Metagenome / Metatranscriptome Family F007823

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F007823
Family Type	Metagenome / Metatranscriptome
Number of Sequences	344
Average Sequence Length	38 residues
Representative Sequence	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKE
Number of Associated Samples	199
Number of Associated Scaffolds	344

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	81.42 %
% of genes near scaffold ends (potentially truncated)	15.70 %
% of genes from short scaffolds (< 2000 bps)	76.74 %
Associated GOLD sequencing projects	165
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (75.872 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.593 % of family members)
Environment Ontology (ENVO)	Unclassified (47.674 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (56.105 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.44% β-sheet: 0.00% Coil/Unstructured: 51.56%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 344 Family Scaffolds
PF05559	DUF763	28.49
PF00903	Glyoxalase	6.10
PF08487	VIT	6.10
PF00488	MutS_V	4.36
PF12681	Glyoxalase_2	2.62
PF04234	CopC	2.33
PF00691	OmpA	1.74
PF07883	Cupin_2	1.74
PF13768	VWA_3	1.45
PF05192	MutS_III	1.45
PF05096	Glu_cyclase_2	1.16
PF02441	Flavoprotein	0.87
PF02633	Creatininase	0.87
PF02368	Big_2	0.87
PF00905	Transpeptidase	0.87
PF00498	FHA	0.58
PF13649	Methyltransf_25	0.58
PF03476	MOSC_N	0.29
PF01408	GFO_IDH_MocA	0.29
PF02563	Poly_export	0.29
PF13414	TPR_11	0.29
PF13787	HXXEE	0.29
PF11992	TgpA_N	0.29
PF02190	LON_substr_bdg	0.29
PF01381	HTH_3	0.29
PF00797	Acetyltransf_2	0.29
PF13424	TPR_12	0.29
PF08352	oligo_HPY	0.29
PF00484	Pro_CA	0.29
PF12704	MacB_PCD	0.29
PF12850	Metallophos_2	0.29
PF00884	Sulfatase	0.29
PF01855	POR_N	0.29
PF05190	MutS_IV	0.29
PF12606	RELT	0.29
PF03734	YkuD	0.29
PF08808	RES	0.29
PF13672	PP2C_2	0.29
PF00106	adh_short	0.29
PF05532	CsbD	0.29
PF17164	DUF5122	0.29
PF02390	Methyltransf_4	0.29
PF08281	Sigma70_r4_2	0.29
PF12680	SnoaL_2	0.29
PF00571	CBS	0.29
PF11937	DUF3455	0.29
PF10236	DAP3	0.29
PF01243	Putative_PNPOx	0.29
PF03824	NicO	0.29
PF00041	fn3	0.29
PF13701	DDE_Tnp_1_4	0.29
PF08309	LVIVD	0.29
PF02371	Transposase_20	0.29
PF01842	ACT	0.29
PF14903	WG_beta_rep	0.29
PF10531	SLBB	0.29

COG ID	Name	Functional Category	% Frequency in 344 Family Scaffolds
COG1415	Uncharacterized conserved protein, DUF763 domain	Function unknown [S]	28.49
COG0249	DNA mismatch repair ATPase MutS	Replication, recombination and repair [L]	6.10
COG1193	dsDNA-specific endonuclease/ATPase MutS2	Replication, recombination and repair [L]	4.36
COG2372	Copper-binding protein CopC (methionine-rich)	Inorganic ion transport and metabolism [P]	2.33
COG3823	Glutamine cyclotransferase	Posttranslational modification, protein turnover, chaperones [O]	1.16
COG1402	Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)	Coenzyme transport and metabolism [H]	0.87
COG0030	16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)	Translation, ribosomal structure and biogenesis [J]	0.29
COG0220	tRNA G46 N7-methylase TrmB	Translation, ribosomal structure and biogenesis [J]	0.29
COG0288	Carbonic anhydrase	Inorganic ion transport and metabolism [P]	0.29
COG0674	Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.29
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.29
COG1596	Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold	Cell wall/membrane/envelope biogenesis [M]	0.29
COG2162	Arylamine N-acetyltransferase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.29
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.29
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.29
COG3217	N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain	Defense mechanisms [V]	0.29
COG3237	Uncharacterized conserved protein YjbJ, UPF0337 family	Function unknown [S]	0.29
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.29
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	0.29
COG4231	TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.29
COG5276	Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain	Function unknown [S]	0.29
COG5654	Predicted toxin component of a toxin-antitoxin system, contains RES domain	Defense mechanisms [V]	0.29

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	75.87 %
Unclassified	root	N/A	24.13 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	75.87 %
Unclassified	root	N/A	24.13 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	75.87 %
Unclassified	root	N/A	24.13 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	35.76 %
Unclassified	root	N/A	24.13 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.91 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.74 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.29 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	0.29 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.29 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.29 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.13 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	18.02 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	3.20 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.45 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	1.45 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.45 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	0.29 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	0.29 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.29 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.29 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.29 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.29 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.29 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.13 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	18.02 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	1.45 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	1.45 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1.45 %
Leptospirales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales	0.29 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	0.29 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.29 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.29 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.29 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.29 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.29 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.29 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.87 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.13 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	18.02 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	1.45 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.45 %
Oscillatoriophycideae	subclass	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae	1.16 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	0.29 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.29 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.29 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.29 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.29 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.29 %
Leptospiraceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae	0.29 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.29 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.87 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.13 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	18.02 %
Pyrinomonas	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas	1.45 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.45 %
Noviherbaspirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum	0.29 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.29 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.29 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	0.29 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.29 %
Nitrospira	genus	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	0.29 %
Leptospira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira	0.29 %
Chroococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales	0.29 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.29 %
Oscillatoriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales	0.87 %
Sinorhizobium/Ensifer group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group	0.87 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.13 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	18.02 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1.45 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.45 %
Sphingomonas crusticola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola	0.29 %
unclassified Nitrospira	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira	0.29 %
Noviherbaspirillum saxi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum saxi	0.29 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	0.29 %
Leptospira alexanderi	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira alexanderi	0.29 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.29 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.29 %
Chroococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales	0.29 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.29 %
Ensifer	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer	0.87 %
Microcoleaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae	0.87 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.13 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	18.02 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1.45 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.45 %
Nitrospira sp.	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	0.29 %
Sphingomonas crusticola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola	0.29 %
Noviherbaspirillum saxi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum saxi	0.29 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	0.29 %
Leptospira alexanderi	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira alexanderi	0.29 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.29 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.29 %
Chroococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales	0.29 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.29 %
Microcoleus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus	0.87 %
Ensifer	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer	0.87 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	24.13 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	18.02 %
Pyrinomonas methylaliphatogenes	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	1.45 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1.45 %
Nitrospira sp.	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	0.29 %
Sphingomonas crusticola	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola	0.29 %
Noviherbaspirillum saxi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum saxi	0.29 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	0.29 %
Leptospira alexanderi	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira alexanderi	0.29 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.29 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.29 %
Chroococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales	0.29 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	0.29 %
Microcoleus asticus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus asticus	0.87 %
Ensifer	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer	0.87 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.87 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_17173207	All Organisms → cellular organisms → Bacteria	12090	Open in IMG/M
2162886012\|MBSR1b_contig_10022502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer	1269	Open in IMG/M
2228664021\|ICCgaii200_c0635850	All Organisms → cellular organisms → Bacteria	827	Open in IMG/M
2228664022\|INPgaii200_c0900617	Not Available	666	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c0564004	All Organisms → cellular organisms → Bacteria → Acidobacteria	777	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c2031586	Not Available	640	Open in IMG/M
3300000363\|ICChiseqgaiiFebDRAFT_11097889	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	1292	Open in IMG/M
3300000531\|CNBas_1005611	Not Available	720	Open in IMG/M
3300000532\|CNAas_1000200	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5549	Open in IMG/M
3300000559\|F14TC_100538703	Not Available	1602	Open in IMG/M
3300000787\|JGI11643J11755_11650584	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales	969	Open in IMG/M
3300000891\|JGI10214J12806_11671066	All Organisms → cellular organisms → Bacteria	2631	Open in IMG/M
3300000953\|JGI11615J12901_10053053	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300000953\|JGI11615J12901_11743929	All Organisms → cellular organisms → Bacteria → Acidobacteria	822	Open in IMG/M
3300000953\|JGI11615J12901_12001664	Not Available	523	Open in IMG/M
3300000955\|JGI1027J12803_101383935	All Organisms → cellular organisms → Bacteria	851	Open in IMG/M
3300000956\|JGI10216J12902_101566329	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	4277	Open in IMG/M
3300000956\|JGI10216J12902_102901852	All Organisms → cellular organisms → Bacteria → Acidobacteria	1522	Open in IMG/M
3300000956\|JGI10216J12902_107802608	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1726	Open in IMG/M
3300000956\|JGI10216J12902_118849356	Not Available	865	Open in IMG/M
3300001139\|JGI10220J13317_10231341	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	629	Open in IMG/M
3300001139\|JGI10220J13317_11461298	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	509	Open in IMG/M
3300001157\|JGI12686J13345_100605	All Organisms → cellular organisms → Bacteria	4748	Open in IMG/M
3300003267\|soilL1_10170566	All Organisms → cellular organisms → Bacteria	1130	Open in IMG/M
3300003999\|Ga0055469_10104292	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	819	Open in IMG/M
3300004016\|Ga0058689_10107884	Not Available	597	Open in IMG/M
3300004114\|Ga0062593_101888258	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300004156\|Ga0062589_101305000	Not Available	702	Open in IMG/M
3300005093\|Ga0062594_100246396	All Organisms → cellular organisms → Bacteria	1302	Open in IMG/M
3300005280\|Ga0065696_1439520	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	511	Open in IMG/M
3300005328\|Ga0070676_10534031	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	837	Open in IMG/M
3300005345\|Ga0070692_10019049	All Organisms → cellular organisms → Bacteria	3309	Open in IMG/M
3300005364\|Ga0070673_100131409	All Organisms → cellular organisms → Bacteria → Acidobacteria	2101	Open in IMG/M
3300005444\|Ga0070694_100012608	All Organisms → cellular organisms → Bacteria	5261	Open in IMG/M
3300005459\|Ga0068867_100064237	All Organisms → cellular organisms → Bacteria → Acidobacteria	2729	Open in IMG/M
3300005467\|Ga0070706_100681115	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	954	Open in IMG/M
3300005471\|Ga0070698_102048257	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	526	Open in IMG/M
3300005539\|Ga0068853_100448420	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer	1213	Open in IMG/M
3300005543\|Ga0070672_100655123	Not Available	917	Open in IMG/M
3300005543\|Ga0070672_101180971	Not Available	681	Open in IMG/M
3300005543\|Ga0070672_101256729	Not Available	660	Open in IMG/M
3300005549\|Ga0070704_101200488	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	692	Open in IMG/M
3300005564\|Ga0070664_100224728	All Organisms → cellular organisms → Bacteria	1681	Open in IMG/M
3300005564\|Ga0070664_100423198	All Organisms → cellular organisms → Bacteria	1220	Open in IMG/M
3300005564\|Ga0070664_100540763	All Organisms → cellular organisms → Bacteria → Acidobacteria	1077	Open in IMG/M
3300005566\|Ga0066693_10241057	All Organisms → cellular organisms → Bacteria	714	Open in IMG/M
3300005577\|Ga0068857_100210020	All Organisms → cellular organisms → Bacteria	1776	Open in IMG/M
3300005577\|Ga0068857_100604556	All Organisms → cellular organisms → Bacteria	1037	Open in IMG/M
3300005577\|Ga0068857_101170620	Not Available	744	Open in IMG/M
3300005577\|Ga0068857_101897557	Not Available	584	Open in IMG/M
3300005577\|Ga0068857_102558995	Not Available	501	Open in IMG/M
3300005578\|Ga0068854_100818808	Not Available	813	Open in IMG/M
3300005578\|Ga0068854_101207881	Not Available	678	Open in IMG/M
3300005578\|Ga0068854_101824025	Not Available	558	Open in IMG/M
3300005616\|Ga0068852_100969099	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	869	Open in IMG/M
3300005617\|Ga0068859_100018701	All Organisms → cellular organisms → Bacteria	6962	Open in IMG/M
3300005617\|Ga0068859_100155962	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2360	Open in IMG/M
3300005617\|Ga0068859_100180533	All Organisms → cellular organisms → Bacteria	2193	Open in IMG/M
3300005617\|Ga0068859_100333077	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1612	Open in IMG/M
3300005617\|Ga0068859_100405734	All Organisms → cellular organisms → Bacteria → Proteobacteria	1459	Open in IMG/M
3300005617\|Ga0068859_101605306	All Organisms → cellular organisms → Bacteria	718	Open in IMG/M
3300005617\|Ga0068859_102012007	Not Available	638	Open in IMG/M
3300005618\|Ga0068864_100031523	All Organisms → cellular organisms → Bacteria → Acidobacteria	4498	Open in IMG/M
3300005618\|Ga0068864_100087467	All Organisms → cellular organisms → Bacteria → Acidobacteria	2743	Open in IMG/M
3300005618\|Ga0068864_102060156	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	577	Open in IMG/M
3300005718\|Ga0068866_10561669	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	765	Open in IMG/M
3300005719\|Ga0068861_100002001	All Organisms → cellular organisms → Bacteria	13180	Open in IMG/M
3300005719\|Ga0068861_100048586	All Organisms → cellular organisms → Bacteria	3208	Open in IMG/M
3300005719\|Ga0068861_100684684	All Organisms → cellular organisms → Bacteria	951	Open in IMG/M
3300005834\|Ga0068851_10635284	Not Available	652	Open in IMG/M
3300005840\|Ga0068870_10138264	All Organisms → cellular organisms → Bacteria	1422	Open in IMG/M
3300005841\|Ga0068863_100850774	All Organisms → cellular organisms → Bacteria	911	Open in IMG/M
3300005843\|Ga0068860_100018636	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	6750	Open in IMG/M
3300005843\|Ga0068860_101727418	All Organisms → cellular organisms → Bacteria → Acidobacteria	648	Open in IMG/M
3300005844\|Ga0068862_100006048	All Organisms → cellular organisms → Bacteria	10078	Open in IMG/M
3300005844\|Ga0068862_100289391	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1504	Open in IMG/M
3300005844\|Ga0068862_100541268	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1111	Open in IMG/M
3300005844\|Ga0068862_101207125	All Organisms → cellular organisms → Bacteria → Acidobacteria	755	Open in IMG/M
3300005844\|Ga0068862_101348337	All Organisms → cellular organisms → Bacteria	716	Open in IMG/M
3300005875\|Ga0075293_1000594	All Organisms → cellular organisms → Bacteria	2451	Open in IMG/M
3300005985\|Ga0081539_10012371	All Organisms → cellular organisms → Bacteria	6584	Open in IMG/M
3300006049\|Ga0075417_10534208	Not Available	592	Open in IMG/M
3300006169\|Ga0082029_1037318	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	634	Open in IMG/M
3300006169\|Ga0082029_1062544	All Organisms → cellular organisms → Bacteria	1259	Open in IMG/M
3300006169\|Ga0082029_1154053	All Organisms → cellular organisms → Bacteria	1718	Open in IMG/M
3300006169\|Ga0082029_1222854	All Organisms → cellular organisms → Bacteria → Acidobacteria	26632	Open in IMG/M
3300006169\|Ga0082029_1733431	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	867	Open in IMG/M
3300006169\|Ga0082029_1777827	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	960	Open in IMG/M
3300006173\|Ga0070716_100470133	All Organisms → cellular organisms → Bacteria	921	Open in IMG/M
3300006173\|Ga0070716_100910850	Not Available	689	Open in IMG/M
3300006358\|Ga0068871_101829734	Not Available	577	Open in IMG/M
3300006755\|Ga0079222_10397701	Not Available	957	Open in IMG/M
3300006755\|Ga0079222_10477382	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300006755\|Ga0079222_11180800	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	683	Open in IMG/M
3300006794\|Ga0066658_10318572	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300006796\|Ga0066665_10360083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum saxi	1190	Open in IMG/M
3300006844\|Ga0075428_100123419	All Organisms → cellular organisms → Bacteria	2819	Open in IMG/M
3300006844\|Ga0075428_100551229	All Organisms → cellular organisms → Bacteria	1232	Open in IMG/M
3300006844\|Ga0075428_102300417	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300006844\|Ga0075428_102404403	All Organisms → cellular organisms → Bacteria → Acidobacteria	541	Open in IMG/M
3300006852\|Ga0075433_10019581	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	5642	Open in IMG/M
3300006852\|Ga0075433_10118106	All Organisms → cellular organisms → Bacteria → Acidobacteria	2354	Open in IMG/M
3300006852\|Ga0075433_11355902	All Organisms → cellular organisms → Bacteria	616	Open in IMG/M
3300006854\|Ga0075425_100109862	All Organisms → cellular organisms → Bacteria	3142	Open in IMG/M
3300006854\|Ga0075425_100741164	All Organisms → cellular organisms → Bacteria	1127	Open in IMG/M
3300006871\|Ga0075434_100100060	All Organisms → cellular organisms → Bacteria	2905	Open in IMG/M
3300006871\|Ga0075434_100203370	All Organisms → cellular organisms → Bacteria	2001	Open in IMG/M
3300006876\|Ga0079217_10000511	All Organisms → cellular organisms → Bacteria	9805	Open in IMG/M
3300006876\|Ga0079217_10031723	All Organisms → cellular organisms → Bacteria → Acidobacteria	1979	Open in IMG/M
3300006876\|Ga0079217_10039222	All Organisms → cellular organisms → Bacteria → Acidobacteria	1832	Open in IMG/M
3300006876\|Ga0079217_10278110	All Organisms → cellular organisms → Bacteria	912	Open in IMG/M
3300006876\|Ga0079217_11410388	All Organisms → cellular organisms → Bacteria	545	Open in IMG/M
3300006876\|Ga0079217_11456335	Not Available	539	Open in IMG/M
3300006876\|Ga0079217_11652117	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	513	Open in IMG/M
3300006894\|Ga0079215_10131636	All Organisms → cellular organisms → Bacteria	1161	Open in IMG/M
3300006894\|Ga0079215_10662184	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	696	Open in IMG/M
3300006904\|Ga0075424_101800880	Not Available	648	Open in IMG/M
3300006918\|Ga0079216_10638091	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	743	Open in IMG/M
3300006918\|Ga0079216_10819494	All Organisms → cellular organisms → Bacteria	687	Open in IMG/M
3300006969\|Ga0075419_11120356	Not Available	577	Open in IMG/M
3300007004\|Ga0079218_10050716	All Organisms → cellular organisms → Bacteria → Acidobacteria	2576	Open in IMG/M
3300007004\|Ga0079218_12419945	All Organisms → cellular organisms → Bacteria	618	Open in IMG/M
3300009012\|Ga0066710_100077779	All Organisms → cellular organisms → Bacteria	4304	Open in IMG/M
3300009038\|Ga0099829_10199158	All Organisms → cellular organisms → Bacteria → Proteobacteria	1620	Open in IMG/M
3300009092\|Ga0105250_10068078	All Organisms → cellular organisms → Bacteria	1437	Open in IMG/M
3300009094\|Ga0111539_10003278	All Organisms → cellular organisms → Bacteria → Acidobacteria	21398	Open in IMG/M
3300009098\|Ga0105245_10497956	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1234	Open in IMG/M
3300009098\|Ga0105245_11280246	All Organisms → cellular organisms → Bacteria	782	Open in IMG/M
3300009098\|Ga0105245_11429261	Not Available	742	Open in IMG/M
3300009098\|Ga0105245_13059175	Not Available	518	Open in IMG/M
3300009100\|Ga0075418_10110884	All Organisms → cellular organisms → Bacteria	2914	Open in IMG/M
3300009100\|Ga0075418_10229141	All Organisms → cellular organisms → Bacteria	1978	Open in IMG/M
3300009100\|Ga0075418_10546136	All Organisms → cellular organisms → Bacteria	1245	Open in IMG/M
3300009100\|Ga0075418_11450744	All Organisms → cellular organisms → Bacteria	745	Open in IMG/M
3300009100\|Ga0075418_12924875	Not Available	521	Open in IMG/M
3300009101\|Ga0105247_10294560	All Organisms → cellular organisms → Bacteria	1124	Open in IMG/M
3300009101\|Ga0105247_10916756	Not Available	678	Open in IMG/M
3300009147\|Ga0114129_10100078	All Organisms → cellular organisms → Bacteria → Proteobacteria	4011	Open in IMG/M
3300009147\|Ga0114129_10182813	All Organisms → cellular organisms → Bacteria	2852	Open in IMG/M
3300009147\|Ga0114129_10265812	All Organisms → cellular organisms → Bacteria	2297	Open in IMG/M
3300009147\|Ga0114129_11106094	Not Available	992	Open in IMG/M
3300009147\|Ga0114129_12144874	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus asticus	673	Open in IMG/M
3300009147\|Ga0114129_12511518	Not Available	616	Open in IMG/M
3300009148\|Ga0105243_10738159	All Organisms → cellular organisms → Bacteria	964	Open in IMG/M
3300009148\|Ga0105243_10772889	All Organisms → cellular organisms → Bacteria	944	Open in IMG/M
3300009148\|Ga0105243_11393052	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus asticus	721	Open in IMG/M
3300009148\|Ga0105243_12490511	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	556	Open in IMG/M
3300009148\|Ga0105243_12734491	Not Available	534	Open in IMG/M
3300009162\|Ga0075423_12520200	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	561	Open in IMG/M
3300009553\|Ga0105249_10808614	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1002	Open in IMG/M
3300009553\|Ga0105249_11391701	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300009553\|Ga0105249_11861881	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	674	Open in IMG/M
3300009553\|Ga0105249_13215381	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	525	Open in IMG/M
3300009789\|Ga0126307_10767604	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	778	Open in IMG/M
3300009789\|Ga0126307_11174394	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	621	Open in IMG/M
3300009789\|Ga0126307_11364100	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300009789\|Ga0126307_11739920	Not Available	507	Open in IMG/M
3300009792\|Ga0126374_10904606	Not Available	684	Open in IMG/M
3300009840\|Ga0126313_11319775	All Organisms → cellular organisms → Bacteria → Acidobacteria	597	Open in IMG/M
3300010036\|Ga0126305_10039056	All Organisms → cellular organisms → Bacteria → Acidobacteria	2636	Open in IMG/M
3300010036\|Ga0126305_10220912	All Organisms → cellular organisms → Bacteria	1208	Open in IMG/M
3300010036\|Ga0126305_10376336	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	933	Open in IMG/M
3300010036\|Ga0126305_10688066	Not Available	691	Open in IMG/M
3300010038\|Ga0126315_10001770	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	8669	Open in IMG/M
3300010038\|Ga0126315_10166238	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1314	Open in IMG/M
3300010040\|Ga0126308_11234266	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300010040\|Ga0126308_11341667	Not Available	508	Open in IMG/M
3300010042\|Ga0126314_10381130	All Organisms → cellular organisms → Bacteria	1014	Open in IMG/M
3300010042\|Ga0126314_10640707	All Organisms → cellular organisms → Bacteria	777	Open in IMG/M
3300010044\|Ga0126310_10137308	All Organisms → cellular organisms → Bacteria	1539	Open in IMG/M
3300010044\|Ga0126310_11723748	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	521	Open in IMG/M
3300010045\|Ga0126311_10326292	All Organisms → cellular organisms → Bacteria	1163	Open in IMG/M
3300010045\|Ga0126311_10798343	Not Available	761	Open in IMG/M
3300010045\|Ga0126311_11852892	Not Available	512	Open in IMG/M
3300010046\|Ga0126384_11063809	Not Available	740	Open in IMG/M
3300010047\|Ga0126382_10292890	All Organisms → cellular organisms → Bacteria	1218	Open in IMG/M
3300010359\|Ga0126376_10000554	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	18496	Open in IMG/M
3300010359\|Ga0126376_10006717	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	6952	Open in IMG/M
3300010359\|Ga0126376_10084526	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2371	Open in IMG/M
3300010359\|Ga0126376_10133813	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1957	Open in IMG/M
3300010359\|Ga0126376_10791425	Not Available	925	Open in IMG/M
3300010364\|Ga0134066_10387707	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300010373\|Ga0134128_12080684	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300010373\|Ga0134128_12495718	Not Available	570	Open in IMG/M
3300010375\|Ga0105239_10424062	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1507	Open in IMG/M
3300010396\|Ga0134126_12146011	Not Available	610	Open in IMG/M
3300010399\|Ga0134127_10055926	All Organisms → cellular organisms → Bacteria → Proteobacteria	3286	Open in IMG/M
3300010399\|Ga0134127_11646741	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	716	Open in IMG/M
3300010399\|Ga0134127_13043966	Not Available	547	Open in IMG/M
3300010400\|Ga0134122_10534373	All Organisms → cellular organisms → Bacteria → Acidobacteria	1069	Open in IMG/M
3300010400\|Ga0134122_11448633	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	703	Open in IMG/M
3300010401\|Ga0134121_10000922	All Organisms → cellular organisms → Bacteria → Acidobacteria	29866	Open in IMG/M
3300010401\|Ga0134121_10249083	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer	1554	Open in IMG/M
3300010401\|Ga0134121_11036347	All Organisms → cellular organisms → Bacteria	808	Open in IMG/M
3300010401\|Ga0134121_12448154	Not Available	563	Open in IMG/M
3300010403\|Ga0134123_10366496	All Organisms → cellular organisms → Bacteria	1307	Open in IMG/M
3300010403\|Ga0134123_10483661	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1160	Open in IMG/M
3300010403\|Ga0134123_10531238	All Organisms → cellular organisms → Bacteria	1114	Open in IMG/M
3300010403\|Ga0134123_10977504	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	860	Open in IMG/M
3300011333\|Ga0127502_10844411	Not Available	512	Open in IMG/M
3300011993\|Ga0120182_1021128	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300012015\|Ga0120187_1002766	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300012022\|Ga0120191_10124959	All Organisms → cellular organisms → Bacteria	561	Open in IMG/M
3300012045\|Ga0136623_10000398	All Organisms → cellular organisms → Bacteria → Acidobacteria	12724	Open in IMG/M
3300012210\|Ga0137378_10803843	Not Available	853	Open in IMG/M
3300012360\|Ga0137375_10134062	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2449	Open in IMG/M
3300012474\|Ga0157356_1017005	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300012684\|Ga0136614_10016328	All Organisms → cellular organisms → Bacteria → Acidobacteria	5374	Open in IMG/M
3300012923\|Ga0137359_10034555	All Organisms → cellular organisms → Bacteria → Acidobacteria	4354	Open in IMG/M
3300012929\|Ga0137404_10000948	All Organisms → cellular organisms → Bacteria	19127	Open in IMG/M
3300012929\|Ga0137404_11215927	Not Available	693	Open in IMG/M
3300012957\|Ga0164303_10160896	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1200	Open in IMG/M
3300013100\|Ga0157373_10727160	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	728	Open in IMG/M
3300013102\|Ga0157371_10775797	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	721	Open in IMG/M
3300013296\|Ga0157374_10973286	All Organisms → cellular organisms → Bacteria	867	Open in IMG/M
3300013296\|Ga0157374_12575328	Not Available	536	Open in IMG/M
3300013297\|Ga0157378_10661240	Not Available	1061	Open in IMG/M
3300013306\|Ga0163162_10952095	Not Available	970	Open in IMG/M
3300013306\|Ga0163162_11676660	Not Available	726	Open in IMG/M
3300013307\|Ga0157372_11804270	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	703	Open in IMG/M
3300013760\|Ga0120188_1020240	All Organisms → cellular organisms → Bacteria	690	Open in IMG/M
3300013760\|Ga0120188_1030713	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	615	Open in IMG/M
3300014487\|Ga0182000_10426092	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	596	Open in IMG/M
3300014487\|Ga0182000_10542847	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	550	Open in IMG/M
3300014969\|Ga0157376_11644546	Not Available	677	Open in IMG/M
3300015262\|Ga0182007_10197800	Not Available	701	Open in IMG/M
3300015371\|Ga0132258_10048200	All Organisms → cellular organisms → Bacteria	9727	Open in IMG/M
3300015371\|Ga0132258_10346687	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	3670	Open in IMG/M
3300015371\|Ga0132258_10855222	All Organisms → cellular organisms → Bacteria → Acidobacteria	2295	Open in IMG/M
3300015373\|Ga0132257_103286767	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	589	Open in IMG/M
3300015374\|Ga0132255_100044932	All Organisms → cellular organisms → Bacteria → Acidobacteria	5708	Open in IMG/M
3300015374\|Ga0132255_100064237	All Organisms → cellular organisms → Bacteria	4846	Open in IMG/M
3300018422\|Ga0190265_10468625	All Organisms → cellular organisms → Bacteria	1368	Open in IMG/M
3300018422\|Ga0190265_10893300	Not Available	1011	Open in IMG/M
3300018422\|Ga0190265_11753797	All Organisms → cellular organisms → Bacteria → Acidobacteria	730	Open in IMG/M
3300018429\|Ga0190272_12524442	Not Available	560	Open in IMG/M
3300018469\|Ga0190270_10726471	Not Available	989	Open in IMG/M
3300018469\|Ga0190270_11338673	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	760	Open in IMG/M
3300018469\|Ga0190270_13110302	Not Available	525	Open in IMG/M
3300018476\|Ga0190274_10418354	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1307	Open in IMG/M
3300018476\|Ga0190274_13369659	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	539	Open in IMG/M
3300019360\|Ga0187894_10000688	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	45530	Open in IMG/M
3300019458\|Ga0187892_10027826	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	4795	Open in IMG/M
3300020003\|Ga0193739_1024610	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1569	Open in IMG/M
3300020146\|Ga0196977_1004267	All Organisms → cellular organisms → Bacteria → Acidobacteria	3994	Open in IMG/M
3300024179\|Ga0247695_1002257	All Organisms → cellular organisms → Bacteria	2800	Open in IMG/M
3300025567\|Ga0210076_1133257	Not Available	541	Open in IMG/M
3300025893\|Ga0207682_10355017	All Organisms → cellular organisms → Bacteria → Acidobacteria	691	Open in IMG/M
3300025900\|Ga0207710_10000609	All Organisms → cellular organisms → Bacteria	20923	Open in IMG/M
3300025900\|Ga0207710_10060510	All Organisms → cellular organisms → Bacteria	1717	Open in IMG/M
3300025904\|Ga0207647_10006263	All Organisms → cellular organisms → Bacteria → Acidobacteria	8666	Open in IMG/M
3300025904\|Ga0207647_10152475	Not Available	1350	Open in IMG/M
3300025904\|Ga0207647_10239845	All Organisms → cellular organisms → Bacteria → Acidobacteria	1041	Open in IMG/M
3300025906\|Ga0207699_11085854	Not Available	592	Open in IMG/M
3300025907\|Ga0207645_10231540	All Organisms → cellular organisms → Bacteria	1220	Open in IMG/M
3300025907\|Ga0207645_10595877	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	750	Open in IMG/M
3300025907\|Ga0207645_10687588	Not Available	695	Open in IMG/M
3300025908\|Ga0207643_10001777	All Organisms → cellular organisms → Bacteria	12034	Open in IMG/M
3300025908\|Ga0207643_10256660	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1078	Open in IMG/M
3300025911\|Ga0207654_10149629	All Organisms → cellular organisms → Bacteria	1497	Open in IMG/M
3300025911\|Ga0207654_10160926	All Organisms → cellular organisms → Bacteria	1450	Open in IMG/M
3300025913\|Ga0207695_10360764	All Organisms → cellular organisms → Bacteria	1340	Open in IMG/M
3300025923\|Ga0207681_10044463	All Organisms → cellular organisms → Bacteria	2976	Open in IMG/M
3300025923\|Ga0207681_10721248	All Organisms → cellular organisms → Bacteria	830	Open in IMG/M
3300025924\|Ga0207694_10002866	All Organisms → cellular organisms → Bacteria	13882	Open in IMG/M
3300025925\|Ga0207650_10000027	All Organisms → cellular organisms → Bacteria	257466	Open in IMG/M
3300025925\|Ga0207650_10143170	Not Available	1881	Open in IMG/M
3300025925\|Ga0207650_10715410	All Organisms → cellular organisms → Bacteria → Acidobacteria	846	Open in IMG/M
3300025925\|Ga0207650_11064435	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	688	Open in IMG/M
3300025932\|Ga0207690_10129872	All Organisms → cellular organisms → Bacteria	1843	Open in IMG/M
3300025935\|Ga0207709_10005466	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	7217	Open in IMG/M
3300025935\|Ga0207709_10831353	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	747	Open in IMG/M
3300025935\|Ga0207709_11405353	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Microcoleus → Microcoleus asticus	578	Open in IMG/M
3300025936\|Ga0207670_10000316	All Organisms → cellular organisms → Bacteria → Acidobacteria	28993	Open in IMG/M
3300025938\|Ga0207704_10736025	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	819	Open in IMG/M
3300025939\|Ga0207665_10934212	Not Available	689	Open in IMG/M
3300025940\|Ga0207691_11056236	Not Available	677	Open in IMG/M
3300025942\|Ga0207689_10275450	All Organisms → cellular organisms → Bacteria → Acidobacteria	1393	Open in IMG/M
3300025945\|Ga0207679_10411651	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1191	Open in IMG/M
3300025945\|Ga0207679_10579052	All Organisms → cellular organisms → Bacteria	1010	Open in IMG/M
3300025945\|Ga0207679_11579926	Not Available	601	Open in IMG/M
3300025949\|Ga0207667_11468439	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300025960\|Ga0207651_12136559	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300025961\|Ga0207712_10405427	All Organisms → cellular organisms → Bacteria	1147	Open in IMG/M
3300025971\|Ga0210102_1065637	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.	783	Open in IMG/M
3300025981\|Ga0207640_10057186	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2564	Open in IMG/M
3300026023\|Ga0207677_10312685	All Organisms → cellular organisms → Bacteria → Acidobacteria	1302	Open in IMG/M
3300026071\|Ga0208537_1018665	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300026075\|Ga0207708_12058765	Not Available	500	Open in IMG/M
3300026088\|Ga0207641_10581761	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1094	Open in IMG/M
3300026088\|Ga0207641_12548720	Not Available	509	Open in IMG/M
3300026089\|Ga0207648_10094751	All Organisms → cellular organisms → Bacteria → Acidobacteria	2611	Open in IMG/M
3300026089\|Ga0207648_10212985	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1715	Open in IMG/M
3300026089\|Ga0207648_10987569	All Organisms → cellular organisms → Bacteria	788	Open in IMG/M
3300026089\|Ga0207648_11732115	Not Available	586	Open in IMG/M
3300026095\|Ga0207676_10991644	All Organisms → cellular organisms → Bacteria	827	Open in IMG/M
3300026116\|Ga0207674_10568232	All Organisms → cellular organisms → Bacteria	1095	Open in IMG/M
3300026116\|Ga0207674_10603794	All Organisms → cellular organisms → Bacteria	1060	Open in IMG/M
3300026118\|Ga0207675_100180776	All Organisms → cellular organisms → Bacteria	2019	Open in IMG/M
3300026312\|Ga0209153_1031598	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1811	Open in IMG/M
3300026377\|Ga0257171_1032751	Not Available	890	Open in IMG/M
3300026535\|Ga0256867_10005522	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	5524	Open in IMG/M
3300026538\|Ga0209056_10129556	All Organisms → cellular organisms → Bacteria	1982	Open in IMG/M
3300027266\|Ga0209215_1000127	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes	22820	Open in IMG/M
3300027530\|Ga0209216_1000012	All Organisms → cellular organisms → Bacteria	165233	Open in IMG/M
3300027637\|Ga0209818_1001011	All Organisms → cellular organisms → Bacteria	5839	Open in IMG/M
3300027637\|Ga0209818_1023946	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1347	Open in IMG/M
3300027637\|Ga0209818_1146296	Not Available	660	Open in IMG/M
3300027639\|Ga0209387_1251391	Not Available	504	Open in IMG/M
3300027691\|Ga0209485_1045870	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1107	Open in IMG/M
3300027775\|Ga0209177_10452115	Not Available	526	Open in IMG/M
3300027873\|Ga0209814_10290350	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira alexanderi	711	Open in IMG/M
3300027880\|Ga0209481_10045589	All Organisms → cellular organisms → Bacteria	2020	Open in IMG/M
3300027886\|Ga0209486_10151241	All Organisms → cellular organisms → Bacteria	1279	Open in IMG/M
3300027907\|Ga0207428_10010326	All Organisms → cellular organisms → Bacteria → Acidobacteria	8347	Open in IMG/M
3300027907\|Ga0207428_10060293	All Organisms → cellular organisms → Bacteria → Acidobacteria	3006	Open in IMG/M
3300027909\|Ga0209382_11432743	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300028379\|Ga0268266_11399619	All Organisms → cellular organisms → Bacteria → Acidobacteria	675	Open in IMG/M
3300028380\|Ga0268265_10420428	All Organisms → cellular organisms → Bacteria → Acidobacteria	1241	Open in IMG/M
3300028380\|Ga0268265_12135774	Not Available	567	Open in IMG/M
3300028381\|Ga0268264_10707480	All Organisms → cellular organisms → Bacteria → Acidobacteria	1001	Open in IMG/M
3300030510\|Ga0268243_1123123	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	615	Open in IMG/M
3300030511\|Ga0268241_10054519	Not Available	864	Open in IMG/M
3300031538\|Ga0310888_10000985	All Organisms → cellular organisms → Bacteria	7832	Open in IMG/M
3300031538\|Ga0310888_10870588	Not Available	561	Open in IMG/M
3300031548\|Ga0307408_100209873	All Organisms → cellular organisms → Bacteria	1582	Open in IMG/M
3300031548\|Ga0307408_100210712	All Organisms → cellular organisms → Bacteria → Acidobacteria	1579	Open in IMG/M
3300031548\|Ga0307408_100282736	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola	1382	Open in IMG/M
3300031731\|Ga0307405_10097489	All Organisms → cellular organisms → Bacteria → Acidobacteria	1963	Open in IMG/M
3300031731\|Ga0307405_10695409	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300031740\|Ga0307468_100263688	All Organisms → cellular organisms → Bacteria	1222	Open in IMG/M
3300031854\|Ga0310904_10696364	All Organisms → cellular organisms → Bacteria → Acidobacteria	702	Open in IMG/M
3300031858\|Ga0310892_11001988	Not Available	589	Open in IMG/M
3300031901\|Ga0307406_10461777	All Organisms → cellular organisms → Bacteria	1021	Open in IMG/M
3300031903\|Ga0307407_10355694	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1038	Open in IMG/M
3300031938\|Ga0308175_102462219	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	583	Open in IMG/M
3300031995\|Ga0307409_101885355	Not Available	627	Open in IMG/M
3300032002\|Ga0307416_102678305	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	595	Open in IMG/M
3300032157\|Ga0315912_10175324	All Organisms → cellular organisms → Bacteria	1681	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	51.16%
Environmental	Environmental	48.84%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	51.16%
Terrestrial	Environmental → Terrestrial	47.09%
Aquatic	Environmental → Aquatic	1.74%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	46.51%
Rhizosphere	Host-Associated → Plants → Rhizosphere	29.65%
Rhizoplane	Host-Associated → Plants → Rhizoplane	20.93%
Freshwater	Environmental → Aquatic → Freshwater	0.87%
Marine	Environmental → Aquatic → Marine	0.87%
Cave	Environmental → Terrestrial → Cave	0.58%
Roots	Host-Associated → Plants → Roots	0.29%
Phyllosphere	Host-Associated → Plants → Phyllosphere	0.29%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	40.99%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	22.38%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	18.02%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.27%
Loam	Environmental → Terrestrial → Soil → Loam	4.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.91%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.87%
Ice	Environmental → Aquatic → Freshwater → Ice	0.58%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.58%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.58%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.29%
Sand	Environmental → Terrestrial → Soil → Sand	0.29%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.29%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.29%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	22.38%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	18.02%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	8.43%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.27%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.98%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.20%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.91%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.45%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.16%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.87%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.87%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.58%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.58%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.58%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.29%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.29%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.29%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.29%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.29%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	9.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	8.14%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	7.27%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.69%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.23%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	5.81%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.78%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.49%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.49%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.62%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.62%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.03%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.74%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	1.74%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.74%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	1.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.45%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.16%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.16%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.87%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.87%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.58%
Quercus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere	0.58%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.58%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.29%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.29%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.29%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.29%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.29%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.29%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.29%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.29%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.29%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.29%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.29%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.29%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.29%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	0.29%
Switchgrass Rhizosphere Bulk Soil	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil	0.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.29%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.29%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.29%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.29%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.29%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.29%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000531	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled	Host-Associated	Open in IMG/M
3300000532	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled	Host-Associated	Open in IMG/M
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001139	Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil	Environmental	Open in IMG/M
3300001157	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2	Environmental	Open in IMG/M
3300003267	Sugarcane bulk soil Sample L1	Environmental	Open in IMG/M
3300003999	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2	Environmental	Open in IMG/M
3300004016	Agave microbial communities from Guanajuato, Mexico - As.Ma.rz	Host-Associated	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005280	Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005875	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101	Environmental	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011333	Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300011993	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1	Environmental	Open in IMG/M
3300012015	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1	Environmental	Open in IMG/M
3300012022	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6	Environmental	Open in IMG/M
3300012045	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012474	Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610	Environmental	Open in IMG/M
3300012684	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013760	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2	Environmental	Open in IMG/M
3300014487	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG	Environmental	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300020003	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2	Environmental	Open in IMG/M
3300020146	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C	Environmental	Open in IMG/M
3300024179	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36	Environmental	Open in IMG/M
3300025567	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025971	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes)	Environmental	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026071	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026377	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B	Environmental	Open in IMG/M
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027266	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027530	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)	Environmental	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027639	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)	Environmental	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300030510	Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)	Environmental	Open in IMG/M
3300030511	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)	Environmental	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_03496800	2088090014	Soil	MLQEIWDSFIMLIPVFILLTMIFGAGFYIGRVSKKQK
MBSR1b_0662.00002680	2162886012	Miscanthus Rhizosphere	MITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE
ICCgaii200_06358502	2228664021	Soil	MTIIQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER
INPgaii200_09006171	2228664022	Soil	MLKEVWDAFVMLIPVFFLLLMIFGAGFYIGRISKRTE
ICChiseqgaiiDRAFT_05640042	3300000033	Soil	MLQQVWDSFVLLIPVFFLLIMIFGAGFFIGRASKKDC*
ICChiseqgaiiDRAFT_20315861	3300000033	Soil	MLQQVWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE*
ICChiseqgaiiFebDRAFT_110978892	3300000363	Soil	MFQQLWDGFIMLIPVFFLLTLIFGAGVYVGRVSKKER*
CNBas_10056112	3300000531	Quercus Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVTKRE*
CNAas_10002009	3300000532	Quercus Rhizosphere	MLEQIWGTFVMMIPVFLLLTMIFGAGFFIGRVTRKE*
F14TC_1005387032	3300000559	Soil	MLTQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKEQ*
JGI11643J11755_116505842	3300000787	Soil	MTIIQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER*
JGI10214J12806_116710664	3300000891	Soil	MLTQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
JGI11615J12901_100530532	3300000953	Soil	MLEELWQSFIVMIPIFFLLTMIFGAGFYIGRVTKKDT*
JGI11615J12901_117439292	3300000953	Soil	MIQQIWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
JGI11615J12901_120016642	3300000953	Soil	MTSLNLKEVARMLQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE*
JGI1027J12803_1013839352	3300000955	Soil	MLKEVWDAFVMLIPVFFLLLMIFGAGFYIGRISKRTE*
JGI10216J12902_1015663292	3300000956	Soil	MLEELWNSFVILIPVFFLLTLIFAAGFYIGRVTKRE*
JGI10216J12902_1029018521	3300000956	Soil	MIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDT*
JGI10216J12902_1078026082	3300000956	Soil	MRELWDTFVLLIPVFFLLTLMFGAGFVIGRISKREH*
JGI10216J12902_1188493561	3300000956	Soil	MLEELWTNFVILIPVFILLTMIFGAGFYIGRVSKRE*
JGI10220J13317_102313412	3300001139	Soil	MIQQLWDSFVMLIPVFFLLTMIFGAGFYVGRVSKKDT*
JGI10220J13317_114612982	3300001139	Soil	MLQQVWDSFVLLIPVFFLLIMIFGAGFFIGRASKRDC*
JGI12686J13345_1006057	3300001157	Forest Soil	MDQIWGTFVTLIPVFFLLTIVFGAGIYIGRVSKRE*
soilL1_101705662	3300003267	Sugarcane Root And Bulk Soil	MLQQLWDSFVMLIPVFFLLTMIFGAGFFIGRASKKESRE*
Ga0055469_101042922	3300003999	Natural And Restored Wetlands	MQSCLTEVVEMLEQLWGSFVLLIPVFFLLMMIFGAGFYIGRVSKRE*
Ga0058689_101078841	3300004016	Agave	MSLIQQIWDSFIMLIPVFLLLTMIFGAGFYIGRVSKKER*
Ga0062593_1018882581	3300004114	Soil	KGDQNMLENLWGTFVMMIPVFLLLTMIFGAGFYIGRVSKKE*
Ga0062589_1013050002	3300004156	Soil	MTSLNLKEVARMLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE*
Ga0063356_1010072311	3300004463	Arabidopsis Thaliana Rhizosphere	RTPKNLRREICPMVRELWETFVMLIPVFFLLTMIFGAGFYIGRVSKREQ*
Ga0062594_1002463963	3300005093	Soil	MLEQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE*
Ga0065696_14395201	3300005280	Switchgrass Rhizosphere Bulk Soil	RMLQQLWDTFIMLIPVFVLLTMIFGAGFYIGRVSKENSAAD*
Ga0070676_105340311	3300005328	Miscanthus Rhizosphere	MSIVQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
Ga0066388_1007990891	3300005332	Tropical Forest Soil	EEVIFCLKEGSEMLEDLWTNFILLIPVFILLTMIFGAGFYIGRVSKKE*
Ga0070692_100190493	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE*
Ga0070673_1001314092	3300005364	Switchgrass Rhizosphere	RRPQMLQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER*
Ga0070694_1000126084	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MNVIRPETSLTKEISMLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE*
Ga0068867_1000642372	3300005459	Miscanthus Rhizosphere	MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDTEAAD*
Ga0070706_1006811152	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	LFMLSELWGTFVLLIPVFFLLTIIFFAGFVIGRVSKREQ*
Ga0070698_1020482572	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	VVKVLQQLWDSFVIMIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0068853_1004484202	3300005539	Corn Rhizosphere	HCPAQSVFPTVWLRRRCIQMITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE*
Ga0070672_1006551231	3300005543	Miscanthus Rhizosphere	MLQEIWGSFIMLIPVFILLTMIFGAGVYIGRVSKKQE*
Ga0070672_1011809712	3300005543	Miscanthus Rhizosphere	MLQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER*
Ga0070672_1012567291	3300005543	Miscanthus Rhizosphere	WLRRRCIQMITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE*
Ga0070704_1012004882	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	TEVNQMIEELWNSFVLLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0070664_1002247282	3300005564	Corn Rhizosphere	MLEELWNSFVILIPVFFLLTLIFAAGFYIGRVSKRE*
Ga0070664_1004231981	3300005564	Corn Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0070664_1005407631	3300005564	Corn Rhizosphere	MQQLWDTFIMMIPVFLLLTMIFGAGFFIGRVSKKER*
Ga0066693_102410572	3300005566	Soil	MLQQIWDTFVMMIPVFFLLTIVFGAGFYIGRVTKRE*
Ga0068857_1002100202	3300005577	Corn Rhizosphere	MSIIQQIWDSFIMLIPVFFLLTLIFGAGFYIGRVSKKER*
Ga0068857_1006045562	3300005577	Corn Rhizosphere	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0068857_1011706202	3300005577	Corn Rhizosphere	MLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE*
Ga0068857_1018975572	3300005577	Corn Rhizosphere	MMQQLWGTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS*
Ga0068857_1025589951	3300005577	Corn Rhizosphere	MLQQVWDTFVMMIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0068854_1008188082	3300005578	Corn Rhizosphere	MVSELWNTFVMLIPVFVLLTLIFGAGFYIGRVSKREQ*
Ga0068854_1012078812	3300005578	Corn Rhizosphere	MLQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE*
Ga0068854_1018240251	3300005578	Corn Rhizosphere	MLQQVWDSFILLIPVFFLLTLIFGAGFYIGRVSKRE*
Ga0068852_1009690992	3300005616	Corn Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKD*
Ga0068859_1000187013	3300005617	Switchgrass Rhizosphere	MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRER*
Ga0068859_1001559621	3300005617	Switchgrass Rhizosphere	MFDELWRSFVVMIPIFFLLTMIFGAGFYIGRVTKKE*
Ga0068859_1001805332	3300005617	Switchgrass Rhizosphere	MLQQVWDSFVMLIPVFFLLIMIFGAGFYIGRVSKRE*
Ga0068859_1003330773	3300005617	Switchgrass Rhizosphere	MITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE*
Ga0068859_1004057342	3300005617	Switchgrass Rhizosphere	MLQQIFDTFVMLIPVFILLTMIFGAGFYIGRVSKRD*
Ga0068859_1016053061	3300005617	Switchgrass Rhizosphere	MLQQIWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKE*
Ga0068859_1020120072	3300005617	Switchgrass Rhizosphere	MIEQLWGSFVMLIPVFFLLTMIFGAGFYIGRVSKKD*
Ga0068864_1000315232	3300005618	Switchgrass Rhizosphere	MLQQIFDTFVILIPVFVLLTMIFGAGFYIGRVSKKER*
Ga0068864_1000874672	3300005618	Switchgrass Rhizosphere	MMQQLWDTFVMLIPVFVLLTMIFGAGFYIGRVSKRDS*
Ga0068864_1020601562	3300005618	Switchgrass Rhizosphere	PRGLSVPITIEVNLMIEELWNSFVLLIPVFFLLTIIFGAGFYIGRVSKRE*
Ga0068866_105616692	3300005718	Miscanthus Rhizosphere	QLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRDS*
Ga0068861_10000200114	3300005719	Switchgrass Rhizosphere	MLQQLWDSFVLLIPVFFLLIMVFGAGFYIGRVSVSRRE*
Ga0068861_1000485863	3300005719	Switchgrass Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0068861_1006846842	3300005719	Switchgrass Rhizosphere	MMQQVWDSFVLLIPVFFLLIMIFGAGFYIGRVSKKDS*
Ga0068851_106352841	3300005834	Corn Rhizosphere	MLQQVWDSFLMLIPVFFLLTMIFGAGFYIGRVSKKE*
Ga0068870_101382642	3300005840	Miscanthus Rhizosphere	MLQQIFDTFVILIPVFVLLTMIFGAGFYIGRVSKKEDS*
Ga0068863_1008507742	3300005841	Switchgrass Rhizosphere	MLQTVWDSFVMLIPVFFLLTMIFGAGFYIGRVTKKEE*
Ga0068860_1000186366	3300005843	Switchgrass Rhizosphere	MMQQIWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS*
Ga0068860_1017274182	3300005843	Switchgrass Rhizosphere	MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
Ga0068862_1000060483	3300005844	Switchgrass Rhizosphere	MLTQVWDAFIMLIPVFILLTMIFGAGFYIGRVSKKER*
Ga0068862_1002893912	3300005844	Switchgrass Rhizosphere	MLQTVWDSFVMLIPVFFLLTMIFGAGFYIGRVTKKQE*
Ga0068862_1005412682	3300005844	Switchgrass Rhizosphere	MLQQIFDTFVILIPVFVLLTMIFGAGFYIGRVSKKE*
Ga0068862_1012071252	3300005844	Switchgrass Rhizosphere	MSIIQQIWDSFILLIPVFFLLTMIFGAGFYIGRVSKKER*
Ga0068862_1013483372	3300005844	Switchgrass Rhizosphere	MLQQLLDTFVMLVPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0075293_10005941	3300005875	Rice Paddy Soil	MLQQVWDSFIMLIPVFFLLVMIFGAGFYIGRVSKKE*
Ga0081539_100123712	3300005985	Tabebuia Heterophylla Rhizosphere	MLDQLWNSFVMLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0075417_105342082	3300006049	Populus Rhizosphere	MLGQVWDTFVMLLPVFFLLTMIFGAGFYIGRVSKKE*
Ga0082029_10373181	3300006169	Termite Nest	MMQQLWDTFVLMIPVFVLLTMIFGAGFYIGRVSKKDS*
Ga0082029_10625442	3300006169	Termite Nest	MLQQVWDTFVMLIPVFLLLTMIFGVGFYIGRVSKRE*
Ga0082029_11540533	3300006169	Termite Nest	MLQQVWDSFVLLIPVFFLLIMIFGAGFYIGRVSKKDS*
Ga0082029_122285420	3300006169	Termite Nest	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSSSS*
Ga0082029_17334312	3300006169	Termite Nest	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDRSSS*
Ga0082029_17778271	3300006169	Termite Nest	MEQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDT*
Ga0070716_1004701332	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MLDELWNSFVLLIPVFFLLTLIFGAGFYVGRVSKRE*
Ga0070716_1009108502	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MLQQIWDTFVMMIPVFFLLTIVFGAGFYIGRVSKRE*
Ga0068871_1018297342	3300006358	Miscanthus Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDT*
Ga0079222_103977012	3300006755	Agricultural Soil	MIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
Ga0079222_104773822	3300006755	Agricultural Soil	MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKD*
Ga0079222_111808002	3300006755	Agricultural Soil	MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKRDS*
Ga0066658_103185723	3300006794	Soil	MLQQIWDTFVMMIPVFFLLTIIFGAGFYIGRVTKRE*
Ga0066665_103600832	3300006796	Soil	MLERLWGTFVLLVPVFVLLTMIFGAGFVIGRVSKKQ*
Ga0075428_1001234192	3300006844	Populus Rhizosphere	MLQQLWDTFVIMIPVFFLLTMIFGAGFYIGRVSKREQ*
Ga0075428_1005512291	3300006844	Populus Rhizosphere	MLAQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKE
Ga0075428_1023004171	3300006844	Populus Rhizosphere	QLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDGRE*
Ga0075428_1024044032	3300006844	Populus Rhizosphere	MSFIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
Ga0075433_100195813	3300006852	Populus Rhizosphere	MLQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE*
Ga0075433_101181062	3300006852	Populus Rhizosphere	MLQKLWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKE*
Ga0075433_113559022	3300006852	Populus Rhizosphere	RRPAMMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS*
Ga0075425_1001098624	3300006854	Populus Rhizosphere	MLEDLWHTLITLIPVFILLLMIFGAGFYIGRVSMRQ*
Ga0075425_1007411642	3300006854	Populus Rhizosphere	MLQTVWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKQE*
Ga0075434_1001000603	3300006871	Populus Rhizosphere	MMQQIWDTFVMMIPVFFLLTMIFGAGFYIGRVSKRDS*
Ga0075434_1002033703	3300006871	Populus Rhizosphere	MLQQLWDSFVMLIPVFLLLTMIFGAGFYIGRVSKKDT*
Ga0079217_100005112	3300006876	Agricultural Soil	MSIIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
Ga0079217_100317232	3300006876	Agricultural Soil	MSIIQQIWDSFILLIPVFFLLTMIFGAGFYVGRVSKKER*
Ga0079217_100392222	3300006876	Agricultural Soil	MVQQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0079217_102781101	3300006876	Agricultural Soil	MVRELWETFVMLIPVFFLLTMIFGAGFYIGRVSKREQ*
Ga0079217_114103882	3300006876	Agricultural Soil	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRER*
Ga0079217_114563352	3300006876	Agricultural Soil	MLQQIFDTFVMLIPVFVLLTMIFGAGFYIGRVSKRE*
Ga0079217_116521171	3300006876	Agricultural Soil	MLHQMWDSFVLLIPVFFLLLMIFGAGFYIGRVSKKDC*
Ga0079215_100001721	3300006894	Agricultural Soil	EECRMSIIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
Ga0079215_101316362	3300006894	Agricultural Soil	MLHQMWDSFVLLIPVFFLLLMIFGAGFYIGRVSKKDS*
Ga0079215_106621842	3300006894	Agricultural Soil	MLQQIWDTFIMMIPVFFLLTMIFGAGFYIGRVSKKE*
Ga0075424_1018008801	3300006904	Populus Rhizosphere	MIEELWNSFVLLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0079216_106380911	3300006918	Agricultural Soil	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKE*
Ga0079216_108194942	3300006918	Agricultural Soil	MSFIQQIWDSFIMLIPVFFLLTMIFGAGFYVGRVSKRER*
Ga0079219_116961731	3300006954	Agricultural Soil	APSLTVVATQRGEPMLQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE*
Ga0075419_111203561	3300006969	Populus Rhizosphere	GAMLGQVWDTFVMLIAVFFLLTMIFGAGVYIGRVSKKSDR*
Ga0079218_100507162	3300007004	Agricultural Soil	QIWDSFIMLIPVFFLLTMIFGAGVYVGRVSKKER*
Ga0079218_124199451	3300007004	Agricultural Soil	MLQQLVDSIVLLIPVFFLLTIIFGAGFYIGRVSKKE*
Ga0066710_1000777792	3300009012	Grasslands Soil	MLERLWGTFVLLIPVFVLLTMIFGAGFYIGRVSKKQ
Ga0099829_101991582	3300009038	Vadose Zone Soil	MLDELWGTFVLLIPVFFLLTIIFFAGFIIGRVSKREQ*
Ga0105250_100680781	3300009092	Switchgrass Rhizosphere	MLQQVWDSFIMLIPVFFLLTMIFGAGFYVGRVSKK
Ga0111539_1000327810	3300009094	Populus Rhizosphere	MFQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKER*
Ga0105245_104979562	3300009098	Miscanthus Rhizosphere	MLQQVWDSFIMLIPVFILLIMIFGAGFYIGRVSKKER*
Ga0105245_112802463	3300009098	Miscanthus Rhizosphere	SSLTKEISMLQQLWDSFVMLIPVFFLLTMIFGAGFFIVRASKKESRE*
Ga0105245_114292611	3300009098	Miscanthus Rhizosphere	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0105245_130591752	3300009098	Miscanthus Rhizosphere	MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKKNS*
Ga0075418_101108843	3300009100	Populus Rhizosphere	MLVQVWETFVMLLPVFFLLTMIFGAGFYIGRVSKKG*
Ga0075418_102291412	3300009100	Populus Rhizosphere	MIQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKER*
Ga0075418_105461361	3300009100	Populus Rhizosphere	MLTQVWDTFIMLIPVFILLTMIFGAGFYIGRVSKKER*
Ga0075418_114507441	3300009100	Populus Rhizosphere	LWPKEVIVVLQQLFDSFVLLIPVFFLLLMIFGAGFYIGRVSKKDS*
Ga0075418_129248751	3300009100	Populus Rhizosphere	MSIIQQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKE
Ga0105247_102945602	3300009101	Switchgrass Rhizosphere	MMQQLWDTFVMLIPVFFLLTMIFGAGFYIGRVSKRDT*
Ga0105247_109167561	3300009101	Switchgrass Rhizosphere	MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDT*
Ga0114129_101000782	3300009147	Populus Rhizosphere	MLSDVWSAFLALIPVFFLLIMIFAAGIYIGRVSKKERN*
Ga0114129_101828132	3300009147	Populus Rhizosphere	MSIIQQVWDTFIMLIPVFFLLTMIFGAGFYIGRVSKKER*
Ga0114129_102658123	3300009147	Populus Rhizosphere	MLEELWDTFVLLIPVFFLLTLIFGAGVYIGRASKRQ*
Ga0114129_111060942	3300009147	Populus Rhizosphere	QVWDTFVMLIPVFFLLTMIFGAGVYIGRVSKKSDR*
Ga0114129_121448742	3300009147	Populus Rhizosphere	MSIIQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER*
Ga0114129_125115182	3300009147	Populus Rhizosphere	MLQQLVDTFVMLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0105243_107381592	3300009148	Miscanthus Rhizosphere	MLQQVWDSFTMLIPVFFLLIMIFGAGFYIGRVSKKE*
Ga0105243_107728892	3300009148	Miscanthus Rhizosphere	MLQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKDS*
Ga0105243_113930521	3300009148	Miscanthus Rhizosphere	MSIIQQIWDSFIMLIPVFFLLTLIFGAGFYIGRVTKKER*
Ga0105243_124905112	3300009148	Miscanthus Rhizosphere	QQLWDSFVMLIPVFLLLTMIFGAGFYIGRVSKKDT*
Ga0105243_127344912	3300009148	Miscanthus Rhizosphere	MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKDS*
Ga0075423_118066901	3300009162	Populus Rhizosphere	NLTTEATQMLEELWQSFVVMIPIFILLTMIFGAGFYIGRVTKKDT*
Ga0075423_125202001	3300009162	Populus Rhizosphere	PSRFQRRLIMLEELWNSFVIMIPVFFLLTLIFGAGFYIGRVSKRE*
Ga0105249_108086142	3300009553	Switchgrass Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRDS*
Ga0105249_113917012	3300009553	Switchgrass Rhizosphere	MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKER*
Ga0105249_118618811	3300009553	Switchgrass Rhizosphere	QQIFDTFVMLIPVFVLLTMIFGAGFYIGRVSKKE*
Ga0105249_132153811	3300009553	Switchgrass Rhizosphere	NGGGQMLQQVWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE*
Ga0126307_107676042	3300009789	Serpentine Soil	MLQQIWDTFIMMIPVFFLLTMIFGAGFYIGRVSKKGT*
Ga0126307_111743941	3300009789	Serpentine Soil	MLQQLWDTLVMMIPVFVLLTMIFGAGFYIGRVSKRE*
Ga0126307_113641001	3300009789	Serpentine Soil	SSTKGGRRMLQQIWDNLVMMIPVFFLLTMIFGAGFYIGRVTRKE*
Ga0126307_117399202	3300009789	Serpentine Soil	MEVKVLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0126374_109046062	3300009792	Tropical Forest Soil	MLEDLWTNFILLIPVFILLTMIFGAGFYIGRVSKKE*
Ga0126313_113197752	3300009840	Serpentine Soil	MVQQLWDTFVMMIPVFFLLTLIFGAGFYVGRVSKRER*
Ga0126305_100390562	3300010036	Serpentine Soil	MLQQVWDSFIMLIPVFLLLTMIFGAGFYIGRVTKRE*
Ga0126305_102209122	3300010036	Serpentine Soil	MLEQLWGTFITLIPVFFLLTMVFGAGFYIGRVSKRE*
Ga0126305_103763362	3300010036	Serpentine Soil	MLQQLWDNFIMLIPVFFLLTMIFGAGFYIGRVSKRDS*
Ga0126305_106880662	3300010036	Serpentine Soil	MLQQLFDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0126315_100017705	3300010038	Serpentine Soil	MLQQIWDTFVMLIPVFFLLTMIFGAGFYVGRVSKKE*
Ga0126315_101662381	3300010038	Serpentine Soil	MLQQLWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKE*
Ga0126308_112342661	3300010040	Serpentine Soil	MLQQIWDTFIMMIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0126308_113416671	3300010040	Serpentine Soil	MLQQLWDSFVVLIPVFFLLTLIFGAGIYIGRVSKRE*
Ga0126314_103811301	3300010042	Serpentine Soil	QQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKE*
Ga0126314_106407072	3300010042	Serpentine Soil	MLQQLWGSFIMLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0126310_101373081	3300010044	Serpentine Soil	MEASMLQQLFDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0126310_117237481	3300010044	Serpentine Soil	LRQKEGEKMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0126311_103262921	3300010045	Serpentine Soil	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKR
Ga0126311_107983432	3300010045	Serpentine Soil	MEASMLQQLFDSFIMLIPVFFLLTMIFAAGFYIGRVSKKDS*
Ga0126311_118528922	3300010045	Serpentine Soil	MQQLWDTFVMMIPVFFLLTMIFGAGFYVGRVSKRER*
Ga0126384_110638092	3300010046	Tropical Forest Soil	MLEELWNSFVILIPVFFLLTLIFGAGFYIGRVSKRE*
Ga0126382_102928901	3300010047	Tropical Forest Soil	MFQQLWETFVMMIPVFLLLTMIFAAGFYIGRVSKRE*
Ga0126376_100005545	3300010359	Tropical Forest Soil	MFQQIWDTFVMMIPVFFLLTMIFGAGFYIGRVTKKE*
Ga0126376_100067173	3300010359	Tropical Forest Soil	MFQQLWDTFVMMIPVFLLLTMIFGAGFYIGRVSKRE*
Ga0126376_100845263	3300010359	Tropical Forest Soil	MLEELWNSFIILIPVFFLLTLIFAAGFYIGRVTKRE*
Ga0126376_101338132	3300010359	Tropical Forest Soil	MFQNLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE*
Ga0126376_107914251	3300010359	Tropical Forest Soil	MFEDLWTNFVLLIPIFILLTMIFGAGFYIGRVSKKE*
Ga0134066_103877072	3300010364	Grasslands Soil	VLQQLWDSFVVLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0134128_120806842	3300010373	Terrestrial Soil	MLQQIWDTFVMMIPVFFLLTMVFGAGFYIGRVTKRE*
Ga0134128_124957182	3300010373	Terrestrial Soil	MLQQLWDSFVLLIPVFFLLTMIFGAGFYVGRVSKKE*
Ga0105239_104240622	3300010375	Corn Rhizosphere	MLQQVWDSFTMLIPVFFLLIMIFGAGFYIGRVSKRE*
Ga0134126_121460112	3300010396	Terrestrial Soil	MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKE*
Ga0134127_100559264	3300010399	Terrestrial Soil	MFTQVWDAFVMLIPVFILLTMIFGAGFYIGRVSKKE*
Ga0134127_116467412	3300010399	Terrestrial Soil	MLQQIFDTFVMLIPVFVLLTMIFGAGFYIGRVSKKE*
Ga0134127_130439661	3300010399	Terrestrial Soil	MIQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVTKKDT*
Ga0134122_105343732	3300010400	Terrestrial Soil	MLQQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0134122_114486332	3300010400	Terrestrial Soil	QQLWVTFVMMIPVFVLLTMIFGAGFYIGRVSKRDT*
Ga0134121_1000092212	3300010401	Terrestrial Soil	MLQQLWDNFIMLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0134121_102490832	3300010401	Terrestrial Soil	MITQVWDAFVMLIPVFILLTMIFGAGFYIGRVSKKE*
Ga0134121_110363471	3300010401	Terrestrial Soil	MFQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVTKKE*
Ga0134121_124481541	3300010401	Terrestrial Soil	MLQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRK*
Ga0134123_103664962	3300010403	Terrestrial Soil	MLQEIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER*
Ga0134123_104836611	3300010403	Terrestrial Soil	MMQQLWDTFVMMIPVYVLLTMLFGAGLYIWRVSKKGSW*
Ga0134123_105312383	3300010403	Terrestrial Soil	MLEQLWDSFVMLIPVFFLLTMIFGAGFFIGRASKKESRE*
Ga0134123_109775042	3300010403	Terrestrial Soil	TKGERQMFEELWNSFVILIPVFFLLTLIFGAGFYIGRVTKRE*
Ga0127502_108444111	3300011333	Soil	PHLSLTTEVLRMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0120182_10211281	3300011993	Terrestrial	MLQQLWDSFVLLIPVFFLLLMIFGAGFFIGRASKKDS*
Ga0120187_10027662	3300012015	Terrestrial	MLQQLWDSFVLLIPVFFLLIMIFGAGFFIGRASKKDS*
Ga0120191_101249592	3300012022	Terrestrial	MLQQIWDTFIILIPVFVLLTMIFGAGVYIGRASKRQ*
Ga0136623_100003986	3300012045	Polar Desert Sand	MINELWGTFVMLIPVFLLLTLIFGAGFYIGRVSKREQ*
Ga0137378_108038432	3300012210	Vadose Zone Soil	MLRELWGTFVLLVPVFFLLTIIFAAGFVIGRMSKREQ*
Ga0137375_101340622	3300012360	Vadose Zone Soil	MVRELWDVFVLLIPVFFLLTLMFVAGFVIGRISKRER*
Ga0157356_10170051	3300012474	Unplanted Soil	LHEIWDSFIMLIPVFILLTMIFGAGFYIGRVSKKEE*
Ga0136614_100163283	3300012684	Polar Desert Sand	MLRQLWDTFVLLIPVFFLLTIIFGAGFVIGRISTREQ*
Ga0137359_100345553	3300012923	Vadose Zone Soil	MLSELWGTFVLLIPVFFLLTIIFFAGFIIGRVSKREQ*
Ga0137404_100009488	3300012929	Vadose Zone Soil	MLEDLWHTFITLIPVFILLLMIFGAGFYIGRVSTRK*
Ga0137404_112159271	3300012929	Vadose Zone Soil	MLQQLWDTFTMMIPVFLLLTMIFGAGFYIGRVSKRE*
Ga0164303_101608961	3300012957	Soil	MFQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE*
Ga0157373_107271602	3300013100	Corn Rhizosphere	MSIVQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0157371_107757973	3300013102	Corn Rhizosphere	LVFSFPFLTTEVFEMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0157374_109732862	3300013296	Miscanthus Rhizosphere	MLQQVWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0157374_125753281	3300013296	Miscanthus Rhizosphere	MLQQVWDSFMMLIPVFFLLIMIFGAGFYIGRVSKRE*
Ga0157378_106612403	3300013297	Miscanthus Rhizosphere	MLREIFNSFVLLIPVFILLMLTFGAGFAIGRISRREE*
Ga0163162_109520952	3300013306	Switchgrass Rhizosphere	MLTQVWDTFMMLIPVFILLTMIFGAGFYIGRVSKKER*
Ga0163162_116766601	3300013306	Switchgrass Rhizosphere	MLQQLWDSFIMLIPVFFLLTMILGAEFYIGRVSKKDS*
Ga0157372_118042702	3300013307	Corn Rhizosphere	MLQQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKKDS*
Ga0120188_10202401	3300013760	Terrestrial	MLEQLWDSFVLLIPVFFLLIMIFGAGFFIGRASKKDS*
Ga0120188_10307132	3300013760	Terrestrial	LQQLWDSFVMLIPVFFLLTMIFGAGFFIGRVNGKNSRE*
Ga0182000_104260921	3300014487	Soil	GGLQMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS*
Ga0182000_105428472	3300014487	Soil	MLQQLWDSFVLLIPVFFLLIMIFGAGFFIGRASKKES*
Ga0157376_116445462	3300014969	Miscanthus Rhizosphere	RPMLQEIWGSFVMLIPVFILLTMIFGAGVYIGRVSKKQE*
Ga0182007_101978002	3300015262	Rhizosphere	MLQQLWDSFVLLIPVFFLLTLIFGVGFYIGRVSKRE*
Ga0132258_100482009	3300015371	Arabidopsis Rhizosphere	MITQVWDTFIMLIPVFILLTMIFGAGFYIGRVSKKE*
Ga0132258_103466873	3300015371	Arabidopsis Rhizosphere	MLEQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0132258_108552221	3300015371	Arabidopsis Rhizosphere	MFDELWRSFVVMIPIFFLLTMIFGAGFYIGRVTKKDT*
Ga0132257_1032867672	3300015373	Arabidopsis Rhizosphere	ITTEVNLMIEELWNSFVLLIPVFFLLTMIFGAGFYIGRVSKRE*
Ga0132255_1000449326	3300015374	Arabidopsis Rhizosphere	MLQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRDS*
Ga0132255_1000642376	3300015374	Arabidopsis Rhizosphere	MTAERQERVRPMLQEIWGSFIMLIPVFILLTMIFGAGVYIGRVSKKQE*
Ga0190265_104686251	3300018422	Soil	MLQQIWDTFIMLIPVFFLLTMIFGAGFYVGRVSKKE
Ga0190265_108933003	3300018422	Soil	MSFIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKK
Ga0190265_117537972	3300018422	Soil	MSFIQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKER
Ga0190272_125244421	3300018429	Soil	MVNELWGTFVMLIPVFLLLTLIFGAGFYIGRVSKREQ
Ga0190270_107264711	3300018469	Soil	MLEEVWITFVTMIPVFILLTMIFGAGFCIGRFTKRE
Ga0190270_113386731	3300018469	Soil	MIQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDS
Ga0190270_131103022	3300018469	Soil	MLQQVWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE
Ga0190274_104183542	3300018476	Soil	MMQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS
Ga0190274_133696591	3300018476	Soil	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVTKRE
Ga0187894_1000068832	3300019360	Microbial Mat On Rocks	MIQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRE
Ga0187892_100278264	3300019458	Bio-Ooze	MLREFWDTFVLLIPVFVLLLMIFGAGFYIGRASTRQ
Ga0193739_10246102	3300020003	Soil	MLQNLWDSFLMLIPVFLLLLMMFGAGFFIGRKSKQT
Ga0196977_10042676	3300020146	Soil	MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDT
Ga0247695_10022572	3300024179	Soil	MLEELWNSFVILIPVFFLLTMIFGAGFYIGRVTKRE
Ga0210076_11332571	3300025567	Natural And Restored Wetlands	MLEQLWGSFVLLIPVFFLLMMIFGAGFYIGRVSKRE
Ga0207682_103550171	3300025893	Miscanthus Rhizosphere	MLQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER
Ga0207710_1000060913	3300025900	Switchgrass Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKD
Ga0207710_100605102	3300025900	Switchgrass Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKDS
Ga0207647_100062632	3300025904	Corn Rhizosphere	MMQQIWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS
Ga0207647_101524753	3300025904	Corn Rhizosphere	PMLQQVWDSFLMLIPVFFLLTMIFGAGFYIGRVSKKE
Ga0207647_102398452	3300025904	Corn Rhizosphere	MMQQVWDSFVLLIPVFFLLIMIFGAGFYIGRVSKKDS
Ga0207699_110858541	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MLQQLWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE
Ga0207645_102315402	3300025907	Miscanthus Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE
Ga0207645_105958772	3300025907	Miscanthus Rhizosphere	MSIVQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER
Ga0207645_106875882	3300025907	Miscanthus Rhizosphere	MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKKNS
Ga0207643_100017773	3300025908	Miscanthus Rhizosphere	MLQQIFDTFVILIPVFVLLTMIFGAGFYIGRVSKKER
Ga0207643_102566602	3300025908	Miscanthus Rhizosphere	MLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE
Ga0207654_101496292	3300025911	Corn Rhizosphere	MMQQLWDTFVIMIPVFFLLTMIFGAGFYIGRVSKRDS
Ga0207654_101609261	3300025911	Corn Rhizosphere	DLTVSLTTEVFEMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE
Ga0207695_103607642	3300025913	Corn Rhizosphere	MLQQLWDSFVMLIPVFFLLTMIFGAGFFIGRASKKESRE
Ga0207681_100444632	3300025923	Switchgrass Rhizosphere	MLTQVWDAFIMLIPVFILLTMIFGAGFYIGRVSKKER
Ga0207681_107212482	3300025923	Switchgrass Rhizosphere	MLEQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE
Ga0207694_1000286613	3300025924	Corn Rhizosphere	MLQQVWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRD
Ga0207650_1000002767	3300025925	Switchgrass Rhizosphere	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRDS
Ga0207650_101431702	3300025925	Switchgrass Rhizosphere	MLQQLWDTFVMMIPVFLLLTMIFGAGFYIGRVSKREQ
Ga0207650_107154102	3300025925	Switchgrass Rhizosphere	MLQTVWDSFVMLIPVFFLLTMIFGAGFYIGRVTKKQE
Ga0207650_110644352	3300025925	Switchgrass Rhizosphere	MLQQLWDNFIMLIPVFVLLTMIFGAGFYIGRVSKKDS
Ga0207690_101298722	3300025932	Corn Rhizosphere	MLQQVWDSFIMLIPVFFLLIMIFAAGFYIGRVSKKNS
Ga0207709_100054664	3300025935	Miscanthus Rhizosphere	MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDT
Ga0207709_108313531	3300025935	Miscanthus Rhizosphere	MLQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKDS
Ga0207709_114053531	3300025935	Miscanthus Rhizosphere	MSIIQQIWDSFIMLIPVFFLLTLIFGAGFYIGRVTKKER
Ga0207670_100003166	3300025936	Switchgrass Rhizosphere	MLQQIFDTFVLLIPVFILLTMIFGAGFYIGRVSKRD
Ga0207704_107360252	3300025938	Miscanthus Rhizosphere	MLQQIFDTFVMLIPVFVLLTMIFGAGFYIGRVSKKE
Ga0207665_109342122	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MLQQIWDTFVMMIPVFFLLTIVFGAGFYIGRVSKRE
Ga0207691_110562361	3300025940	Miscanthus Rhizosphere	VFPTVWLRRRCIQMITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE
Ga0207689_102754502	3300025942	Miscanthus Rhizosphere	MTSLNLKEVARMLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE
Ga0207679_104116512	3300025945	Corn Rhizosphere	MLEELWNSFVILIPVFCLLTLIFAAGFYIGRVSKRE
Ga0207679_105790521	3300025945	Corn Rhizosphere	MLQQLWDNFVMLIPVFFLLTMIFGAGFYIGRVSKKE
Ga0207679_115799262	3300025945	Corn Rhizosphere	MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE
Ga0207667_114684393	3300025949	Corn Rhizosphere	LWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDSRE
Ga0207651_121365592	3300025960	Switchgrass Rhizosphere	MLEQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKDS
Ga0207712_104054273	3300025961	Switchgrass Rhizosphere	MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKER
Ga0210102_10656371	3300025971	Natural And Restored Wetlands	MLEEIWRTFVVMIPVFFLLTMIFGAGFYIGRVTRKE
Ga0207640_100571866	3300025981	Corn Rhizosphere	LWDSFVMLIPVFFLLTMIFGAGFFIGRASKKESRE
Ga0207677_103126852	3300026023	Miscanthus Rhizosphere	MIQQLWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER
Ga0208537_10186652	3300026071	Natural And Restored Wetlands	MQSCLTEVVEMLEQLWGSFVLLIPVFFLLMMIFGAGFYIGRVSKRE
Ga0207708_120587651	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	RCIQMITQVWDTFVMLIPVFILLTMIFGAGFYIGRVSKKE
Ga0207641_105817612	3300026088	Switchgrass Rhizosphere	VKRRSSMLQQIFDTFVMLIPVFILLTMIFGAGFYIGRVSKRD
Ga0207641_125487201	3300026088	Switchgrass Rhizosphere	MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS
Ga0207648_100947514	3300026089	Miscanthus Rhizosphere	MMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDTEAAD
Ga0207648_102129852	3300026089	Miscanthus Rhizosphere	MLQQLWDSFIMLIPVFFLLTMIFGAGFYIDRVSKKES
Ga0207648_109875692	3300026089	Miscanthus Rhizosphere	MLQQVWDSFTMLIPVFFLLIMIFGAGFYIGRVSKKE
Ga0207648_117321151	3300026089	Miscanthus Rhizosphere	EMVSELWNTFVMLIPVFVLLTLIFGAGFYIGRVSKREQ
Ga0207676_109916442	3300026095	Switchgrass Rhizosphere	SSMLQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE
Ga0207674_105682322	3300026116	Corn Rhizosphere	MLQQLWDNFIMLIPVFFLLTMIFGAGFYIGRVSKKDS
Ga0207674_106037942	3300026116	Corn Rhizosphere	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKE
Ga0207675_1001807761	3300026118	Switchgrass Rhizosphere	MLQQLWDTFVMLIPVFLLLTMIFGAGFYIGRVSKRE
Ga0209153_10315982	3300026312	Soil	MLQQIWDTFVMMIPVFFLLTIIFGAGFYIGRVTKRE
Ga0257171_10327511	3300026377	Soil	MLSELWGTFVLLIPVFFLLTIIFAAGFVIGRMSKREQ
Ga0256867_100055227	3300026535	Soil	MLEQLWDSFVMLIPVFFLLIMIFGAGFYIGRVSKKDS
Ga0209056_101295563	3300026538	Soil	MLERLWGTFVLLIPVFVLLTMIFGAGFVIGRVSKKQ
Ga0209215_10001279	3300027266	Forest Soil	MLQQIWDTFVMMIPVFFLLTLIFAAGFYIGRVSKRDT
Ga0209216_100001258	3300027530	Forest Soil	MDQIWGTFVTLIPVFFLLTIVFGAGIYIGRVSKRE
Ga0209818_10010115	3300027637	Agricultural Soil	MSIIQQIWDSFILLIPVFFLLTMIFGAGFYVGRVSKKER
Ga0209818_10239462	3300027637	Agricultural Soil	MSIIQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER
Ga0209818_11462961	3300027637	Agricultural Soil	MVQQLWDSFVLLIPVFFLLTMIFGAGFYIGRVSKRE
Ga0209387_12513912	3300027639	Agricultural Soil	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKKER
Ga0209485_10458701	3300027691	Agricultural Soil	QMLQQVWDSFVLLIPVFFLLTLIFGAGFYIGRVSKRE
Ga0209177_104521152	3300027775	Agricultural Soil	MLQQVWDSFIMLIPVFFLLIMIFGAGFYIGRVSKKD
Ga0209814_102903502	3300027873	Populus Rhizosphere	MSIIQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER
Ga0209481_100455892	3300027880	Populus Rhizosphere	MLQQLWDTFVIMIPVFFLLTMIFGAGFYIGRVSKREQ
Ga0209486_101512412	3300027886	Agricultural Soil	MLQQLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRER
Ga0207428_100103267	3300027907	Populus Rhizosphere	MMQQIWDTFVMMIPVFFLLTMIFGAGFYIGRVSKRDS
Ga0207428_100602932	3300027907	Populus Rhizosphere	MFQQIWDSFIMLIPVFVLLTMIFGAGFYIGRVSKKER
Ga0209382_114327432	3300027909	Populus Rhizosphere	LWPKEVIVVLQQLFDSFVLLIPVFFLLLMIFGAGFYIGRVSKKDC
Ga0268266_113996191	3300028379	Switchgrass Rhizosphere	MLQQVWDSFLMLIPVFFLLTMIFGAGFYIGRVSKK
Ga0268265_104204282	3300028380	Switchgrass Rhizosphere	MLQTVWDSFVMLIPVFFLLTMLFGAGFYIGRVTKKQE
Ga0268265_121357742	3300028380	Switchgrass Rhizosphere	MFDELWRSFVVMIPIFFLLTMIFGAGFYIGRVTKKE
Ga0268264_107074802	3300028381	Switchgrass Rhizosphere	MIQQLWDSFIMLIPVFFLLTMIFGAGFYIGRVSKKER
Ga0268243_11231231	3300030510	Soil	GGLQMQQLWDTFVMMIPVFVLLTMIFGAGFYIGRVSKRDS
Ga0268241_100545192	3300030511	Soil	MLERLWDSFVMLIPVFFLLTMIFGAGFYIGRVSKRE
Ga0310888_100009852	3300031538	Soil	MLTQVWDTFMMLIPVFILLTMIFGAGFYIGRVSKKEQ
Ga0310888_108705881	3300031538	Soil	LHILGGPMLQQVWDSFLMLIPVFFLLTMIFGAGFYIGRVSKKE
Ga0307408_1002098732	3300031548	Rhizosphere	MLQQIFDTFVMLIPVFFLLTMIFGAGFYIGRVSKKDS
Ga0307408_1002107122	3300031548	Rhizosphere	MLQQVWDSFVLLIPVFFLLIMIFGAGFYIGRVSKKDS
Ga0307408_1002827362	3300031548	Rhizosphere	MLQQLWDNFILLIPVFVLLTMIFGAGFYIGRVSKKDS
Ga0307405_100974892	3300031731	Rhizosphere	MLQQLWDSIVLLIPVFFLLTMIFGAGFYIGRVTKKE
Ga0307405_106954092	3300031731	Rhizosphere	MLQQVWDTFVMLIPVFLLLTMIFGAGFYIGRVSKR
Ga0307468_1002636881	3300031740	Hardwood Forest Soil	MLEQIWGTFVMMIPVFFLLTMIFGAGFYIGRVTKKE
Ga0310904_106963642	3300031854	Soil	SSTQRRPQMLQQIWDSFIMLIPVFFLLTLIFGAGVYVGRVSKKER
Ga0310892_110019881	3300031858	Soil	MLQTVWDSFVMLIPVFFLLTMIFGAGFYLGRVTKKEE
Ga0307406_104617772	3300031901	Rhizosphere	MLQQIVDTFVMLIPVFFLLTMIFGAGFYIGRVSKKDS
Ga0307407_103556942	3300031903	Rhizosphere	MCAMLQQLWDSIVLLIPVFFLLTMIFGAGFYIGRVTKKE
Ga0308175_1024622192	3300031938	Soil	GELMLQQLWDSFVVLIPVFFLLTMIFGAGFYIGRVSKRE
Ga0307409_1018853552	3300031995	Rhizosphere	MVRELWETFVMLIPVFFLLTMIFGAGFYIGRVSKREQ
Ga0307416_1026783052	3300032002	Rhizosphere	RCAMLQQLWDSIVLLIPVFFLLTMIFGAGFYIGRVTKKE
Ga0315912_101753242	3300032157	Soil	MLQQIWDSFIMLIPVFFLLTMIFGAGFYIGRVSKRE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F007823

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences