKHT*
Ga0182110_11260141	3300015322	Miscanthus Phyllosphere	MKDGKLVLIAQTLLESRTGAYLEWLANEVIMTANKT*
Ga0182129_10255361	3300015323	Miscanthus Phyllosphere	MKDDEMVLIAQPLLEIRTCAYLE*LVNKLIMTALL
Ga0182129_10289342	3300015323	Miscanthus Phyllosphere	MKDGEMDLFAQILFESRTGAYLEWLDNKLIMTANKKHT*
Ga0182129_10476571	3300015323	Miscanthus Phyllosphere	MKVGVMVLIAQPLLESRIGAYLEWLANEVIMIANKT*
Ga0182129_10683991	3300015323	Miscanthus Phyllosphere	MKGGKMVLIAQLFLEGRTGAYLEWLANKVIMTANKT*
Ga0182129_10843631	3300015323	Miscanthus Phyllosphere	MKDGEIDLIAQLLLGSRTCAYIEWLSNELIMTANKK
Ga0182129_11175721	3300015323	Miscanthus Phyllosphere	MKGGETELFVQLLIESRIDVYIEWLDNELIMTANKKHT*
Ga0182187_10420071	3300015341	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRIDAYLEWLANEVIMTANKT*
Ga0182187_10943591	3300015341	Miscanthus Phyllosphere	MTDGDMVLIAQTLLESRTGACLEWLANEVIMTAN*
Ga0182187_11543962	3300015341	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRIGAYMEWLDNELIMTANKKHT*
Ga0182187_11661141	3300015341	Miscanthus Phyllosphere	MKDSEMVLIAQPLLKSRTCAYLEWLANEVIMTANKT
Ga0182187_11758411	3300015341	Miscanthus Phyllosphere	MKDGEMDLFTQLLLESKTCAYLEYLDNELIMTANKKHT*
Ga0182187_11885551	3300015341	Miscanthus Phyllosphere	MKDGEMVLIAQPLLGSRTGAYLEWLANEVIMTVNKT*
Ga0182109_10757361	3300015342	Miscanthus Phyllosphere	MKGGKLVLIAQPFLESRTGAYLEWLAKEVIMTAK*
Ga0182109_10792852	3300015342	Miscanthus Phyllosphere	MKGGKMELFAQLLLEGRTGAYLEWLADELIMTANKIHT*
Ga0182109_11263211	3300015342	Miscanthus Phyllosphere	MKGGEMELFAQFLLESRTGAYIEWLDNELIMTANKT*
Ga0182109_11331022	3300015342	Miscanthus Phyllosphere	MKGGEIILIAQPLLESRTGAYLEWLANEVIRTANKT*
Ga0182109_12074361	3300015342	Miscanthus Phyllosphere	KDGEMVLIAQPLLESRTDAYLEWLANEVIINANKT*
Ga0182155_11505501	3300015343	Miscanthus Phyllosphere	MNDGEIVLIAQPLLESRTDAYLEWLANEVIMIANKT
Ga0182155_11643221	3300015343	Miscanthus Phyllosphere	KDGEMDLIAQPLLESRTTAYIEWLDNELIMMANKTPT*
Ga0182189_11237731	3300015344	Miscanthus Phyllosphere	MKDGKMVLIAQPLLESRTGAYQEWLSSEVIMIANKT*
Ga0182189_11252921	3300015344	Miscanthus Phyllosphere	MKDGEMVMIAQPLLESRTGAYLEWLVNEVIMTANKT*
Ga0182189_11356711	3300015344	Miscanthus Phyllosphere	MKDGEMDLIAQLLLETRTGAYIEWLDNELIMTANKKPT*
Ga0182189_11551251	3300015344	Miscanthus Phyllosphere	HRSKNWKMKRGEMDLFAQLLLENRTGAYLEWLDNGLIMTANKEYT*
Ga0182189_11685582	3300015344	Miscanthus Phyllosphere	MKDGKRVLIAQPLVESRTGAYLEWLANEAIMTVN*
Ga0182189_11722042	3300015344	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTSAYLEWLANEVIMTANK
Ga0182189_11839871	3300015344	Miscanthus Phyllosphere	MDLFAQLLLESRTCAYIEWLDNELIMTVNKKHTKGFTTSIAFLKKKPYNP*
Ga0182189_12163421	3300015344	Miscanthus Phyllosphere	MKDGKLVLIAQPLIGSRTGAYLEWLANEVIMTAN*
Ga0182189_12221031	3300015344	Miscanthus Phyllosphere	MKDGKMVLMAQPLLESKIGAYLEWLANDVIMTANKT*
Ga0182189_12298272	3300015344	Miscanthus Phyllosphere	MKDGEKDLIAQLLLESRIGAYIKWLANELIMTANKIHT*
Ga0182111_10822942	3300015345	Miscanthus Phyllosphere	DEREMDLIAQLLLESRTGAYIEWLAKELIMTTNKVHT
Ga0182111_10901721	3300015345	Miscanthus Phyllosphere	MKDDEIDLIVQLSLESRTSAYIEWLANERIMTANKT
Ga0182111_10921541	3300015345	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRTSAYIEWLANDLIMTANKTHT*
Ga0182111_10958571	3300015345	Miscanthus Phyllosphere	MKGDKIEHVAQLLLESRTCAYIEWLDNKLIMAANN
Ga0182111_11026261	3300015345	Miscanthus Phyllosphere	MKGGEMEMFAQLLLESRTGAYIEWLDNKLTMTANNKHA*
Ga0182111_11240981	3300015345	Miscanthus Phyllosphere	GEMELFAQLLLESRTCAYIEWLDNELIMTTNNKHT*
Ga0182111_11462661	3300015345	Miscanthus Phyllosphere	MKDGKIVLIAQPLLESRTGAYLEWLANEVIMTAN*
Ga0182111_11526451	3300015345	Miscanthus Phyllosphere	MKDDEMVLIAQPLLESRTDAYLEWLANEVIMTANKT*
Ga0182111_11813922	3300015345	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTGAYLGWLANEVIITANKT*
Ga0182111_11854061	3300015345	Miscanthus Phyllosphere	MKDDKMVLIAQPLLESGTGAYLEWLANEIIMTANKA*
Ga0182111_12142161	3300015345	Miscanthus Phyllosphere	KIKYGEMDLVAQLLLESRTCAYIEWLANELIMTANKTHT*
Ga0182111_12182661	3300015345	Miscanthus Phyllosphere	MKCDEMELIAQLLLESRTGAYIKWLDKELIMMANNNINKAS
Ga0182111_12356831	3300015345	Miscanthus Phyllosphere	MKDDKLILIAQPLLENRTSAYLEWLAKEVIMTAN*
Ga0182111_12417692	3300015345	Miscanthus Phyllosphere	MEDGKLVLIAQPLLESKTCAYLEGLANEVIMTAN*
Ga0182111_12448811	3300015345	Miscanthus Phyllosphere	HHSKNKRKGDEMELFAQPLLESRTGAYIEWLDNELIMTANNKHT
Ga0182111_12464151	3300015345	Miscanthus Phyllosphere	MKEGEMILIAQPLLESRTVAYLEWLANEVIMTANKT*
Ga0182139_10382851	3300015346	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRTGAYIEWLDNELIMTGNKKHT*
Ga0182139_11079201	3300015346	Miscanthus Phyllosphere	MKDGEMDLIAQPLLESRTCAYLEWLANEIIMTANKT*
Ga0182139_11656951	3300015346	Miscanthus Phyllosphere	MKDGEMDLIAQLLIESRTGAYIEWLANELIMPANKTHT*
Ga0182139_11709331	3300015346	Miscanthus Phyllosphere	MKDGKMVLFAQSLLEGRTGAYLERLANKVIMTANKT*
Ga0182139_11876471	3300015346	Miscanthus Phyllosphere	MKDDEMDLIAQLLLKSKIGAYIEWLVNELIMTANKTHI*
Ga0182139_11901142	3300015346	Miscanthus Phyllosphere	NWKFKDGEIDLFAQLLLESKTGAYLEWLDNELIMTANKKHT*
Ga0182139_12439571	3300015346	Miscanthus Phyllosphere	SDLAMVDHRSKNWKMKDGEVVLIAQPLLESRTGAYLEWLINEVIMTAN*
Ga0182177_10368441	3300015347	Miscanthus Phyllosphere	MKDGELDLIAQLLLESRTCAYIEWLDNEVIMIANKKHT*
Ga0182177_10683032	3300015347	Miscanthus Phyllosphere	MKDGEMDLIAQLLLETRIGAYIEWLANELIMTANKKHT*
Ga0182177_10687361	3300015347	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTGAYLKWLANEVIMTDNKK*
Ga0182177_11221541	3300015347	Miscanthus Phyllosphere	MKDGKMVLIAQPLLESRTYDYLEWLANEVIMTANKT*
Ga0182177_11427201	3300015347	Miscanthus Phyllosphere	MKGDEIELFAQLLLESRICAYIEWLDNELIMTANNNINKD
Ga0182177_11681841	3300015347	Miscanthus Phyllosphere	NIKYGKIVLFAQPLLEGRTGDYLERLANEVIMTASKTP*
Ga0182177_11775101	3300015347	Miscanthus Phyllosphere	MKGGVTDLFAQLLLESRTGAYLEWLDNELIMTANKKYT*
Ga0182177_12449991	3300015347	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRIGAYLEWLDNELIMMANKKHT*
Ga0182161_10649362	3300015351	Miscanthus Phyllosphere	MKDGEIDLIAQLLLESRTCAYIEWLDNELIMTAKKKHT*
Ga0182161_10760331	3300015351	Miscanthus Phyllosphere	MKDGEMDLIVQLLIESRTGAYIEWLANELIMTANKTPT*
Ga0182161_11038261	3300015351	Miscanthus Phyllosphere	MKDGKMVLIAQPLLESRTGAYLEWLANDVIMTANKT*
Ga0182161_11378051	3300015351	Miscanthus Phyllosphere	MKDGKTVLIAQPLLKSRTGAYLEWLANEVIMTTNKT*
Ga0182161_11514301	3300015351	Miscanthus Phyllosphere	GEMVMIAQPLLESRIGAYLEWLANEVIMIANKTWL*
Ga0182161_12322801	3300015351	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESKTGAYLEWLANEVIMTTNK
Ga0182159_10548432	3300015355	Miscanthus Phyllosphere	MGDGKLVLIAQPLLENSIGAYIEWLVNELMMTANKS*
Ga0182159_11407091	3300015355	Miscanthus Phyllosphere	MKDGEMVLIAQPLLETRIGAYLEWLANEVIMTANKI*
Ga0182159_11800731	3300015355	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRTGAYIEWLANELIMTANKKYT*
Ga0182159_12048872	3300015355	Miscanthus Phyllosphere	DEMKLIAQLLLESRTCAYIESIANELIMTANKTHT*
Ga0182159_12098381	3300015355	Miscanthus Phyllosphere	MKGGEMDLIAQLLLESRTYAYIEWLANELIMTANKTHT*
Ga0182159_12186732	3300015355	Miscanthus Phyllosphere	MKDDKIVLIVQPLLESRTCAYLEWLANEVIMTANKT
Ga0182159_12301711	3300015355	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESKTCAYLEWLANEVIMTADKT*
Ga0182159_12437351	3300015355	Miscanthus Phyllosphere	MKDGKMILISYHQLESTTGAYIEWLVNELMLTANKIE
Ga0182159_12641711	3300015355	Miscanthus Phyllosphere	MKDSEIVLIAEPLLESRICAYLKWLANEVIKTANKT*
Ga0182159_12738912	3300015355	Miscanthus Phyllosphere	MKDGKIVLIAQPLLEGRTGAYLEWLTNKVIMIANKT*
Ga0182159_13084421	3300015355	Miscanthus Phyllosphere	MKDGKMDLFDQLLLKSRIGAYLEWLDNELIMTVNKKHT*
Ga0182159_13087671	3300015355	Miscanthus Phyllosphere	VKDGKMVLIAQHLLEGRTGAYLEWLSNEVIMTANKT*
Ga0182145_10452971	3300015361	Miscanthus Phyllosphere	MKDGKIVLIAQPLLESRTGAYLKWLANEVIMTANKT*
Ga0182145_10479532	3300015361	Miscanthus Phyllosphere	KNWKIKDGEMDLFAQLLLESRIGAYIEWLDNELIMTANKKHT*
Ga0182203_10780741	3300017404	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRTCAYIEWLANELIMTANKTHT
Ga0182203_11091311	3300017404	Miscanthus Phyllosphere	MKDSKLVLIAQPLLESRTGAYLEWFANEVIMTANKTHT
Ga0182203_11346061	3300017404	Miscanthus Phyllosphere	MKDGKIDLIAQLLLESRTGPYIEWLANKLIMIANKTPT
Ga0182203_11405711	3300017404	Miscanthus Phyllosphere	MKEGEIDLIAQLLLESRTCAYIEWLDNELIMAANNK
Ga0182203_11613211	3300017404	Miscanthus Phyllosphere	MKGGEMELFAQFLLESRTGAYIEWLDNELIMTANNKHT
Ga0182203_11628031	3300017404	Miscanthus Phyllosphere	MKDDKMVLIAQPLLESRTSAYLEWLANEVIMTANKT
Ga0182220_10364071	3300017407	Miscanthus Phyllosphere	MKDGEMDMFAQLLLESRIGAYLEWLDNELIMTANNKHV
Ga0182220_11039661	3300017407	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRTCAYIEWLDNKLIITANKKHTQGSTTSNA
Ga0182204_10345731	3300017409	Miscanthus Phyllosphere	MKDDEMDLFAQLLLESRTGAYLEWLDNELITTANKKHT
Ga0182204_10711611	3300017409	Miscanthus Phyllosphere	MKDGEMILIAQPLLEGRTGAYLEWLANKVIMTANKT
Ga0182204_10951531	3300017409	Miscanthus Phyllosphere	MIDSKMDQFPQLLIETRTGAYLEWLDNELIMTDNKKYT
Ga0182204_11024062	3300017409	Miscanthus Phyllosphere	MKDGEMDLIAQLLIESGRGAYIEWLANELIMTANKIHT
Ga0182207_10636921	3300017410	Miscanthus Phyllosphere	MKDSEMDLIAQLLLESRTCAYIEWLDNEVIMIANKKHT
Ga0182207_11187741	3300017410	Miscanthus Phyllosphere	MKGGKMILFAQPLLGGRIGAYLEWLANKVIMTANKTWP
Ga0182207_11409871	3300017410	Miscanthus Phyllosphere	GGEMELFAQLLLESRIGPYIEWLGNELIMTANIKHS
Ga0182207_11431801	3300017410	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRTGAYIEWLDNELIMIANKTHT
Ga0182208_10712201	3300017411	Miscanthus Phyllosphere	MKDGKLVLIAQPLLESRIGAYLEWLANEVIMTANET
Ga0182208_10761851	3300017411	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRIGAYIEWLANELIMTANKTHT
Ga0182208_11236071	3300017411	Miscanthus Phyllosphere	MKDGEIDLFAQLLLESRTGAYIEWLDNELIMTANNKHT
Ga0182208_11250681	3300017411	Miscanthus Phyllosphere	MKGGEMELFAQLLLESRTGAYIEWLDNELIMNANN
Ga0182222_10524541	3300017413	Miscanthus Phyllosphere	MKGDEMELFAQLLLESITGAYIEWLDNELIMTANNKHI
Ga0182222_10969401	3300017413	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRIGAYLEWSANEVIMTANKTRL
Ga0182202_10664651	3300017415	Miscanthus Phyllosphere	MKGDEIELFAQLLLESRTDAYIEWLDNELIMTANNKHT
Ga0182202_11298662	3300017415	Miscanthus Phyllosphere	MKDGEMDMFAHLLLESRTCAYLEWLANEVIMTANKT
Ga0182202_11386381	3300017415	Miscanthus Phyllosphere	NXKMKGGEMELFAQLLLESRTCAYIEWLDKELIMTANNKHT
Ga0182202_11394411	3300017415	Miscanthus Phyllosphere	MKDGKIVLIAQPLLESRTGAYLEWLANEVIMTANKT
Ga0182230_10461861	3300017417	Miscanthus Phyllosphere	MKDGKLVQIAQPLLESRTSAYLEWLDNEVIMTANKT
Ga0182230_10479531	3300017417	Miscanthus Phyllosphere	MKGGEMKLFAQLLFESRTGAYIEWLDNVIIMTAKNKLT
Ga0182230_10686871	3300017417	Miscanthus Phyllosphere	MKDGEMILIAQPLLESRIGAYLEWLANEVIMTANKT
Ga0182219_10370321	3300017424	Miscanthus Phyllosphere	KNWNMKDGKLVLIAQPLLESGTGAYLEWLANEVIMTAN
Ga0182219_10533391	3300017424	Miscanthus Phyllosphere	MKDDEIDLIAQLLLESRIGAYIEWIANELIMTANKTPT
Ga0182219_10625231	3300017424	Miscanthus Phyllosphere	MKDNEMVLIAQPLLESRAGAYLKWLANEVIVTANKT
Ga0182219_11025841	3300017424	Miscanthus Phyllosphere	MKNGEMVPIAQSLPESGTGAYLGWLANEVIITVNKT
Ga0182219_11203861	3300017424	Miscanthus Phyllosphere	MKDGKMVLIAQPLLESRTHAYLEWLDNEVIMTANKT
Ga0182219_11376811	3300017424	Miscanthus Phyllosphere	MTEGEMILIAQLLLESRAVAYLEWLANEVIMVANKT
Ga0182224_10319461	3300017425	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRTGAYIEWLDYELIMIANKKHT
Ga0182224_10551901	3300017425	Miscanthus Phyllosphere	MKDGEIDLIAQLLLESRTCVYIELLDNELIRTANKK
Ga0182224_10806821	3300017425	Miscanthus Phyllosphere	KNWKMKDGEMDLIVQLLLESRTDTYIEWLANELIRTANKKHT
Ga0182224_10883631	3300017425	Miscanthus Phyllosphere	MKGDEMELFAQTLLENRTGAYIEWLDNKLIMAANKKHA
Ga0182224_10946491	3300017425	Miscanthus Phyllosphere	MKYGEMDLFAQLLLESGIGAYLEWLDNELIMTANKKHT
Ga0182224_11128351	3300017425	Miscanthus Phyllosphere	MKGGKMVLIAQLLLEGKTGAYLELLANKVIMTPNKT
Ga0182224_11442401	3300017425	Miscanthus Phyllosphere	MTDGKMVLIAQPLLEGRTGAYLEWLANEVIMTANKS
Ga0182224_11586591	3300017425	Miscanthus Phyllosphere	MEGDEIELIAQLLLESRTRVYIKWLDNELIMTANRKHT
Ga0182190_10751991	3300017427	Miscanthus Phyllosphere	MKNGEIVLIAQPLLESTTCAYLEWLANEVIMIANKT
Ga0182190_11371851	3300017427	Miscanthus Phyllosphere	KNWKMKDGKIVLITQPLLKSRTGAYLEWLANEVIMTANKT
Ga0182190_11566451	3300017427	Miscanthus Phyllosphere	MKDDKIELFAQLLLESRIGAYIEWLDKVIIMTVKNKHT
Ga0182190_11582172	3300017427	Miscanthus Phyllosphere	MKDVEMDLIAQLLLESRTCAYIEWLANELIMTANKIHT
Ga0182192_10491281	3300017430	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTCAYLEWLANEVIMTANKI
Ga0182192_10597651	3300017430	Miscanthus Phyllosphere	MKDGEMDLIAQLLLKSRTGAYIEWIANEQIMTANKT
Ga0182192_11032881	3300017430	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTGAYLEWLGNEVIMTANKT
Ga0182192_11387121	3300017430	Miscanthus Phyllosphere	MKDGKMVLIAQPLLEGRTGAYLEWLANKVIMTANKT
Ga0182192_11548351	3300017430	Miscanthus Phyllosphere	MKDDKTVLIAHSLLESRIGAYLEWLAIEVIIIANKT
Ga0182192_11600121	3300017430	Miscanthus Phyllosphere	XKMKNGEMVLIGQPLLESRTGAYLEWLANEVIMTAN
Ga0182192_11624771	3300017430	Miscanthus Phyllosphere	KMKDGEMVLIAQPLLESRTCAYLEWLANEVIMTANKT
Ga0182192_11625831	3300017430	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRAGAYIEWLDNELIMTANKKHT
Ga0182206_10522031	3300017433	Miscanthus Phyllosphere	MKDSEMDLIAQLLLESRTGAYIDWLANELIMTVNKIYT
Ga0182206_10941792	3300017433	Miscanthus Phyllosphere	MKDGKMVLMAQPLLESTTGAYLEWLANEVLMTANKT
Ga0182206_11102241	3300017433	Miscanthus Phyllosphere	MKGGEMELFDQLLLESRIGAYIEWLDNELIMTANKKDT
Ga0182206_11241771	3300017433	Miscanthus Phyllosphere	MKGGKLVLIAQPFLESRTGAYLEWLANEVIMTANKTWS
Ga0182206_11379021	3300017433	Miscanthus Phyllosphere	MKGGEMELFAQLLLESRTGAYIEWLDNKLIMNANNLHK
Ga0182206_11405961	3300017433	Miscanthus Phyllosphere	MKDDEMDLFAQLLLESRTSAYLEWLDNELIMIANKKHT
Ga0182206_11589701	3300017433	Miscanthus Phyllosphere	MKDGEIDLIAQFLLESRTGAYLEWLAKELIMTANKIHT
Ga0182206_11605201	3300017433	Miscanthus Phyllosphere	MKGDEMDLFAQLLLESXIGAYIEWLVNELIMTANKKYT
Ga0182209_10384091	3300017436	Miscanthus Phyllosphere	KDGEIDLFAQLLLESRTGAYIEWLANELIMTANKKYT
Ga0182209_10487811	3300017436	Miscanthus Phyllosphere	MKDGEMDLFAQLLLKSRIGAYIEWLANELIMTANKNIHKDSLL
Ga0182209_11321121	3300017436	Miscanthus Phyllosphere	MEGDERELIAQLLLESRTGAYIEWLDNKLIMATNNNINKTHY
Ga0182191_11635141	3300017438	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRIGAYIEWLANELIRTANKKHT
Ga0182191_11677611	3300017438	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRIGAYLEWLDNELIMTANKKHT
Ga0182221_10667682	3300017442	Miscanthus Phyllosphere	MKGGKMVLIAQLSLEGRTGAYLEWLANKVIMTANKT
Ga0182221_11212962	3300017442	Miscanthus Phyllosphere	MKDDEMELIAQLLLESRTYACIEWLDKELIMTANNNLNK
Ga0182221_11387442	3300017442	Miscanthus Phyllosphere	MKGGEIDLIVQLLLESKTGAYIEWLANELIMTANKTNT
Ga0182221_11621351	3300017442	Miscanthus Phyllosphere	MKDGEMVLIAQPLLESRTCAYLEWLVNEVIMTANET
Ga0182221_11651701	3300017442	Miscanthus Phyllosphere	MKDGEIDLIAQPLLESRRAAYIEWLDNELIMTANKTLT
Ga0182193_11230761	3300017443	Miscanthus Phyllosphere	MKYGEMDLIAQLLLESRICAYIEWLANELIMAANKTYT
Ga0182193_11243971	3300017443	Miscanthus Phyllosphere	MKDSEIDLIAQLLLESKIGAYIDWLDNELIKTGYKKH
Ga0182193_11326311	3300017443	Miscanthus Phyllosphere	MKGGEMELFAQLLLESRTGAYIEWLDNKLIMTANNKHA
Ga0182193_11379241	3300017443	Miscanthus Phyllosphere	MKDGKLVLIAHSLLESRTSAYLEWLANEIIMTANKT
Ga0182193_11572251	3300017443	Miscanthus Phyllosphere	MKDGKMDLIAQLLLESRIGAYIEWIANELIMTANKTPT
Ga0182193_11763981	3300017443	Miscanthus Phyllosphere	MKGGKMVMIAQLLLEGRTCAYLEWLANKVIMTANKT
Ga0182193_11930461	3300017443	Miscanthus Phyllosphere	MKDGKMVLIAQLLLEGRTGAYLEWLANKVIMSTNKT
Ga0182233_10398441	3300017680	Miscanthus Phyllosphere	MECDEMELIAQLLLESRTGAYIEWLDIELIMTANNKHT
Ga0182226_10731401	3300017681	Miscanthus Phyllosphere	RSKNWKMKDGEMDLFAQLLLESRTGAYLEWLDNKLIMTANKKHT
Ga0182226_11164641	3300017681	Miscanthus Phyllosphere	MEDGEMKLIAQLLLESRTDAYIEWLDIELIMNAND
Ga0182229_10466991	3300017682	Miscanthus Phyllosphere	MEGGKMVLFAQPLLEDRTGAYLEWLANKVIMTANKT
Ga0182218_10209631	3300017683	Miscanthus Phyllosphere	KNRKIKDDEMDLFAQLLLESRTDAYIEXLDNELIMTANKKHT
Ga0182218_10862652	3300017683	Miscanthus Phyllosphere	MIDGEMVLIAQPLLESRIGSYLEWLANEVIMTANKT
Ga0182218_11038711	3300017683	Miscanthus Phyllosphere	MKDDEMELFAQLLLESRTCAYIEWLDNVIIMIAKNKHT
Ga0182218_11104661	3300017683	Miscanthus Phyllosphere	MKDDEMDLIAQPMLESRSGAYLEWLGNEVIMTANKT
Ga0182218_11257441	3300017683	Miscanthus Phyllosphere	MKDGEMDLIAQLLLESRIGAYIEWLDNELIMTANNKHT
Ga0182218_11281021	3300017683	Miscanthus Phyllosphere	MKVGEIILIAQPLLESRTDAYLEWLANEVIMTANKT
Ga0182218_11378521	3300017683	Miscanthus Phyllosphere	MKGGEMELFAQLLLRSRTGAYIEWLDNIIIMTTKNK
Ga0182218_11431112	3300017683	Miscanthus Phyllosphere	MKDDKMVLIAQPLLEGRIGAYLEWLANKVIMTANKT
Ga0182218_11514251	3300017683	Miscanthus Phyllosphere	MKDDEMDLFAQLLLESRIGAYLELLASEVIMTANKNLTVRMNY
Ga0182218_11532591	3300017683	Miscanthus Phyllosphere	MKDDKMVLIAQPLLESRTCAYLEWLANEEIMAANKT
Ga0182225_11003122	3300017684	Miscanthus Phyllosphere	MKCGEIDLFAQLLLESKTDAYLEWLDNELIMTANKKHT
Ga0182225_11022101	3300017684	Miscanthus Phyllosphere	KMKDGEMDLFAQLLLESRTGAYLEXLDNELIMTTNKKHR
Ga0182227_10614001	3300017685	Miscanthus Phyllosphere	MKDGKMVLFAQPLLEGRTGAYLEWLANKVIMTANKT
Ga0182227_10631432	3300017685	Miscanthus Phyllosphere	MKDGEIDLIAQFLLESRTDAYIEWLDNKLIMTANKKHT
Ga0182227_10797111	3300017685	Miscanthus Phyllosphere	MKDDEMDLFAQILFESRTGAYLEWLDNEVIMTANKT
Ga0182227_10858632	3300017685	Miscanthus Phyllosphere	MKDEKIVLIAQPLLESRTDTYLEWLANEVIMIANKT
Ga0182227_10873251	3300017685	Miscanthus Phyllosphere	KDGEMVLIAQPLLESRIGAYLEWLANEVIMTANKI
Ga0182227_11235831	3300017685	Miscanthus Phyllosphere	MNDGEMDMFAQLLLGSRLGAYLEWLDNELIMTTNKKYT
Ga0182205_10476291	3300017686	Miscanthus Phyllosphere	KNWKMKDGEIDLIAQLLLESRTCAYIEWLDNKLIMTANKKHT
Ga0182205_11006792	3300017686	Miscanthus Phyllosphere	MKVSEMVLIAQPMLESRSGAYLEWLANEVIMTANKA
Ga0182231_10651731	3300017689	Miscanthus Phyllosphere	ELEEEREXIDLIAQLLFESRTGAYLEWLANELIMTANKIHT
Ga0182231_10711752	3300017689	Miscanthus Phyllosphere	MKGGKMVLIAQLLLEGRIGAYLEWLSNKVIMTANKT
Ga0182223_10231782	3300017690	Miscanthus Phyllosphere	MKDGELDLIAQLLLESRTCAYIEWLDNEVIMIANKKHT
Ga0182223_10335591	3300017690	Miscanthus Phyllosphere	MKDGEMDLFAQLLLESRTGAYLEWLNNELIMTANKKPT
Ga0182223_11088171	3300017690	Miscanthus Phyllosphere	MKDGKMDLIAPLLLESRKSAYIEWLVNELIMTANKTHI
Ga0182232_10808861	3300021060	Phyllosphere	WKIKDGEIDLFAQSLLKSRTCAYLEWLENELIMTANKKHT
Ga0207642_108723641	3300025899	Miscanthus Rhizosphere	MEGDEMELIAQLLLESRIGAYIEWLDNELIMTANKKHT
Ga0207642_110204202	3300025899	Miscanthus Rhizosphere	MKDGEMDLFAQLLLESRTGAYKEWIDNELIMTANKKHT
Ga0207643_109586411	3300025908	Miscanthus Rhizosphere	MEGGKMVLFAQPLLEGRTGAYLEWLANKVIMTANKT
Ga0207691_111215561	3300025940	Miscanthus Rhizosphere	MKDGEMVLIAQPLLESRTGAYLEWLANEVIMTANKT

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F007098

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign