Basic Information | |
---|---|
Family ID | F007447 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 351 |
Average Sequence Length | 42 residues |
Representative Sequence | VLEGPNSPHAKSLFEFARKVVARVDEIKASAPEGVIQIQ |
Number of Associated Samples | 287 |
Number of Associated Scaffolds | 351 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.17 % |
% of genes near scaffold ends (potentially truncated) | 95.73 % |
% of genes from short scaffolds (< 2000 bps) | 85.19 % |
Associated GOLD sequencing projects | 261 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.761 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (8.262 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.937 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.444 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 351 Family Scaffolds |
---|---|---|
PF01266 | DAO | 41.31 |
PF01628 | HrcA | 5.98 |
PF01391 | Collagen | 3.42 |
PF13561 | adh_short_C2 | 1.71 |
PF10609 | ParA | 1.71 |
PF05050 | Methyltransf_21 | 1.14 |
PF01850 | PIN | 1.14 |
PF03869 | Arc | 1.14 |
PF03444 | HrcA_DNA-bdg | 0.85 |
PF00877 | NLPC_P60 | 0.85 |
PF01025 | GrpE | 0.85 |
PF01979 | Amidohydro_1 | 0.57 |
PF02163 | Peptidase_M50 | 0.57 |
PF00069 | Pkinase | 0.57 |
PF09471 | Peptidase_M64 | 0.57 |
PF00106 | adh_short | 0.28 |
PF04299 | FMN_bind_2 | 0.28 |
PF05016 | ParE_toxin | 0.28 |
PF02538 | Hydantoinase_B | 0.28 |
PF01569 | PAP2 | 0.28 |
PF04542 | Sigma70_r2 | 0.28 |
PF01156 | IU_nuc_hydro | 0.28 |
PF07992 | Pyr_redox_2 | 0.28 |
PF11319 | VasI | 0.28 |
PF01556 | DnaJ_C | 0.28 |
PF00266 | Aminotran_5 | 0.28 |
PF03992 | ABM | 0.28 |
PF00801 | PKD | 0.28 |
PF13361 | UvrD_C | 0.28 |
PF02803 | Thiolase_C | 0.28 |
PF00885 | DMRL_synthase | 0.28 |
PF01833 | TIG | 0.28 |
PF02190 | LON_substr_bdg | 0.28 |
PF01479 | S4 | 0.28 |
PF06751 | EutB | 0.28 |
PF00684 | DnaJ_CXXCXGXG | 0.28 |
PF09286 | Pro-kuma_activ | 0.28 |
PF12969 | DUF3857 | 0.28 |
PF12762 | DDE_Tnp_IS1595 | 0.28 |
PF02518 | HATPase_c | 0.28 |
PF13502 | AsmA_2 | 0.28 |
PF00291 | PALP | 0.28 |
PF07690 | MFS_1 | 0.28 |
PF00254 | FKBP_C | 0.28 |
PF02367 | TsaE | 0.28 |
PF05685 | Uma2 | 0.28 |
COG ID | Name | Functional Category | % Frequency in 351 Family Scaffolds |
---|---|---|---|
COG1420 | Transcriptional regulator of heat shock response | Transcription [K] | 5.98 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.28 |
COG0576 | Molecular chaperone GrpE (heat shock protein HSP-70) | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.85 |
COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.57 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 0.57 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.28 |
COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 0.28 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.28 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.28 |
COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.28 |
COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 0.28 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.28 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.28 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.28 |
COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.28 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.28 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.05 % |
Unclassified | root | N/A | 15.95 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ01DTBQ0 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104879398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300001108|JGI12647J13326_104163 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300001471|JGI12712J15308_10057927 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300001593|JGI12635J15846_10792472 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300002568|C688J35102_119367314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
3300002917|JGI25616J43925_10144944 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300004091|Ga0062387_100281675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
3300004092|Ga0062389_104754725 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300004114|Ga0062593_103002096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
3300004152|Ga0062386_100023229 | Not Available | 4551 | Open in IMG/M |
3300004152|Ga0062386_100953791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium 13_1_40CM_3_65_7 | 710 | Open in IMG/M |
3300004156|Ga0062589_100365734 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
3300004479|Ga0062595_100014792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2732 | Open in IMG/M |
3300005167|Ga0066672_10493926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 795 | Open in IMG/M |
3300005332|Ga0066388_104137234 | Not Available | 740 | Open in IMG/M |
3300005332|Ga0066388_104680572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 696 | Open in IMG/M |
3300005334|Ga0068869_100827697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
3300005344|Ga0070661_100329701 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300005435|Ga0070714_100940949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 840 | Open in IMG/M |
3300005435|Ga0070714_101930126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300005436|Ga0070713_100767951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 923 | Open in IMG/M |
3300005436|Ga0070713_101884564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300005439|Ga0070711_100379268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
3300005439|Ga0070711_100999845 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005450|Ga0066682_10815867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 562 | Open in IMG/M |
3300005454|Ga0066687_10037182 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
3300005467|Ga0070706_102083395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
3300005468|Ga0070707_101437474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300005533|Ga0070734_10404151 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300005533|Ga0070734_10644299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 603 | Open in IMG/M |
3300005534|Ga0070735_10560829 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300005541|Ga0070733_10013957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5046 | Open in IMG/M |
3300005541|Ga0070733_10280473 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300005541|Ga0070733_10506293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 808 | Open in IMG/M |
3300005542|Ga0070732_10219233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1138 | Open in IMG/M |
3300005542|Ga0070732_10264765 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300005542|Ga0070732_10548077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300005546|Ga0070696_100062440 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
3300005547|Ga0070693_100107762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1708 | Open in IMG/M |
3300005549|Ga0070704_102241737 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005554|Ga0066661_10713202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 588 | Open in IMG/M |
3300005560|Ga0066670_10542431 | Not Available | 712 | Open in IMG/M |
3300005563|Ga0068855_100798953 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300005568|Ga0066703_10086625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1821 | Open in IMG/M |
3300005576|Ga0066708_10311698 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300005578|Ga0068854_100718975 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300005586|Ga0066691_10365135 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300005591|Ga0070761_10014719 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon | 4361 | Open in IMG/M |
3300005602|Ga0070762_10820759 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300005610|Ga0070763_10877658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 533 | Open in IMG/M |
3300005618|Ga0068864_101222026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300005712|Ga0070764_10112134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1468 | Open in IMG/M |
3300005938|Ga0066795_10155684 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300005995|Ga0066790_10290473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 697 | Open in IMG/M |
3300006046|Ga0066652_101489015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300006050|Ga0075028_100521999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 696 | Open in IMG/M |
3300006052|Ga0075029_100179718 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
3300006052|Ga0075029_100527521 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300006052|Ga0075029_100709763 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300006055|Ga0097691_1015943 | All Organisms → cellular organisms → Bacteria | 3440 | Open in IMG/M |
3300006059|Ga0075017_101461545 | Not Available | 538 | Open in IMG/M |
3300006086|Ga0075019_10158805 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300006086|Ga0075019_10767119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300006162|Ga0075030_101244792 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300006163|Ga0070715_10541926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300006163|Ga0070715_10692233 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 608 | Open in IMG/M |
3300006176|Ga0070765_100462446 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300006237|Ga0097621_101028821 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 771 | Open in IMG/M |
3300006237|Ga0097621_101430129 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300006237|Ga0097621_102044207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300006354|Ga0075021_10895694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 576 | Open in IMG/M |
3300006358|Ga0068871_100140233 | All Organisms → cellular organisms → Bacteria | 2055 | Open in IMG/M |
3300006794|Ga0066658_10668630 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300006797|Ga0066659_11313330 | Not Available | 603 | Open in IMG/M |
3300006854|Ga0075425_100246792 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300006854|Ga0075425_102075958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300006914|Ga0075436_100183524 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
3300007076|Ga0075435_101592277 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300007265|Ga0099794_10090373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1519 | Open in IMG/M |
3300007788|Ga0099795_10496137 | Not Available | 569 | Open in IMG/M |
3300009038|Ga0099829_11057986 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300009090|Ga0099827_10362318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1235 | Open in IMG/M |
3300009092|Ga0105250_10115886 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300009093|Ga0105240_12390069 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300009143|Ga0099792_11183614 | Not Available | 518 | Open in IMG/M |
3300009523|Ga0116221_1305729 | Not Available | 688 | Open in IMG/M |
3300009524|Ga0116225_1014030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4263 | Open in IMG/M |
3300009524|Ga0116225_1322037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium austroafricanum | 689 | Open in IMG/M |
3300009551|Ga0105238_11947984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300009628|Ga0116125_1044064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1127 | Open in IMG/M |
3300009630|Ga0116114_1075178 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300009634|Ga0116124_1074125 | Not Available | 978 | Open in IMG/M |
3300009639|Ga0116122_1012956 | All Organisms → cellular organisms → Bacteria | 3110 | Open in IMG/M |
3300009643|Ga0116110_1007153 | All Organisms → cellular organisms → Bacteria | 4875 | Open in IMG/M |
3300009665|Ga0116135_1426700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300009764|Ga0116134_1179961 | Not Available | 739 | Open in IMG/M |
3300009839|Ga0116223_10535756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300010043|Ga0126380_10758755 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300010043|Ga0126380_11908879 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300010046|Ga0126384_10305398 | Not Available | 1310 | Open in IMG/M |
3300010046|Ga0126384_11738089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300010048|Ga0126373_11078980 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300010159|Ga0099796_10034794 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300010326|Ga0134065_10403651 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300010341|Ga0074045_10394706 | Not Available | 898 | Open in IMG/M |
3300010360|Ga0126372_10088253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2285 | Open in IMG/M |
3300010361|Ga0126378_12936877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300010375|Ga0105239_11973403 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300010376|Ga0126381_102814107 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300010376|Ga0126381_102831931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300010376|Ga0126381_103232198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300010398|Ga0126383_13317267 | Not Available | 526 | Open in IMG/M |
3300010403|Ga0134123_10655248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
3300011120|Ga0150983_13521641 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300012201|Ga0137365_11271923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 523 | Open in IMG/M |
3300012206|Ga0137380_10996572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300012209|Ga0137379_11479367 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300012210|Ga0137378_10973692 | Not Available | 762 | Open in IMG/M |
3300012212|Ga0150985_122965201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300012361|Ga0137360_10480871 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300012362|Ga0137361_10101587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2502 | Open in IMG/M |
3300012362|Ga0137361_11102275 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300012363|Ga0137390_10388037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1376 | Open in IMG/M |
3300012683|Ga0137398_10870695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
3300012685|Ga0137397_10077016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2420 | Open in IMG/M |
3300012917|Ga0137395_10426673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 951 | Open in IMG/M |
3300012918|Ga0137396_10125733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1851 | Open in IMG/M |
3300012918|Ga0137396_10173513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1577 | Open in IMG/M |
3300012923|Ga0137359_11097886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300012925|Ga0137419_11967929 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300012927|Ga0137416_10684077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 900 | Open in IMG/M |
3300012930|Ga0137407_11098965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300012957|Ga0164303_11451416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300012958|Ga0164299_11037881 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 607 | Open in IMG/M |
3300012971|Ga0126369_10134147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2303 | Open in IMG/M |
3300012971|Ga0126369_12752495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 575 | Open in IMG/M |
3300012971|Ga0126369_13238657 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012986|Ga0164304_11122284 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300012989|Ga0164305_11174187 | Not Available | 664 | Open in IMG/M |
3300013100|Ga0157373_10136399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1725 | Open in IMG/M |
3300013296|Ga0157374_10275381 | Not Available | 1660 | Open in IMG/M |
3300013296|Ga0157374_11943325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300013308|Ga0157375_12772146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
3300013308|Ga0157375_13619461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300013308|Ga0157375_13666649 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300014150|Ga0134081_10350443 | Not Available | 542 | Open in IMG/M |
3300014155|Ga0181524_10402113 | Not Available | 597 | Open in IMG/M |
3300014156|Ga0181518_10147091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Neosynechococcus → Neosynechococcus sphagnicola → Neosynechococcus sphagnicola sy1 | 1266 | Open in IMG/M |
3300014166|Ga0134079_10345522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300014167|Ga0181528_10863908 | Not Available | 510 | Open in IMG/M |
3300014169|Ga0181531_10666149 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300014169|Ga0181531_10760444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300014489|Ga0182018_10102638 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
3300014495|Ga0182015_10048924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3102 | Open in IMG/M |
3300014654|Ga0181525_10433496 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300015051|Ga0137414_1167018 | Not Available | 4153 | Open in IMG/M |
3300015372|Ga0132256_101941278 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300017823|Ga0187818_10507470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300017823|Ga0187818_10541348 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300017927|Ga0187824_10391365 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300017930|Ga0187825_10249712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300017930|Ga0187825_10409537 | Not Available | 522 | Open in IMG/M |
3300017934|Ga0187803_10034712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2003 | Open in IMG/M |
3300017936|Ga0187821_10432404 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300017937|Ga0187809_10133567 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300017943|Ga0187819_10066140 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
3300017943|Ga0187819_10331098 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300017946|Ga0187879_10041129 | All Organisms → cellular organisms → Bacteria | 2755 | Open in IMG/M |
3300017959|Ga0187779_10603177 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300017972|Ga0187781_10835490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
3300017972|Ga0187781_10943326 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300017974|Ga0187777_10373815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300017975|Ga0187782_10353073 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300017995|Ga0187816_10218436 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300017995|Ga0187816_10218588 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300018003|Ga0187876_1196529 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300018003|Ga0187876_1309509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 500 | Open in IMG/M |
3300018012|Ga0187810_10332662 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300018019|Ga0187874_10089523 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300018026|Ga0187857_10358065 | Not Available | 661 | Open in IMG/M |
3300018029|Ga0187787_10454211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300018034|Ga0187863_10292799 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300018042|Ga0187871_10231712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
3300018042|Ga0187871_10880751 | Not Available | 500 | Open in IMG/M |
3300018047|Ga0187859_10070765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1837 | Open in IMG/M |
3300018047|Ga0187859_10342270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300018057|Ga0187858_10880274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300018085|Ga0187772_10021339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3729 | Open in IMG/M |
3300018085|Ga0187772_11005706 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300018085|Ga0187772_11264813 | Not Available | 545 | Open in IMG/M |
3300018086|Ga0187769_10827390 | Not Available | 700 | Open in IMG/M |
3300018086|Ga0187769_11411794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300018088|Ga0187771_10031742 | All Organisms → cellular organisms → Bacteria | 4022 | Open in IMG/M |
3300018090|Ga0187770_10966049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 685 | Open in IMG/M |
3300018431|Ga0066655_11207639 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300019268|Ga0181514_1618193 | Not Available | 658 | Open in IMG/M |
3300020006|Ga0193735_1091131 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300020021|Ga0193726_1006804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6576 | Open in IMG/M |
3300020022|Ga0193733_1000460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13629 | Open in IMG/M |
3300020022|Ga0193733_1024319 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
3300020078|Ga0206352_11086126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
3300020170|Ga0179594_10220376 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 713 | Open in IMG/M |
3300020579|Ga0210407_10417467 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300020580|Ga0210403_10001160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25578 | Open in IMG/M |
3300020580|Ga0210403_11294405 | Not Available | 557 | Open in IMG/M |
3300020581|Ga0210399_10001237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 20035 | Open in IMG/M |
3300020581|Ga0210399_11040727 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300020582|Ga0210395_11284395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300021168|Ga0210406_10149115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1964 | Open in IMG/M |
3300021168|Ga0210406_11393940 | Not Available | 501 | Open in IMG/M |
3300021171|Ga0210405_10999551 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300021178|Ga0210408_10142692 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
3300021402|Ga0210385_11556736 | Not Available | 505 | Open in IMG/M |
3300021403|Ga0210397_10746982 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300021404|Ga0210389_10142592 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
3300021404|Ga0210389_10801719 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300021405|Ga0210387_11323523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300021407|Ga0210383_11555793 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300021420|Ga0210394_11070566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300021432|Ga0210384_10799010 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300021432|Ga0210384_11854403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300021478|Ga0210402_11859734 | Not Available | 528 | Open in IMG/M |
3300024055|Ga0247794_10321629 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300025134|Ga0207416_1133767 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300025612|Ga0208691_1036218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
3300025900|Ga0207710_10150855 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300025905|Ga0207685_10388790 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 712 | Open in IMG/M |
3300025906|Ga0207699_10074370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2087 | Open in IMG/M |
3300025909|Ga0207705_11252675 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300025910|Ga0207684_11639519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300025913|Ga0207695_11487410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300025914|Ga0207671_10921277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300025915|Ga0207693_11185345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300025920|Ga0207649_10019789 | All Organisms → cellular organisms → Bacteria | 3852 | Open in IMG/M |
3300025922|Ga0207646_10321379 | Not Available | 1398 | Open in IMG/M |
3300025924|Ga0207694_10716000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300025928|Ga0207700_11837774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300025929|Ga0207664_10787190 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300025929|Ga0207664_11445814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300025929|Ga0207664_11574665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300025949|Ga0207667_10695344 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300026067|Ga0207678_10362007 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300026277|Ga0209350_1087381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
3300026318|Ga0209471_1195927 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300026335|Ga0209804_1216601 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300026354|Ga0257180_1035029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300026489|Ga0257160_1049381 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300026529|Ga0209806_1185067 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300026552|Ga0209577_10250763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1336 | Open in IMG/M |
3300027432|Ga0209421_1112355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300027497|Ga0208199_1060130 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300027548|Ga0209523_1111108 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300027591|Ga0209733_1032232 | Not Available | 1408 | Open in IMG/M |
3300027610|Ga0209528_1063959 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300027652|Ga0209007_1009549 | All Organisms → cellular organisms → Bacteria | 2573 | Open in IMG/M |
3300027660|Ga0209736_1073818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
3300027660|Ga0209736_1197691 | Not Available | 522 | Open in IMG/M |
3300027727|Ga0209328_10238885 | Not Available | 544 | Open in IMG/M |
3300027745|Ga0209908_10019039 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300027765|Ga0209073_10449899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300027773|Ga0209810_1153308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
3300027812|Ga0209656_10047795 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
3300027825|Ga0209039_10012592 | Not Available | 4726 | Open in IMG/M |
3300027853|Ga0209274_10070476 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300027853|Ga0209274_10598975 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300027854|Ga0209517_10046393 | All Organisms → cellular organisms → Bacteria | 3343 | Open in IMG/M |
3300027854|Ga0209517_10100957 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
3300027862|Ga0209701_10066087 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
3300027867|Ga0209167_10025045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2849 | Open in IMG/M |
3300027869|Ga0209579_10177848 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300027869|Ga0209579_10657806 | Not Available | 568 | Open in IMG/M |
3300027875|Ga0209283_10747132 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300027882|Ga0209590_10002870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7002 | Open in IMG/M |
3300027884|Ga0209275_10110087 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
3300027884|Ga0209275_10234212 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300027894|Ga0209068_10513317 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300027903|Ga0209488_10473101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 921 | Open in IMG/M |
3300027911|Ga0209698_10068043 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
3300028023|Ga0265357_1030392 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300028380|Ga0268265_10450688 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300028734|Ga0302206_1143603 | Not Available | 595 | Open in IMG/M |
3300028745|Ga0302267_10389150 | Not Available | 577 | Open in IMG/M |
3300028798|Ga0302222_10001792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10534 | Open in IMG/M |
3300028868|Ga0302163_10248013 | Not Available | 506 | Open in IMG/M |
3300028906|Ga0308309_11788078 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300029636|Ga0222749_10059460 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
3300029908|Ga0311341_10032296 | All Organisms → cellular organisms → Bacteria | 4364 | Open in IMG/M |
3300029951|Ga0311371_11102202 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300029956|Ga0302150_10350658 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300030007|Ga0311338_11154415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 738 | Open in IMG/M |
3300030042|Ga0302300_1227382 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300030051|Ga0302195_10090703 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
3300030659|Ga0316363_10394516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300030706|Ga0310039_10041183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2083 | Open in IMG/M |
3300030730|Ga0307482_1030428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
3300030815|Ga0265746_1004270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
3300031057|Ga0170834_102681534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300031057|Ga0170834_105269203 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300031231|Ga0170824_105915956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
3300031231|Ga0170824_108759409 | Not Available | 1101 | Open in IMG/M |
3300031233|Ga0302307_10107902 | Not Available | 1455 | Open in IMG/M |
3300031241|Ga0265325_10130590 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300031344|Ga0265316_10090450 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
3300031446|Ga0170820_10120939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300031524|Ga0302320_10933095 | Not Available | 933 | Open in IMG/M |
3300031525|Ga0302326_12057115 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300031561|Ga0318528_10655488 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300031708|Ga0310686_104351471 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
3300031708|Ga0310686_109377511 | Not Available | 1192 | Open in IMG/M |
3300031720|Ga0307469_11067920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300031720|Ga0307469_11159201 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300031736|Ga0318501_10579022 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300031740|Ga0307468_100163591 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300031754|Ga0307475_10998789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300031893|Ga0318536_10570133 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300031896|Ga0318551_10799462 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300031910|Ga0306923_10187517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2363 | Open in IMG/M |
3300031912|Ga0306921_10308842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1851 | Open in IMG/M |
3300031954|Ga0306926_11215345 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300031962|Ga0307479_10488291 | Not Available | 1215 | Open in IMG/M |
3300031962|Ga0307479_10809631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300031962|Ga0307479_11006325 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300032066|Ga0318514_10722846 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300032180|Ga0307471_102954231 | Not Available | 603 | Open in IMG/M |
3300032205|Ga0307472_101122816 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300032205|Ga0307472_102265635 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300032515|Ga0348332_14380581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 969 | Open in IMG/M |
3300032782|Ga0335082_11071624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 671 | Open in IMG/M |
3300032783|Ga0335079_11389796 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300032783|Ga0335079_12110868 | Not Available | 540 | Open in IMG/M |
3300032805|Ga0335078_12407269 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300032828|Ga0335080_11728607 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300032829|Ga0335070_10510764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1138 | Open in IMG/M |
3300032892|Ga0335081_10066479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5545 | Open in IMG/M |
3300032892|Ga0335081_10290750 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
3300032955|Ga0335076_11268396 | Not Available | 621 | Open in IMG/M |
3300033004|Ga0335084_10676311 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300033158|Ga0335077_11443602 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300033433|Ga0326726_10333331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1429 | Open in IMG/M |
3300033433|Ga0326726_11759214 | Not Available | 604 | Open in IMG/M |
3300033808|Ga0314867_119091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 616 | Open in IMG/M |
3300034282|Ga0370492_0037815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1984 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.99% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.70% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.70% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.42% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.42% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.13% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.13% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.13% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.28% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.85% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.71% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.71% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.42% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.14% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.57% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.57% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.57% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.57% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.28% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.28% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.28% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.28% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.28% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.28% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.28% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.28% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.28% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.28% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.28% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.28% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.28% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.28% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.28% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.28% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.28% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.28% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001108 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028734 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_1 | Environmental | Open in IMG/M |
3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029956 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_08229390 | 2170459024 | Grass Soil | EAGDSGSPAVLKDVDSPSVKSLYDFARKVVARVTEVKSHAPESVIQIQ |
INPhiseqgaiiFebDRAFT_1048793982 | 3300000364 | Soil | EESPHAKALFEFARQVXXRVEEIKSQAPEGVIQIQ* |
JGI12647J13326_1041632 | 3300001108 | Forest Soil | PSVLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ* |
JGI12712J15308_100579271 | 3300001471 | Forest Soil | EIRKSGDSGSPSVLEGENSSHAKSLFAFARNVATRVDELKASSSESVIQIQ* |
JGI12635J15846_107924722 | 3300001593 | Forest Soil | LEGENSPHAKSIYEFAKNVATRTAEIRANAPASVIQIQ* |
C688J35102_1193673142 | 3300002568 | Soil | NGKPSVLDGEGSTRGKSLYDFARNVVARVKEVKANAGEGVIQIQ* |
JGI25616J43925_101449441 | 3300002917 | Grasslands Soil | EIRKSGDSGSPSVLQGEDSPHAKSLFAXARXVXARVEEIKATSPESVIQIQ* |
soilH1_100790112 | 3300003321 | Sugarcane Root And Bulk Soil | RASDSGSPTVLEGTDSAHAKSLYDFAKKVVSRVDEIEASAPQGVIQIQ* |
Ga0062387_1002816752 | 3300004091 | Bog Forest Soil | PTVLEGPNSPHAKSLFDFARKVVARVDEIKANATEGVIQIQ* |
Ga0062389_1047547251 | 3300004092 | Bog Forest Soil | TVLEGEDSPHAKSLFAFARNVVARVEEIKANSPESVIQIQ* |
Ga0062593_1030020962 | 3300004114 | Soil | GKPIVIQGEDSSHAKSIYEFARRVAARVDEIKAAAPQDVIQIQ* |
Ga0062386_1000232291 | 3300004152 | Bog Forest Soil | SGTPSVLQGEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ* |
Ga0062386_1009537912 | 3300004152 | Bog Forest Soil | SGTPSVLQGEDSPHAKSLFAFARNVAARVDEIKAGSSESVIQIQ* |
Ga0062589_1003657341 | 3300004156 | Soil | DIRKASDSGQPTVLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ* |
Ga0062595_1000147921 | 3300004479 | Soil | DPEIRRAGDEGKPTVLEGENSAQAKPLFDFARKVVERVGQIRSSAGEGVIQIQ* |
Ga0066672_104939261 | 3300005167 | Soil | GQPAVLAGEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ* |
Ga0066388_1041372342 | 3300005332 | Tropical Forest Soil | GQPVVLAGEDAEQAKSLYEFARKVAARVEEIEANAAESVIHIQ* |
Ga0066388_1046805721 | 3300005332 | Tropical Forest Soil | GQPPVLEGENSPAAKSLYDFARKVIARVEEIKSTASAGVIQIQ* |
Ga0068869_1008276971 | 3300005334 | Miscanthus Rhizosphere | VLEGENSPHAKALFDFARKVVERVGQIRANAGEGVIHIQ* |
Ga0070661_1003297011 | 3300005344 | Corn Rhizosphere | PAVLAGEDSPHAKSLYALARKVETRVSEIKAAAPEGVIQIQ* |
Ga0070714_1009409491 | 3300005435 | Agricultural Soil | AVLEGESSPHAKALFDFAHRVEERIEQIKAAAPEGVIQIQ* |
Ga0070714_1019301261 | 3300005435 | Agricultural Soil | EGKPAVLEGENSPHAKALFDFAHRVVERVEQIKSAAPESVIQIQ* |
Ga0070713_1007679511 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IRRSGDQGKPAVLEGEDSVHATPLFDFARKVAERVQQIRSSAPEGVIQIQ* |
Ga0070713_1018845641 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PAVLEGEGSSHAKALFEFARKVAERVKQIRSSAPEGVIQIQ* |
Ga0070711_1003792681 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PDIRKAGDTGKPAVLEGENSPHAKSLFAFARSVESRITEIKANAPESVIQIQ* |
Ga0070711_1009998452 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TGKPVVLEGENGAHAKSLYEFAHRVVDRVNEIKSKATENVIQIQ* |
Ga0066682_108158672 | 3300005450 | Soil | AVLAGEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ* |
Ga0066687_100371821 | 3300005454 | Soil | PMVLAGESSAPSKSLYQFARNVVTRVDEIKSTAGESVIQIQ* |
Ga0070706_1020833952 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GDSGSPSVLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ* |
Ga0070707_1014374742 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VLEGENSPHAKALFDFARRVVERVEQIKSAAPESVIQIQ* |
Ga0070734_104041511 | 3300005533 | Surface Soil | GENSPHAKSIYEFANRVRARIDEIRANAPAGVIQIQ* |
Ga0070734_106442991 | 3300005533 | Surface Soil | DEGRPAVLEDESSPHAKSLFDFAHRVEERIEQIKSAAPEGVIQIQ* |
Ga0070735_105608291 | 3300005534 | Surface Soil | VLEGENSAHAKSLFEFARNVVTRVSEIKSTTGDSVIQIQ* |
Ga0070733_100139576 | 3300005541 | Surface Soil | LEGEDSPHAKGLFDFARRVVQRTDEIKSQASEGVIQIQ* |
Ga0070733_102804731 | 3300005541 | Surface Soil | SGDSGKPTVLEGEGSAHAKSLFDFARKVIARVDELKATAGESVIQIQ* |
Ga0070733_105062932 | 3300005541 | Surface Soil | GQPVVLRGENSAPSKSLFDFARKVVARVSEIRAAAPADVIQIQ* |
Ga0070732_102192331 | 3300005542 | Surface Soil | NSPHAKSIYEFARKVIERVGEIKANAPGNVIQIQ* |
Ga0070732_102647651 | 3300005542 | Surface Soil | NSPHAKAIYEFAHKVIDRVTEIKANAPANVIQIQ* |
Ga0070732_105480771 | 3300005542 | Surface Soil | ENSPHAKSIYEFAQRVTARTAEIKANAPASVIQIQ* |
Ga0070672_1002532583 | 3300005543 | Miscanthus Rhizosphere | TVLEGTESAHAKSLYDFTRRVVSRVDEIEAAAPQGVIQIQ* |
Ga0070696_1000624401 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | IRKASDSGRPTVLGGEASSSGKSLYDFARKVVTRVDEIKANAGESVIQIQ* |
Ga0070693_1001077623 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VLEGENSPHAKPLFDFARKVAERVGQIRSSAGEGVIQIQ* |
Ga0070704_1022417371 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KASDSGQPTVLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ* |
Ga0066661_107132022 | 3300005554 | Soil | AVLAGEDAAHAKSLYEFARKVAARVDEIKSGAAESVIHIQ* |
Ga0066670_105424311 | 3300005560 | Soil | AVLEGEESPHAKALFEFARQVVGRVEEIRAQAPESVIQIQ* |
Ga0068855_1007989532 | 3300005563 | Corn Rhizosphere | NSPHAKSIYEFARKVIDRVGEIKANAPAGVIQIQ* |
Ga0066703_100866253 | 3300005568 | Soil | VLEGEVSPSAQSLFEFARRVIARVAEIKAGESEGVIHVQ* |
Ga0066708_103116982 | 3300005576 | Soil | RKSGDEGKPAVLEGEDSPHAKALFDFARHVVERVDQIKSAAPEGVVQIQ* |
Ga0068854_1007189751 | 3300005578 | Corn Rhizosphere | VLAGEDSPHAKSLYALARKVEVRIAEIKSAAPEGVIQIQ* |
Ga0066691_103651353 | 3300005586 | Soil | GGTPAVLKGEDSPHAKSLFAVARKVAARVDEIKAGSSESVIQIQ* |
Ga0070761_100147191 | 3300005591 | Soil | PEIRKSGDGGVPAVLQGEDSPHAKSLFAFARNVAARVDKIKASSSESVIQIQ* |
Ga0070762_108207592 | 3300005602 | Soil | LQGEDSPHAKSLFAFARNVVTRVDELKASSSESVIQIQ* |
Ga0070763_108776581 | 3300005610 | Soil | EGENSPHAKSIYEFAQKVAARTAEIRASAPASVIQIQ* |
Ga0068864_1012220262 | 3300005618 | Switchgrass Rhizosphere | DSGKPTVLDGEGSPHAKSLFDFARKVETRVKEINAAAPESVIQIQ* |
Ga0070764_101121341 | 3300005712 | Soil | EIGRGGDNGSPAVLKGESSSHAKSLFEFARKVVARVEEIKATTSENVIQIQ* |
Ga0068858_1002268171 | 3300005842 | Switchgrass Rhizosphere | DSGTPTVLEGENSAHAKSLYDFANKVVTRVDEIEANAPRGVIQIQ* |
Ga0075285_10275042 | 3300005890 | Rice Paddy Soil | TGKPAVLEGEASAHAKSLYAFARNVETRVKEIKAAAPDNVIQIQ* |
Ga0066795_101556842 | 3300005938 | Soil | DSPHAKSLFAFARNVAARVEEIRAGSSESVIQIQ* |
Ga0066790_102904732 | 3300005995 | Soil | LNGEDSAHAKSLYAFARKVASRIDEIKASAPESVIQIQ* |
Ga0066652_1014890152 | 3300006046 | Soil | VLEGEASSHAKALFDFAKKVDERVQHIRSSAPEGVIQIQ* |
Ga0075028_1005219992 | 3300006050 | Watersheds | ESSSHAKSLFEFARNVIARVDEIKSNAGQSVIQIQ* |
Ga0075029_1001797184 | 3300006052 | Watersheds | SGSPAVLMGEDSPHAKSLFEFARKVVARVEEIKSSSSEGVIQIQ* |
Ga0075029_1005275211 | 3300006052 | Watersheds | IVLEGESSPHAKSIYDFARRVVDRVGEIKASAPGNVIQIQ* |
Ga0075029_1007097631 | 3300006052 | Watersheds | GDTGKPAVLKGENSPYAKSLYDFARKVEARVQEINASASESVIQIQ* |
Ga0097691_10159436 | 3300006055 | Arctic Peat Soil | EIRKSGDSGDPAVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ* |
Ga0075017_1014615451 | 3300006059 | Watersheds | EIRRSGDSGSPAVLKGEDSPHAKSLFEFARKVAARVEEIKASSSEGVIQIQ* |
Ga0075019_101588053 | 3300006086 | Watersheds | AVLKGEDSPHAKSLFEFARRVAVRVEEIKSSSSEGVIQIQ* |
Ga0075019_107671192 | 3300006086 | Watersheds | GGKPAVLAGEDSAHGKSLFAFARKVAARVEEIKASAPGNVVQIQ* |
Ga0075030_1012447922 | 3300006162 | Watersheds | LEGENSPHAKSIYEFARRVVDRVAEIKASAPANVIQIQ* |
Ga0070715_105419262 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AVLEGESSGHAKPLFDFARQVAQRVEEIKSSAPEGVIQIQ* |
Ga0070715_106922331 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ* |
Ga0070765_1004624461 | 3300006176 | Soil | PNIRKAGDSGKPTALEGEGSAQAKSLYDFARNVIARVDEIKSHAGESVIQIQ* |
Ga0097621_1010288211 | 3300006237 | Miscanthus Rhizosphere | IRKASDSGRPTVLAGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ* |
Ga0097621_1014301292 | 3300006237 | Miscanthus Rhizosphere | TPVVLEGENSPHAKSIYEFAKNVAARTAEIKANAPASVIQIQ* |
Ga0097621_1020442072 | 3300006237 | Miscanthus Rhizosphere | GSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ* |
Ga0075021_108956942 | 3300006354 | Watersheds | TVLEGEGSPHAKSLYEFARKVIARVDEIKSSAGESVIQIQ* |
Ga0068871_1001402334 | 3300006358 | Miscanthus Rhizosphere | VLEGEDSPHAKALFDFARRVVERVEQIKAAAPESVIQIQ* |
Ga0066658_106686301 | 3300006794 | Soil | IQLDPQIRKSGDEGRPTVFEGESSPHAKALFDFAHRVEERIEQIKAAAPEGVIQIQ* |
Ga0066659_113133302 | 3300006797 | Soil | ESAPHAKSLFEFARRVADRIEQIKSSAPESVIQIQ* |
Ga0075425_1002467923 | 3300006854 | Populus Rhizosphere | GDGGQPMVLAGEDFAPAKSLYEFARKVVARVDEIKSTAGESVIQIQ* |
Ga0075425_1020759581 | 3300006854 | Populus Rhizosphere | QPIVLEGQDAAHAKSLYQFARKVVARVNEITSSAAESVIHIQ* |
Ga0075436_1001835242 | 3300006914 | Populus Rhizosphere | RKASDSGRPTVLGGEVSSSGKSLYDFARKVVTRVDEIKANAGESVIQIQ* |
Ga0075435_1015922772 | 3300007076 | Populus Rhizosphere | DFAPAKSLYEFARKVVARVDEIKSTAGESVIQIQ* |
Ga0099794_100903731 | 3300007265 | Vadose Zone Soil | ENSPSAQSLYEFARKVIARVTEIKAGESEGVIHVQ* |
Ga0099795_104961371 | 3300007788 | Vadose Zone Soil | EIRKAGDSGSPAVLQGEDSPHAKSLFEFARKVVERVDKIKASSTASVVQIQ* |
Ga0099829_110579861 | 3300009038 | Vadose Zone Soil | LDPEVRKSGDGGKPVVLEGENSAHAKSLFAFARKVEARVAEIRATAPESVIQIH* |
Ga0099827_103623181 | 3300009090 | Vadose Zone Soil | DSPSAQSLYEFARKVIARVTEIKAGESEGVIHVQ* |
Ga0105250_101158862 | 3300009092 | Switchgrass Rhizosphere | VLGGEVSSSGKSLYDFARKVVTRVDEIKANAGERVIQIQ* |
Ga0105240_123900692 | 3300009093 | Corn Rhizosphere | GEDSPHAKSLYALARKVEVRIAEIKSAAPEGVIQIQ* |
Ga0099792_111836141 | 3300009143 | Vadose Zone Soil | GGEDSPHAKSIFAFARKVAARVVEIKAGESASVIQIQ* |
Ga0116221_13057292 | 3300009523 | Peatlands Soil | RKSGDGGTPAVLQGEDSPSAKSLFAFARNVAARVEEIKAGSSESVIQIQ* |
Ga0116225_10140304 | 3300009524 | Peatlands Soil | PSVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ* |
Ga0116225_13220373 | 3300009524 | Peatlands Soil | KPSVLEGENSPHAKSLYEFARKVVARVSEIKANAPESVIQIQ* |
Ga0105238_119479841 | 3300009551 | Corn Rhizosphere | PEIRRSGDEGKPAVLEGENSPHAKALFDFARKVVERVGQIRANAGEGVIHIQ* |
Ga0116125_10440643 | 3300009628 | Peatland | VVLEGENSPHAKSIYEFAHRVAARVAEIKAGEGAGVISIQ* |
Ga0116114_10751781 | 3300009630 | Peatland | SGDGGSPAVLQGENSAHAKSLFAFARNVVARVDEIKASSSQSVIQIQ* |
Ga0116124_10741251 | 3300009634 | Peatland | DSPHAKSLFAFARNVVARVEEIKAGSSDSVIQIQ* |
Ga0116122_10129564 | 3300009639 | Peatland | AVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ* |
Ga0116110_10071531 | 3300009643 | Peatland | QGEDSPHAKSLFAFARNVVARVDEIKASSSQSVIQIQ* |
Ga0116135_14267001 | 3300009665 | Peatland | GENSPHAKSLFAFARKVVERVSEIKANSSESVIQIQ* |
Ga0116134_11799611 | 3300009764 | Peatland | GDGGSPSVLQGEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ* |
Ga0116223_105357562 | 3300009839 | Peatlands Soil | ALRQAGDTGKAVVLDGENSPAAKSLYEFARKVVARVDEIKAGASENVIQIQ* |
Ga0126380_107587552 | 3300010043 | Tropical Forest Soil | GSIALDPEVRKSGDGGKPVVLEGENSPHARSIFEFARKVIDRVSEIKASAPGNVIQIQ* |
Ga0126380_119088791 | 3300010043 | Tropical Forest Soil | EASPHAKSIYDFARKVIDRVGEIKANTPANVIQIQ* |
Ga0126384_103053982 | 3300010046 | Tropical Forest Soil | PAVLGGEQSQHAKSLFGFAQNVESRVSEIKKSTAEGVIQIQ* |
Ga0126384_117380891 | 3300010046 | Tropical Forest Soil | QGTPAVLEGESSAHAKPLFDFARRVAERVEQIRSAAPAGVIQIQ* |
Ga0126373_110789801 | 3300010048 | Tropical Forest Soil | PVVLEGENSSHARSIFEFARKVIDRVSEIKASAPGNVIQIQ* |
Ga0099796_100347941 | 3300010159 | Vadose Zone Soil | LAGEGTASGKSLFDFARKVVVRVDEIKANTGESVIQIQ* |
Ga0134065_104036512 | 3300010326 | Grasslands Soil | EVQLDPGIRQAGDAGQPAVLAGENTPHAKSLFEFARRVAARVDEIKSSATESVISIQ* |
Ga0074045_103947061 | 3300010341 | Bog Forest Soil | AGDGGKPAVLQGEDSAHAKSLFEFARKVVARVEEIKANSSQGVIQIQ* |
Ga0126372_100882533 | 3300010360 | Tropical Forest Soil | IALDPEVRKSGDGGKPVVLEGENSPHARSIYDFARRVIDRVGQIKASSPGNVIQIQ* |
Ga0126378_129368771 | 3300010361 | Tropical Forest Soil | SSPHAKSLFEFAKQVVARVAEVKGTQTDSVIQIQ* |
Ga0105239_119734032 | 3300010375 | Corn Rhizosphere | AGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ* |
Ga0126381_1028141072 | 3300010376 | Tropical Forest Soil | ALDPEVRKAGDGGRPVVLEGENSPHAKSMYEFAKKVIDRVGEIKVNAPGNVIQIQ* |
Ga0126381_1028319312 | 3300010376 | Tropical Forest Soil | GDEGKPAVLAGESSPHAKPLFDFARHVAERVEQIKSTAPEGVIQIQ* |
Ga0126381_1032321981 | 3300010376 | Tropical Forest Soil | KPAVLAGESSPHAKPLFDFARHVAERVEQIKSIASEGVIQIQ* |
Ga0126383_133172671 | 3300010398 | Tropical Forest Soil | SSPHAKSIYDFARRVIDRVGEIKANAPGSVIQIQ* |
Ga0134121_127954361 | 3300010401 | Terrestrial Soil | SGSPTVLEGTDSAHAKSLYDFTKKVVSRVDEIEAAAPQGVIQIQ* |
Ga0134123_106552481 | 3300010403 | Terrestrial Soil | KAGDSGKPTVLDGEGSPHAKSLFDFARKVETRVKEINAAAPESVIQIQ* |
Ga0150983_135216411 | 3300011120 | Forest Soil | ENSPHAKSIFAFARNVVARVEEIKANAGGSVIQIQ* |
Ga0137365_112719232 | 3300012201 | Vadose Zone Soil | EIRKSGDEGRPAVLEGQSSPHAKSLFEFARRVAERVEQIRSSAPESVIQIQ* |
Ga0137380_109965722 | 3300012206 | Vadose Zone Soil | ESAPHAKSLFEFARRVVDRVEQIKSSAPESVIQIQ* |
Ga0137379_114793672 | 3300012209 | Vadose Zone Soil | VLAGEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ* |
Ga0137378_109736921 | 3300012210 | Vadose Zone Soil | PAIRKAGDGGRPMVLAGEDVAAAKSLYEFARKVVTRVDEIKSTAGESVIQIH* |
Ga0150985_1229652012 | 3300012212 | Avena Fatua Rhizosphere | EGESSPHAKALFDFAHRVEERIEQIKAAAPEGVIQIQ* |
Ga0137360_104808711 | 3300012361 | Vadose Zone Soil | EVGKSVDGGKPVVLEGENSAHAKSLFAFARKVEARVAEIRATAPESVIQIQ* |
Ga0137361_101015873 | 3300012362 | Vadose Zone Soil | GSPAVLKGEDSPHAKSLFEFARKVVARVDEVKASSSASVVQIQ* |
Ga0137361_111022751 | 3300012362 | Vadose Zone Soil | VLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ* |
Ga0137390_103880372 | 3300012363 | Vadose Zone Soil | KPTVLEGEESSHAKPLYEFARKVVARVEQIRASSPESVISIQ* |
Ga0137398_108706951 | 3300012683 | Vadose Zone Soil | EIRKSGDSGSPSVLQGEDSPHAKSLFAFARNVAARVEQIKASSSESVIQIQ* |
Ga0137397_100770161 | 3300012685 | Vadose Zone Soil | KAGDTGSPAVLKGEDSAHAKSLFEFARKVVARVDDIKASSSASVVQIQ* |
Ga0137395_104266731 | 3300012917 | Vadose Zone Soil | LGGEGNAYGKSLFDFARTVVTRVDEIKANAGESVIQIQ* |
Ga0137396_101257331 | 3300012918 | Vadose Zone Soil | DSGKPAVLEGENSPRAKSLYDFTRKVITRVDEIRASAPESVMQIQ* |
Ga0137396_101735132 | 3300012918 | Vadose Zone Soil | VLQGEDSPHAKSLFEFARKVVARVDEIKASSSASVVQIQ* |
Ga0137359_110978861 | 3300012923 | Vadose Zone Soil | EIRKSGDSGSPSVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ* |
Ga0137419_119679292 | 3300012925 | Vadose Zone Soil | GKPAVLEGENSPRAKSLYDFTRKVITRVDEIRASAPESVIQIQ* |
Ga0137416_106840772 | 3300012927 | Vadose Zone Soil | PEIRKSGDQGKPAVLEGETSPHAKALFEFARRVAERVEHIKSSAPETVVQIQ* |
Ga0137407_110989651 | 3300012930 | Vadose Zone Soil | VLKGEDSPHARSLFAFARNVVSRVDEIKASSPASVVQIQ* |
Ga0164303_114514161 | 3300012957 | Soil | RRAGDEGKPAVLEGENSPHAKPLFDFARKVAERVGQIRSSAGEGVIQIQ* |
Ga0164299_110378812 | 3300012958 | Soil | GRPTVLAGEGTASGKSLFDFARKVVARVDEIKANAGEAVIQIQ* |
Ga0126369_101341471 | 3300012971 | Tropical Forest Soil | EGESSPHAKSIYDFARKVVDRVGEIKAAAPANVIQIQ* |
Ga0126369_127524952 | 3300012971 | Tropical Forest Soil | PTALEGEGSAHAKSLYEFARNVMTRVDEIKSKAGESVIQIQ* |
Ga0126369_132386572 | 3300012971 | Tropical Forest Soil | LEGESSPQAKSLFDFARGVVARVQEIKATAPEGVIQIQ* |
Ga0164304_111222841 | 3300012986 | Soil | TGKPAVLDGENAPHAKALYEFARRVVARVREIRAQSGDSVIQIQ* |
Ga0164305_111741872 | 3300012989 | Soil | EESAHAKPLFDFARQVIGRVDEIKSQAPEGVIQIQ* |
Ga0157373_101363991 | 3300013100 | Corn Rhizosphere | GENSPHAKSIYEFARKVIDRVGEIKANAPAGVIQIQ* |
Ga0157374_102753813 | 3300013296 | Miscanthus Rhizosphere | DSAHAKSIYEFARRVVNRVDEIKAAAPQDVIQIQ* |
Ga0157374_119433252 | 3300013296 | Miscanthus Rhizosphere | LEGENSPHAKPLFDFARKVAERVQQIRASAGEGVIQIQ* |
Ga0157375_127721462 | 3300013308 | Miscanthus Rhizosphere | SDSGQPTVLAGEVSSSGKSLYDFARKVVTRVDEIKANAGESVIQIQ* |
Ga0157375_136194611 | 3300013308 | Miscanthus Rhizosphere | EGKPTVLEGENSAQAKPLFDFARKVVERVGQIRSSAGEGVIQIQ* |
Ga0157375_136666491 | 3300013308 | Miscanthus Rhizosphere | PDIRKASDSGQPTVLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ* |
Ga0134081_103504431 | 3300014150 | Grasslands Soil | VLAGESYPHAKSLFEFAKKVIFRVQEMKSSSSGTVIKVQ* |
Ga0181524_104021132 | 3300014155 | Bog | APSVLAGEDAPHAKSLFAFARKVAARVEEIKAGNSESVIQIQ* |
Ga0181518_101470911 | 3300014156 | Bog | EDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ* |
Ga0134079_103455221 | 3300014166 | Grasslands Soil | GESSPHAKSLFDLARHVVRRVEQIKSTAPEGVVQIQ* |
Ga0181528_108639081 | 3300014167 | Bog | PAVLKGEDSPHAKSLFAFARKVVTRVEEIKSTSSESVIQIQ* |
Ga0181531_106661492 | 3300014169 | Bog | ENSPHAKSIYEFARKVVARVDEIKANAPASVIQIQ* |
Ga0181531_107604442 | 3300014169 | Bog | LRGEDSPHAKALFEFARRVVARVDEIKANATENVIQIQ* |
Ga0182018_101026384 | 3300014489 | Palsa | SGDSGKPTVLEGENSSHAKSLFEFARNVIARVSEIKASAGDSVIQIQ* |
Ga0182015_100489241 | 3300014495 | Palsa | VPAVLQGEDSPHAKSLFEFARNVVARVDEIKASSSESVIQIQ* |
Ga0181525_104334961 | 3300014654 | Bog | PVVLEGENSPHAKSIYDFARNVLARVTEIKANAPANVIQIQ* |
Ga0137414_11670188 | 3300015051 | Vadose Zone Soil | MVLAGEDFAAAKSLYAFARKVVTRVDEIKSTAGESVIQIQ* |
Ga0132256_1019412781 | 3300015372 | Arabidopsis Rhizosphere | GEDAIHAKSLYEFARKVAARVDEIKLSAAESVIHIQ* |
Ga0187818_105074702 | 3300017823 | Freshwater Sediment | LEGDSSPRSKSLYDFARKVIARVEEIKAAAPEGVIQIQ |
Ga0187818_105413481 | 3300017823 | Freshwater Sediment | GENSPHAKSIYAFAQNVVTRAAEIKANAPASVIQIQ |
Ga0187824_103913651 | 3300017927 | Freshwater Sediment | PVVLEGENSPLAKSLFDFARRVMGRVDEIRASAPSGVIQIQ |
Ga0187825_102497122 | 3300017930 | Freshwater Sediment | RRGGDEGKPAILEGENSPHAKSLFEFARKVADRVQQIRASAGEGVIQIQ |
Ga0187825_104095371 | 3300017930 | Freshwater Sediment | QPAVLAGENSPHAKSLYEFAHKVVGRIGEIKSKAPENVIQIQ |
Ga0187803_100347123 | 3300017934 | Freshwater Sediment | SFLGNIALDPEVRKSGDGGKPVVLEGENSPHARSIYEFARNVVARVAEIKASAPASVIQI |
Ga0187821_104324041 | 3300017936 | Freshwater Sediment | QLDPGIRQAGDAGQPAVLAGENSPQAKSLYEFARNVKARVEEIKASAPESVIQIQ |
Ga0187809_101335671 | 3300017937 | Freshwater Sediment | LEGENSPHAKSIYEFAKNVAARTAEIKAAAPASVIQIQ |
Ga0187819_100661401 | 3300017943 | Freshwater Sediment | VLEGPNSPHAKSLFEFARKVVARVDEIKASAPEGVIQIQ |
Ga0187819_103310982 | 3300017943 | Freshwater Sediment | TVLEGENSPHAKSLYEFAHKVVARVDEIKSSASEGVIQIQ |
Ga0187879_100411294 | 3300017946 | Peatland | LQGENSAHAKSLFAFARNVVARVDEIKASSSQSVIQIQ |
Ga0187779_106031771 | 3300017959 | Tropical Peatland | AVLQGEDSPHAKSLFEFARKVVARVEEIKASSPEGVIQIQ |
Ga0187781_108354901 | 3300017972 | Tropical Peatland | LHGEESAHAKSLFQFARTVAARVEEIKSSSSEGVIQIQ |
Ga0187781_109433261 | 3300017972 | Tropical Peatland | PVVLEGENSPHAKSIYEFAHRVVDRVAEIKASAPAGVIQIQ |
Ga0187777_103738152 | 3300017974 | Tropical Peatland | ALDPEVRKAGDGGKPVVLEGENSPHARSMYEFARKVVDRVAEIRANAPAGVIQIQ |
Ga0187782_103530732 | 3300017975 | Tropical Peatland | AGDGGKPVVREGESSLHAKSIYDFARKVVERVGEIKASAPTSVIQIQ |
Ga0187816_102184362 | 3300017995 | Freshwater Sediment | VLEGENSPHAKSIYAFAQNVVTRAAEIKANAPASVIQIQ |
Ga0187816_102185882 | 3300017995 | Freshwater Sediment | EDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ |
Ga0187876_11965292 | 3300018003 | Peatland | EGENSPHAKSIFEFARRVVARVGEIKAGEGASVIQIQ |
Ga0187876_13095091 | 3300018003 | Peatland | SGDPAVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ |
Ga0187810_103326622 | 3300018012 | Freshwater Sediment | VVLEGENSPHAKAIYDFARKVVERVGEIKANAPGNVIQIQ |
Ga0187874_100895233 | 3300018019 | Peatland | DGGSPSVLQGEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ |
Ga0187857_103580652 | 3300018026 | Peatland | KGEDSSHAKSLFAFARNVVARVEEIKAGSSESVIQIQ |
Ga0187787_104542112 | 3300018029 | Tropical Peatland | ENSPHAKSLYEFTRRVVERVREIKAASPNSVIQIQ |
Ga0187863_102927992 | 3300018034 | Peatland | DGGVPAVLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ |
Ga0187871_102317121 | 3300018042 | Peatland | GDGGSPAVLKGEDSPHAKSLFAFARNVVSRVEELKATSSESVIQIQ |
Ga0187871_108807512 | 3300018042 | Peatland | RKSGDGGTPAVLQGENSPHAKSLFTFARNVVARVEEIKASSSESVIQIQ |
Ga0187859_100707651 | 3300018047 | Peatland | VVLEGENSPHAKSIYEFAHRVAARVAEIKAGEGAGVISIQ |
Ga0187859_103422701 | 3300018047 | Peatland | KSGDGGVPAVLQGEDSPHAKSLFAFARNVVARVEEIKAGSSESVIQIQ |
Ga0187858_108802742 | 3300018057 | Peatland | AVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ |
Ga0187772_100213395 | 3300018085 | Tropical Peatland | GGKPVVLEGENSPHAKSMYEFARKVVERVGEIKASMPTGVIQIQ |
Ga0187772_110057062 | 3300018085 | Tropical Peatland | EDSAHAKSLFEFARKVVARVEEIKASSSEGVIQIQ |
Ga0187772_112648132 | 3300018085 | Tropical Peatland | AAGDSGTPAVLKGEDSPHAKSLFEFARKVVARVEEIKSSSSEGVIQIQ |
Ga0187769_108273901 | 3300018086 | Tropical Peatland | EGENSPHAKSLFAFAKKVMARVEEIKSSSSEGVIQIQ |
Ga0187769_114117942 | 3300018086 | Tropical Peatland | PEVRKAGDGGKPVVLEGENSPHAKSMFEFARKVVDRVAEIKASAPAPVIQIQ |
Ga0187771_100317421 | 3300018088 | Tropical Peatland | PAVLAGESSPHAKSLFEFAKRVVARVEEIKSSSSEGVIQIQ |
Ga0187770_109660491 | 3300018090 | Tropical Peatland | IRRAGDGGKPTVLEGENSPHAKSLFDFARKVIARVDQIKASSPESVIQIQ |
Ga0066655_112076392 | 3300018431 | Grasslands Soil | EDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ |
Ga0181514_16181931 | 3300019268 | Peatland | ENSPHAKSIYEFARKVVARVDEIKANAPASVIQIQ |
Ga0193735_10911312 | 3300020006 | Soil | AGDGGQPMVLAGEDFAPAKSLYEFARNVVTRVDEIKSTAGESVIQIQ |
Ga0193726_10068046 | 3300020021 | Soil | GEDAPHAKSLYEFARKVVERIAEIKATADPSVIQIQ |
Ga0193733_100046012 | 3300020022 | Soil | MVLAGEDFAPAKSLYEFARNVVTRVDEIKSSTGESVIQIQ |
Ga0193733_10243192 | 3300020022 | Soil | MVLAGEDFAPAKSLYEFARNVVTRVDEIKSTAGESVIQIQ |
Ga0206352_110861262 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | ENSAQAKPLFDFARKVVERVGQIRSSAGEGVIQIQ |
Ga0179594_102203762 | 3300020170 | Vadose Zone Soil | IRKASDSGRPTVLAGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ |
Ga0210407_104174672 | 3300020579 | Soil | KSGDGGKPVVLEGENSAHAKALFAFARKVEARVAEIRATSSEGVIQIH |
Ga0210403_1000116022 | 3300020580 | Soil | IVLEGENSPHAKSIYEFARKVVERVGEIKANAPGDVIQIQ |
Ga0210403_112944051 | 3300020580 | Soil | GDSGKPTVLEGEGSAHAKSLFEFARKVIARVDEIKATAGESVIQIQ |
Ga0210399_1000123716 | 3300020581 | Soil | GAIQLDPELRRAGDSGKPVVLEGENTPHTKALYDFARKVVARVDEIRSHAPEGVIQIQ |
Ga0210399_110407272 | 3300020581 | Soil | GAIQLDPELRRAGDSGKPVVLEGENTPHTKALYDFARKVVARVEEIRSHAPEGVIQIQ |
Ga0210395_112843952 | 3300020582 | Soil | LDPEVRKSGDGGKPVVLEGENSPHAKSMYEFARRVVTRVDEIKASAPAGVIQIQ |
Ga0210406_101491151 | 3300021168 | Soil | ENSPHAKSLYDFTRKVIARVDEIRANATEGVIQIQ |
Ga0210406_113939402 | 3300021168 | Soil | MVLAGEGSMPAKSLYDFARKVETRVDEIKSTAGESVIQIQ |
Ga0210405_109995512 | 3300021171 | Soil | VVLEGENSAHAKPLFAFARKVEARVAEIRATAPESVIQIQ |
Ga0210408_101426921 | 3300021178 | Soil | GENSPHAKSLYDFARKVITRVDEIKSSAGESVIQIQ |
Ga0210385_115567361 | 3300021402 | Soil | PEIGRGGDSGSPAVLKGESSSHAKSLFEFARKVVVRVEEIKATASENVIQIQ |
Ga0210397_107469822 | 3300021403 | Soil | VVLEGENSPHAKSIYEFARNVLARVTEIKANAPANVIQIQ |
Ga0210389_101425922 | 3300021404 | Soil | EGENSPHAKSIYEFARNVVKRSDEIRASAAPSVIQIQ |
Ga0210389_108017191 | 3300021404 | Soil | LQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ |
Ga0210387_113235231 | 3300021405 | Soil | EESSHAKPLYEFARKVVARVEQIRATAPEGVISIQ |
Ga0210383_115557931 | 3300021407 | Soil | GENSPHAKSIYAFARRVLDRVAEIKLNAPGNVIQIQ |
Ga0210394_110705661 | 3300021420 | Soil | GQPVVLEGENSPHAKSLFEFARKVMARVDEIKSAAPASVIQIQ |
Ga0210384_107990101 | 3300021432 | Soil | RKSGDGGKPVVLEGENSAHAKALFAFARKVEARVAEIRATAPESVIQIQ |
Ga0210384_118544031 | 3300021432 | Soil | VLKDVNSPSVKSLYDFARKVVARVTEVKSNAPESVIQIQ |
Ga0210402_118597341 | 3300021478 | Soil | GDSGSPAVLKGEGSSHAKSLFEFARKVVARVEEIKATASENVIQIQ |
Ga0247794_103216291 | 3300024055 | Soil | LAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ |
Ga0207416_11337672 | 3300025134 | Iron-Sulfur Acid Spring | LEGENSSHAKSLFEFARNVIARVSEIKASAGESVIQIQ |
Ga0208691_10362182 | 3300025612 | Peatland | VRKSGDSGKPVVLEGENSAHAKSILEFARRVRARVAEIKASEGASVIQIQ |
Ga0207710_101508552 | 3300025900 | Switchgrass Rhizosphere | IRKASDSGQPTVLAGEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ |
Ga0207685_103887901 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PDIRKASDSGRPTVLAGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ |
Ga0207699_100743703 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PVVLAGEGSAPAKSLYDFARKVVTRVDEIKSAAGESVIQIQ |
Ga0207705_112526751 | 3300025909 | Corn Rhizosphere | LEGETSEHAKSIFAFAHNVKARVEELTATGGGSVISID |
Ga0207684_116395192 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LDGESSPHAKALFEFARRVAERVEQIKSSAPESVIQIQ |
Ga0207695_114874101 | 3300025913 | Corn Rhizosphere | VLDGEGSPHAKSLFDFARKVETRVKEINAAAPESVIQIQ |
Ga0207671_109212771 | 3300025914 | Corn Rhizosphere | DEGKPAVLEGENSPHAKPLFDFARKVAERVGQIRSSAGEGVIQIQ |
Ga0207693_111853452 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PEIRKAGDEGRPAVLEGETSVHAKPLFDFARQVAQRVEEIKSSAPESVIQIQ |
Ga0207649_100197895 | 3300025920 | Corn Rhizosphere | GEGSSSGKSLYDFARRVVTRVDEIKANAGESVIHIQ |
Ga0207646_103213792 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLQGEDSPHAKSLFAFARNVVARVEEIKASSSESVIQIQ |
Ga0207694_107160002 | 3300025924 | Corn Rhizosphere | DPEIRRAGDEGKPAVLEGENSPHAKPLFDFARKVAERVGQIRSSAGEGVIQIQ |
Ga0207700_118377742 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LREAGDSGKPAALAGQDSPVSKSLYDFARKVVARVEEINANASEGVIHVQ |
Ga0207664_107871902 | 3300025929 | Agricultural Soil | KPVVLEGENTPHTKALYDFARKVVARVDEIRSHAPEGVIQIQ |
Ga0207664_114458142 | 3300025929 | Agricultural Soil | VLEGENSLHAKPLFDFARRVAERVDQIRASAPESVIQIQ |
Ga0207664_115746652 | 3300025929 | Agricultural Soil | RKSGDEGKPAVLEGENSPHAKALFDFAHRVVERVEQIKSAAPESVIQIQ |
Ga0207686_115023322 | 3300025934 | Miscanthus Rhizosphere | LEGTESAHAKSLYDFTRKVVSRVDEIEAAAPQGVIQIQ |
Ga0207691_108876342 | 3300025940 | Miscanthus Rhizosphere | ASDSGRPTVLEGTESAHAKSLYDFTRRVVSRVDEIEAAAPQGVIQIQ |
Ga0207667_106953441 | 3300025949 | Corn Rhizosphere | VLEGENSPHAKSIYEFARKVIDRVGEIKANAPAGVIQIQ |
Ga0207703_121751391 | 3300026035 | Switchgrass Rhizosphere | ASDSGTPTVLEGENSAHAKSLYDFANKVVTRVDEIEANAPRGVIQIQ |
Ga0207678_103620071 | 3300026067 | Corn Rhizosphere | PIVIEGEDSAHAKSIYEFARRVVNRVDEIKAAAPQDVIQIQ |
Ga0209350_10873811 | 3300026277 | Grasslands Soil | KAGDGGKPLVLEGENSPSAQSLYEFARKVIARVTEIKAGESEGVIHVQ |
Ga0209471_11959271 | 3300026318 | Soil | EGEDSPHAKSLFEFARRVISRVADIKANAPEGVIQIQ |
Ga0209804_12166012 | 3300026335 | Soil | GQPAVLAGEDAVHAKSLYEFARKVAARVDEIKSSAAESVIHIQ |
Ga0257180_10350292 | 3300026354 | Soil | VLKGEDSPHAKSLFAFARKVVERVDEIKASSSASVVQIQ |
Ga0257160_10493811 | 3300026489 | Soil | VLKGEDSPHAKSLFAVARKVAARVDEIKAGSSESVIQIQ |
Ga0209806_11850672 | 3300026529 | Soil | LVLAGENAPNAKSLYEFARKVVTRVEEIKAAAGEGVIQIQ |
Ga0209577_102507632 | 3300026552 | Soil | GENSPHAKPLFEFARRVVERVEQIKSAAPESVIQIQ |
Ga0209421_11123552 | 3300027432 | Forest Soil | AGEGTASGKSLFDFARKVVARVDEIKANAGESVIQIQ |
Ga0208199_10601302 | 3300027497 | Peatlands Soil | GGSPSVLQGEDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ |
Ga0209523_11111082 | 3300027548 | Forest Soil | GETSPLAKSLYDFTRKVISRVDEIRNSAPEGVIQIQ |
Ga0209733_10322321 | 3300027591 | Forest Soil | GEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ |
Ga0209528_10639592 | 3300027610 | Forest Soil | SGDGGKPVVLEGENSAHAKPLFAFARRVEARVAEIRATAPESVIQIQ |
Ga0209007_10095491 | 3300027652 | Forest Soil | EGENSPHAKSIYEFARNVVTRTTEIRVNAPGSVIQIQ |
Ga0209736_10738181 | 3300027660 | Forest Soil | VELQGRLPEIRKAGDNGKPTVLNGEDYAHAKSLFEFARKVVDRVREITADASESVIQIQ |
Ga0209736_11976911 | 3300027660 | Forest Soil | VLEGESSPHAKSLFDFARNVITRVGEIKSSAGESVIQIQ |
Ga0209328_102388851 | 3300027727 | Forest Soil | VLAGENSASGKSLYDFARKVITRVDQIKSTAGESVIQ |
Ga0209908_100190391 | 3300027745 | Thawing Permafrost | VLEGENSPHAKSMFGFARRVVARVGEIKAGETASVIQIQ |
Ga0209073_104498991 | 3300027765 | Agricultural Soil | GENSPHAKSLFEFARKVADRVQQIRASSGEGVIQIQ |
Ga0209810_11533082 | 3300027773 | Surface Soil | RPAVLEGESSPHAKPLFDFARRVAERVQQIKSAAPEGVVQIQ |
Ga0209656_100477954 | 3300027812 | Bog Forest Soil | GESSAHAKSLFEFARKVVARVGEIKSNQSDSVIQIQ |
Ga0209039_100125926 | 3300027825 | Bog Forest Soil | SVELDAEIRKSGDSGTPSVLQGEDSPHAKSLFAFARKVAARVEEIKAGSSESVIQIQ |
Ga0209274_100704761 | 3300027853 | Soil | RQRQAAVLEGENSSHAKSLYEFARKVIARVEEIKSSAGESVIQIQ |
Ga0209274_105989752 | 3300027853 | Soil | ENSPHAKSLYDFARRVVARVDEIKSNAGESVIQIQ |
Ga0209517_100463935 | 3300027854 | Peatlands Soil | EDSSHAKSLFAFARNVAARVEEIKASSSESVIQIQ |
Ga0209517_101009574 | 3300027854 | Peatlands Soil | EDSPHAKSLFAFARNVAARVEEIKAGSSESVIQIQ |
Ga0209701_100660874 | 3300027862 | Vadose Zone Soil | PEIRKSGDSGAPSVLQGEDSPHAKSLFAFARNVAARVEEIKASSPASVIQIQ |
Ga0209167_100250454 | 3300027867 | Surface Soil | TVLEGEDSPHAKGLFDFARRVVQRTDEIKSQASEGVIQIQ |
Ga0209579_101778481 | 3300027869 | Surface Soil | VLEGENSPHAKSIYQFAQRVVARVGEIKASEPASVIQIQ |
Ga0209579_106578061 | 3300027869 | Surface Soil | GDGGQPMVLAGEGSAPANSLFDFARKVVTRVDEIKSAAGESVIQIQ |
Ga0209283_107471322 | 3300027875 | Vadose Zone Soil | LEGENSPHAKSMYEFARNVIARVGEIKAGEGASVIQIQ |
Ga0209590_100028701 | 3300027882 | Vadose Zone Soil | GDGGQPLVLAGEDFAPAKSLYEFARKVVTRVDEIKSTAGESVIQIQ |
Ga0209275_101100872 | 3300027884 | Soil | TVLEGENSPHAKSLYDFARKVITRVDEIKSSAGESVIQIQ |
Ga0209275_102342121 | 3300027884 | Soil | PVVLEGENSPHAKSIYEFAKNVVTRTAEIRANAPAGVIQIQ |
Ga0209068_105133171 | 3300027894 | Watersheds | GEDSPHAKSLYEFARKVVARVEEIQSSSSEGVIQIQ |
Ga0209488_104731012 | 3300027903 | Vadose Zone Soil | VRKSGDGGKPVVLEGENSPHAKSLFAFARKVIARVDEVKASAPASVIQIQ |
Ga0209698_100680431 | 3300027911 | Watersheds | EGEDSPHAKSLFAFARNVVTRVEEIKAGSSESVIQIQ |
Ga0265357_10303922 | 3300028023 | Rhizosphere | ELDPEVRKAGDGGTPIVMQGENSPHAKSMYAFARNVVTRVDEIKASAPAGVISIQ |
Ga0268265_104506882 | 3300028380 | Switchgrass Rhizosphere | GEGSSSGKSLYDFARKVVTRVDEIKASAGESVIQIQ |
Ga0302206_11436032 | 3300028734 | Fen | GEDAPHAKSLFEFARKVVARVDEIKASSSENVIQIQ |
Ga0302267_103891502 | 3300028745 | Bog | GGTPAVLQGEDSPHAKSLFAFARKVVARVEEIKAGSSESVIQIQ |
Ga0302222_100017921 | 3300028798 | Palsa | ENSPHAKSIFEFARRVAARVGEIKAGESASVISIQ |
Ga0302163_102480131 | 3300028868 | Fen | AVLAGEDSPHAKSLYEFARKVVTRVDEIKASAGEGVIQIQ |
Ga0308309_117880782 | 3300028906 | Soil | VLEGEDSPHAKSIYEFARRVVERVGEIKANAPGNVIQIQ |
Ga0222749_100594603 | 3300029636 | Soil | EGTASGKSLFDFARKVVTRVDEIKANAGESVIQIQ |
Ga0311341_100322961 | 3300029908 | Bog | EDSPHAKSLFAFARKVVARVEEIKAGSSESVIQIQ |
Ga0311371_111022021 | 3300029951 | Palsa | PTVLQGENSSHAKSLFAFAHNVVSRVDEIKAGSSESVIQIQ |
Ga0302150_103506582 | 3300029956 | Bog | ENSPHAKSIFAFARKVVARVGEIKAGETASVISIQ |
Ga0311338_111544152 | 3300030007 | Palsa | PIVMQGESSPHAKSMYAFARNVVTRVDEIKASAPAGVISIQ |
Ga0302300_12273821 | 3300030042 | Palsa | VLEGENSPHAKSIFEFARRVAARVGEIKAGESASVISIQ |
Ga0302195_100907031 | 3300030051 | Bog | GTPAVLQGEDSPHAKSLFAFARKVVARVEEIKAGSSESVIQIQ |
Ga0316363_103945161 | 3300030659 | Peatlands Soil | RQAGDTGKAVVLDGENSPAAKSLYEFARKVVARVDEIKAGASENVIQIQ |
Ga0310039_100411831 | 3300030706 | Peatlands Soil | KAGDGGKPVVLEGETSPHAKSMYAFARKVVERVAEIKSSAPANVIQIQ |
Ga0307482_10304281 | 3300030730 | Hardwood Forest Soil | AVLEGESSPHAKALFEFANRVVDRVEQIKSTAPEGVIQIQ |
Ga0265746_10042701 | 3300030815 | Soil | PEVRKSGDGGKPVVLEGENSPHAKSMYAFARKVLGRVEEIKANAPASVIQIQ |
Ga0170834_1026815342 | 3300031057 | Forest Soil | EVRKSGDGGKPVVLEGENSPHAKSMYAFARKVLARVEEIKANALASVIQIQ |
Ga0170834_1052692031 | 3300031057 | Forest Soil | PEIRKSGDSGSPSVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ |
Ga0170824_1059159562 | 3300031231 | Forest Soil | TVLDGEDSPHAKSLYEFAHKVVTRIAEIKATAGESVIQIQ |
Ga0170824_1087594093 | 3300031231 | Forest Soil | VLQGEDSPHAKSLFAFARNVVARVDEVKASSSESVIQIK |
Ga0302307_101079021 | 3300031233 | Palsa | GSPTVLQGENSSHAKSLFAFAHNVVSRVDEIKAGSSESVIQIQ |
Ga0265325_101305901 | 3300031241 | Rhizosphere | EGEDSAHAKSLFAFARNVVARVEQIKSSSPEGVIQIQ |
Ga0265316_100904501 | 3300031344 | Rhizosphere | LEGENSPHAKSIYDFAKRVIERVGEIKAAAPGNVIQIQ |
Ga0170820_101209392 | 3300031446 | Forest Soil | EGKPAVLEGENSPHAKALFDFARRVVERVEQIKSAAPESVIQIQ |
Ga0302320_109330951 | 3300031524 | Bog | GEDSPHAKSLFAFARKVVARVEEIKAGSSESVIQIQ |
Ga0302326_120571151 | 3300031525 | Palsa | EIRKAGDGGVPAVLQGEDSPHAKSLFEFARNVVARVDEIKASSSESVIQIQ |
Ga0318528_106554881 | 3300031561 | Soil | LEGENSPHAKSIYDFARRVIDRVGEIKANAPGNVIQIQ |
Ga0310686_1043514714 | 3300031708 | Soil | VLEGENSSHAKALYEFARKVIARVDEIKSSAGESVIQIQ |
Ga0310686_1093775111 | 3300031708 | Soil | GDGGKPVVLEGETSLHAKSIYAFARKVLARVEEIKANAPASVIQIQ |
Ga0307469_110679201 | 3300031720 | Hardwood Forest Soil | ALREAGDSGKPVVLEGENSPSAQSLYEFARKVVARVAEIKAAESESVIHVQ |
Ga0307469_111592012 | 3300031720 | Hardwood Forest Soil | EGENSPHAKSIYEFARKVIERVGEIKANAPGNVIQIQ |
Ga0318501_105790221 | 3300031736 | Soil | VLEGENSPHAKSLFDFARRVAARVDEIRASAPTGVIQIQ |
Ga0307468_1001635911 | 3300031740 | Hardwood Forest Soil | PAVLEGEDSPHAKSLFEFARRVVGRVDEIRSHSVDNVIQIQ |
Ga0307475_109987892 | 3300031754 | Hardwood Forest Soil | EDSAHAKSLYEFARKVADRVREITADTPESVIQIQ |
Ga0318536_105701332 | 3300031893 | Soil | PTVLEGENSPHAKSLFDFARRVAARVDEIRASAPTGVIQIQ |
Ga0318551_107994621 | 3300031896 | Soil | VRKSGDGGKPVVLEGENSPHAKSMYEFARKVVDRVGEIKANSPGNVIQIQ |
Ga0306923_101875173 | 3300031910 | Soil | LEGENSPHAKSIYDFARKVVERVSEIKAASPGNVIQIQ |
Ga0306921_103088423 | 3300031912 | Soil | PEVRKSGDGGKPVVLEGENSPHAKSMYEFARKVVDRVGEIKANSPGNVIQIQ |
Ga0306926_112153452 | 3300031954 | Soil | DENSPSVKSLYDFARKVIARVTEIKSTAPESVIQIQ |
Ga0307479_104882912 | 3300031962 | Hardwood Forest Soil | GESSAHAKSLYAFARNVEARVAEIRANAPEGVIQIQ |
Ga0307479_108096312 | 3300031962 | Hardwood Forest Soil | ESSSHAKALFDFAHRVVERVEQIKSAAPEGVIQIQ |
Ga0307479_110063251 | 3300031962 | Hardwood Forest Soil | IRKSGDSGSPSVLQGEDSPHAKSLFAFARNVAARVEEIKASSSESVIQIQ |
Ga0318514_107228462 | 3300032066 | Soil | GGDTGKPTVLEGENSPHAKSLFDFARRVAARVDEIRASAPTGVIQIQ |
Ga0307471_1029542311 | 3300032180 | Hardwood Forest Soil | DSGSPAVLKGEDSPHAKSLFEFARKVVARVEEIKASSSASVVQIH |
Ga0307472_1011228161 | 3300032205 | Hardwood Forest Soil | TVLEGEASPHAKSLYDFARNVIARVDEIKSSAGESVIQIQ |
Ga0307472_1022656351 | 3300032205 | Hardwood Forest Soil | ALAGEDLAAAKSLYEFARKVVTRVDEIKSTAGESVIQIQ |
Ga0348332_143805813 | 3300032515 | Plant Litter | ENSPHAKSIFAFARRVAARVVEIKAGESASVIQIQ |
Ga0335082_110716241 | 3300032782 | Soil | RSGDSGQPAVLKGEADKHAKSLFDFARKVAIRVEEIKSSSPENVIQIQ |
Ga0335079_113897961 | 3300032783 | Soil | VLAGENSPHAKSLYDFTRKVISRVDEIKASAPEGVIQIQ |
Ga0335079_121108682 | 3300032783 | Soil | AVLEGEESQPAKSLYEFARKVVTRVDEIKASAPEGVIQIQ |
Ga0335078_124072691 | 3300032805 | Soil | ENSPHAKSIYDFARKVVERVGEIKASAPGSVIQIQ |
Ga0335080_117286072 | 3300032828 | Soil | DPQLREAGDSGKPVALAGQDSPLAKSLYDFARKVVARVDEINANASTGVIHIQ |
Ga0335070_105107642 | 3300032829 | Soil | EDSPHAKSLFEFARKVAARVDEIKSSSSEGVIQIQ |
Ga0335081_100664791 | 3300032892 | Soil | GKPAVLEGENSPHAKSLFDFARRVAERVEQIKSAAPEGVIQIQ |
Ga0335081_102907501 | 3300032892 | Soil | VLAGEDSRQAKSLYDFTRKVAARVEEIKANAPESVIQIQ |
Ga0335076_112683961 | 3300032955 | Soil | DGGSPTVLQGEESSHAKSLFAFARNVVARVEEIKASSSESVIQIQ |
Ga0335084_106763112 | 3300033004 | Soil | ENSPHAKSIYDFAKRVVERVGEIKAASPGNVIQIQ |
Ga0335077_114436021 | 3300033158 | Soil | GPDSPHAKSLFEFARKVVARVDEIKASAPEGVIQIQ |
Ga0326726_103333312 | 3300033433 | Peat Soil | EDSPHAKSLFAFARKVIARVEEIKASSSEGVIQIQ |
Ga0326726_117592141 | 3300033433 | Peat Soil | SPAVLEGEDSPHAKSLYEFAHRVVARVEEIKSSSSESVIQIQ |
Ga0314867_119091_465_584 | 3300033808 | Peatland | VLEGPDSPHAKSLFEFARKVVARVEEIKASASEGVIQIQ |
Ga0370492_0037815_3_110 | 3300034282 | Untreated Peat Soil | ENSPHAKSIFAFARRVAARVGEIKAGESASVISIQ |
⦗Top⦘ |