NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F008003

Metagenome / Metatranscriptome Family F008003

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F008003
Family Type Metagenome / Metatranscriptome
Number of Sequences 341
Average Sequence Length 39 residues
Representative Sequence MIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIML
Number of Associated Samples 208
Number of Associated Scaffolds 341

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.92 %
% of genes near scaffold ends (potentially truncated) 44.87 %
% of genes from short scaffolds (< 2000 bps) 86.80 %
Associated GOLD sequencing projects 193
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.900 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.437 % of family members)
Environment Ontology (ENVO) Unclassified
(27.273 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.560 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.92%    β-sheet: 0.00%    Coil/Unstructured: 83.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 341 Family Scaffolds
PF03401TctC 2.05
PF00528BPD_transp_1 1.76
PF07221GlcNAc_2-epim 1.47
PF02653BPD_transp_2 1.47
PF14224DUF4331 1.17
PF02683DsbD 1.17
PF00005ABC_tran 0.88
PF00370FGGY_N 0.88
PF00550PP-binding 0.88
PF12399BCA_ABC_TP_C 0.88
PF04955HupE_UreJ 0.88
PF08808RES 0.88
PF13458Peripla_BP_6 0.88
PF01578Cytochrom_C_asm 0.88
PF01063Aminotran_4 0.59
PF03480DctP 0.59
PF01494FAD_binding_3 0.59
PF00009GTP_EFTU 0.59
PF01370Epimerase 0.59
PF00497SBP_bac_3 0.59
PF00571CBS 0.59
PF00696AA_kinase 0.59
PF01713Smr 0.59
PF00557Peptidase_M24 0.59
PF04828GFA 0.59
PF12697Abhydrolase_6 0.59
PF14588YjgF_endoribonc 0.59
PF00293NUDIX 0.59
PF00583Acetyltransf_1 0.59
PF00903Glyoxalase 0.59
PF00486Trans_reg_C 0.59
PF13467RHH_4 0.59
PF07883Cupin_2 0.59
PF07690MFS_1 0.59
PF00033Cytochrome_B 0.59
PF01734Patatin 0.59
PF01609DDE_Tnp_1 0.59
PF08402TOBE_2 0.59
PF02913FAD-oxidase_C 0.59
PF03734YkuD 0.59
PF01925TauE 0.29
PF01796OB_aCoA_assoc 0.29
PF05193Peptidase_M16_C 0.29
PF00501AMP-binding 0.29
PF01436NHL 0.29
PF09334tRNA-synt_1g 0.29
PF13953PapC_C 0.29
PF05683Fumerase_C 0.29
PF01019G_glu_transpept 0.29
PF02699YajC 0.29
PF01636APH 0.29
PF00156Pribosyltran 0.29
PF01522Polysacc_deac_1 0.29
PF02771Acyl-CoA_dh_N 0.29
PF13545HTH_Crp_2 0.29
PF01262AlaDh_PNT_C 0.29
PF01909NTP_transf_2 0.29
PF01149Fapy_DNA_glyco 0.29
PF00939Na_sulph_symp 0.29
PF01970TctA 0.29
PF00762Ferrochelatase 0.29
PF11794HpaB_N 0.29
PF01678DAP_epimerase 0.29
PF01053Cys_Met_Meta_PP 0.29
PF00691OmpA 0.29
PF13147Obsolete Pfam Family 0.29
PF01266DAO 0.29
PF00857Isochorismatase 0.29
PF04976DmsC 0.29
PF13249SQHop_cyclase_N 0.29
PF00709Adenylsucc_synt 0.29
PF01728FtsJ 0.29
PF13193AMP-binding_C 0.29
PF14310Fn3-like 0.29
PF01425Amidase 0.29
PF04963Sigma54_CBD 0.29
PF03358FMN_red 0.29
PF00587tRNA-synt_2b 0.29
PF02558ApbA 0.29
PF00381PTS-HPr 0.29
PF00364Biotin_lipoyl 0.29
PF13662Toprim_4 0.29
PF13847Methyltransf_31 0.29
PF12096DUF3572 0.29
PF02878PGM_PMM_I 0.29
PF04055Radical_SAM 0.29
PF01656CbiA 0.29
PF00535Glycos_transf_2 0.29
PF135322OG-FeII_Oxy_2 0.29
PF00011HSP20 0.29
PF02541Ppx-GppA 0.29
PF11799IMS_C 0.29
PF09312SurA_N 0.29
PF05731TROVE 0.29
PF01926MMR_HSR1 0.29
PF12098DUF3574 0.29
PF07995GSDH 0.29
PF04964Flp_Fap 0.29
PF00313CSD 0.29
PF02749QRPTase_N 0.29
PF13641Glyco_tranf_2_3 0.29
PF07021MetW 0.29
PF04339FemAB_like 0.29
PF02082Rrf2 0.29
PF00462Glutaredoxin 0.29
PF12704MacB_PCD 0.29
PF01783Ribosomal_L32p 0.29
PF13807GNVR 0.29
PF03960ArsC 0.29
PF02686Glu-tRNAGln 0.29
PF02569Pantoate_ligase 0.29
PF09285Elong-fact-P_C 0.29
PF02515CoA_transf_3 0.29
PF07977FabA 0.29
PF04377ATE_C 0.29
PF05118Asp_Arg_Hydrox 0.29
PF12200DUF3597 0.29
PF00719Pyrophosphatase 0.29
PF02211NHase_beta 0.29
PF00120Gln-synt_C 0.29
PF00456Transketolase_N 0.29
PF13432TPR_16 0.29
PF01564Spermine_synth 0.29
PF07372DUF1491 0.29
PF00275EPSP_synthase 0.29
PF01041DegT_DnrJ_EryC1 0.29
PF03167UDG 0.29
PF01738DLH 0.29
PF03454MoeA_C 0.29
PF01322Cytochrom_C_2 0.29
PF04107GCS2 0.29
PF05050Methyltransf_21 0.29
PF14579HHH_6 0.29
PF02954HTH_8 0.29
PF00180Iso_dh 0.29
PF00749tRNA-synt_1c 0.29
PF03631Virul_fac_BrkB 0.29
PF00330Aconitase 0.29
PF04126Cyclophil_like 0.29
PF07309FlaF 0.29
PF13649Methyltransf_25 0.29
PF01503PRA-PH 0.29
PF02230Abhydrolase_2 0.29
PF00753Lactamase_B 0.29
PF03602Cons_hypoth95 0.29
PF01192RNA_pol_Rpb6 0.29
PF01988VIT1 0.29
PF04073tRNA_edit 0.29
PF01070FMN_dh 0.29
PF03306AAL_decarboxy 0.29
PF13577SnoaL_4 0.29
PF00977His_biosynth 0.29
PF14087DUF4267 0.29
PF12833HTH_18 0.29
PF00543P-II 0.29
PF03711OKR_DC_1_C 0.29
PF06155GBBH-like_N 0.29
PF04390LptE 0.29
PF00861Ribosomal_L18p 0.29
PF01144CoA_trans 0.29
PF01321Creatinase_N 0.29
PF07100ASRT 0.29
PF00496SBP_bac_5 0.29
PF00534Glycos_transf_1 0.29
PF00793DAHP_synth_1 0.29
PF05598DUF772 0.29
PF01710HTH_Tnp_IS630 0.29
PF00892EamA 0.29
PF09084NMT1 0.29
PF09722Xre_MbcA_ParS_C 0.29
PF028262-Hacid_dh_C 0.29
PF05974DUF892 0.29
PF00160Pro_isomerase 0.29
PF00664ABC_membrane 0.29
PF03328HpcH_HpaI 0.29
PF00296Bac_luciferase 0.29
PF14748P5CR_dimer 0.29
PF12002MgsA_C 0.29
PF03453MoeA_N 0.29
PF01025GrpE 0.29
PF03379CcmB 0.29
PF03330DPBB_1 0.29
PF07813LTXXQ 0.29
PF00361Proton_antipo_M 0.29
PF018125-FTHF_cyc-lig 0.29
PF13434Lys_Orn_oxgnase 0.29
PF00132Hexapep 0.29
PF07366SnoaL 0.29
PF01583APS_kinase 0.29
PF03466LysR_substrate 0.29

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 341 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 2.05
COG2942Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase familyCarbohydrate transport and metabolism [G] 1.47
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 1.17
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.17
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 1.17
COG2370Hydrogenase/urease accessory protein HupEPosttranslational modification, protein turnover, chaperones [O] 0.88
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.88
COG0248Exopolyphosphatase/pppGpp-phosphohydrolaseSignal transduction mechanisms [T] 0.59
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.59
COG0303Molybdopterin Mo-transferase (molybdopterin biosynthesis)Coenzyme transport and metabolism [H] 0.59
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.59
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.59
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.59
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.59
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.59
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.59
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.59
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 0.59
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.59
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.59
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.59
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.59
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.59
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.59
COG3293TransposaseMobilome: prophages, transposons [X] 0.59
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.59
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.59
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.59
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.59
COG5421TransposaseMobilome: prophages, transposons [X] 0.59
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.59
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.59
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.29
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.29
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.29
COG0104Adenylosuccinate synthaseNucleotide transport and metabolism [F] 0.29
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.29
COG0157Nicotinate-nucleotide pyrophosphorylaseCoenzyme transport and metabolism [H] 0.29
COG02125-formyltetrahydrofolate cyclo-ligaseCoenzyme transport and metabolism [H] 0.29
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 0.29
COG0253Diaminopimelate epimeraseAmino acid transport and metabolism [E] 0.29
COG0256Ribosomal protein L18Translation, ribosomal structure and biogenesis [J] 0.29
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.29
COG0276Protoheme ferro-lyase (ferrochelatase)Coenzyme transport and metabolism [H] 0.29
COG029323S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJTranslation, ribosomal structure and biogenesis [J] 0.29
COG0333Ribosomal protein L32Translation, ribosomal structure and biogenesis [J] 0.29
COG0347Nitrogen regulatory protein PIISignal transduction mechanisms [T] 0.29
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.29
COG0414Panthothenate synthetaseCoenzyme transport and metabolism [H] 0.29
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.29
COG0471Di- and tricarboxylate antiporterCarbohydrate transport and metabolism [G] 0.29
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG0529Adenylylsulfate kinase or related kinaseInorganic ion transport and metabolism [P] 0.29
COG0576Molecular chaperone GrpE (heat shock protein HSP-70)Posttranslational modification, protein turnover, chaperones [O] 0.29
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.29
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.29
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.29
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.29
COG0721Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunitTranslation, ribosomal structure and biogenesis [J] 0.29
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.29
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.29
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 0.29
COG0760Peptidyl-prolyl isomerase, parvulin familyPosttranslational modification, protein turnover, chaperones [O] 0.29
COG07643-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydrataseLipid transport and metabolism [I] 0.29
COG1055Na+/H+ antiporter NhaD or related arsenite permeaseInorganic ion transport and metabolism [P] 0.29
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 0.29
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.29
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 0.29
COG1189Predicted rRNA methylase YqxC, contains S4 and FtsJ domainsTranslation, ribosomal structure and biogenesis [J] 0.29
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.29
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.29
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.29
COG1393Arsenate reductase or related protein, glutaredoxin familyInorganic ion transport and metabolism [P] 0.29
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.29
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 0.29
COG1508DNA-directed RNA polymerase specialized sigma subunit, sigma54 homologTranscription [K] 0.29
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.29
COG1545Uncharacterized OB-fold protein, contains Zn-ribbon domainGeneral function prediction only [R] 0.29
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.29
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.29
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.29
COG1758DNA-directed RNA polymerase, subunit K/omegaTranscription [K] 0.29
COG1784TctA family transporterGeneral function prediction only [R] 0.29
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.29
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.29
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.29
COG1838Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domainEnergy production and conversion [C] 0.29
COG1862Protein translocase subunit YajCIntracellular trafficking, secretion, and vesicular transport [U] 0.29
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG1925HPr or related phosphotransfer proteinSignal transduction mechanisms [T] 0.29
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.29
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.29
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.29
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.29
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.29
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.29
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.29
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.29
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 0.29
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 0.29
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.29
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.29
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 0.29
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.29
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 0.29
COG2935Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.29
COG2980Outer membrane lipoprotein LptE/RlpB (LPS assembly)Cell wall/membrane/envelope biogenesis [M] 0.29
COG3146Predicted N-acyltransferaseGeneral function prediction only [R] 0.29
COG3302DMSO reductase anchor subunit DmsCEnergy production and conversion [C] 0.29
COG3333TctA family transporterGeneral function prediction only [R] 0.29
COG3415CRISPR-associated protein Csa3, CARF domainDefense mechanisms [V] 0.29
COG3527Alpha-acetolactate decarboxylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.29
COG3536Uncharacterized conserved protein, DUF971 familyFunction unknown [S] 0.29
COG3555Aspartyl/asparaginyl beta-hydroxylase, cupin superfamilyPosttranslational modification, protein turnover, chaperones [O] 0.29
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.29
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.29
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.29
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 0.29
COG3909Cytochrome c556Energy production and conversion [C] 0.29
COG3959Transketolase, N-terminal subunitCarbohydrate transport and metabolism [G] 0.29
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.29
COG4288Uncharacterized conserved proteinFunction unknown [S] 0.29
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.29
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.29
COG4706Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domainLipid transport and metabolism [I] 0.29
COG5442Flagellar biosynthesis regulator FlaFCell motility [N] 0.29
COG5447Uncharacterized conserved protein, DUF1491 domainFunction unknown [S] 0.29
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.29
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG0021TransketolaseCarbohydrate transport and metabolism [G] 0.29
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 0.29
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.29

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.19 %
UnclassifiedrootN/A25.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100865158All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105864527All Organisms → cellular organisms → Bacteria → Proteobacteria2805Open in IMG/M
3300000955|JGI1027J12803_101400003Not Available800Open in IMG/M
3300000955|JGI1027J12803_102453196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1144Open in IMG/M
3300002245|JGIcombinedJ26739_100797977Not Available824Open in IMG/M
3300003659|JGI25404J52841_10072729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria718Open in IMG/M
3300005167|Ga0066672_10228911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1192Open in IMG/M
3300005293|Ga0065715_10755766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300005332|Ga0066388_100205938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2590Open in IMG/M
3300005332|Ga0066388_101254794All Organisms → cellular organisms → Bacteria → Proteobacteria1273Open in IMG/M
3300005332|Ga0066388_103300538All Organisms → cellular organisms → Bacteria → Proteobacteria824Open in IMG/M
3300005332|Ga0066388_103863228Not Available764Open in IMG/M
3300005332|Ga0066388_106198882All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria604Open in IMG/M
3300005347|Ga0070668_100718954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria882Open in IMG/M
3300005353|Ga0070669_100819342All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300005435|Ga0070714_100066374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata3109Open in IMG/M
3300005435|Ga0070714_100696750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria980Open in IMG/M
3300005436|Ga0070713_101603126All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005511|Ga0077121_10381434Not Available995Open in IMG/M
3300005529|Ga0070741_10079122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3630Open in IMG/M
3300005529|Ga0070741_10645183All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300005537|Ga0070730_10046120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3177Open in IMG/M
3300005537|Ga0070730_10054571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2871Open in IMG/M
3300005538|Ga0070731_10066573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2391Open in IMG/M
3300005538|Ga0070731_10744302Not Available651Open in IMG/M
3300005543|Ga0070672_100164498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1842Open in IMG/M
3300005543|Ga0070672_100516221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1035Open in IMG/M
3300005554|Ga0066661_10034990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2799Open in IMG/M
3300005554|Ga0066661_10193080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae1259Open in IMG/M
3300005560|Ga0066670_10338992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae916Open in IMG/M
3300005561|Ga0066699_10810666All Organisms → cellular organisms → Bacteria → Proteobacteria659Open in IMG/M
3300005562|Ga0058697_10376254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300005569|Ga0066705_10072232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1994Open in IMG/M
3300005569|Ga0066705_10094337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1769Open in IMG/M
3300005587|Ga0066654_10850866All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300005598|Ga0066706_11497324Not Available508Open in IMG/M
3300005614|Ga0068856_101610638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300005617|Ga0068859_101365765Not Available781Open in IMG/M
3300005617|Ga0068859_101681629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria701Open in IMG/M
3300005713|Ga0066905_100745110Not Available845Open in IMG/M
3300005713|Ga0066905_101047262All Organisms → cellular organisms → Bacteria → Proteobacteria722Open in IMG/M
3300005713|Ga0066905_101381381Not Available637Open in IMG/M
3300005764|Ga0066903_100141684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3422Open in IMG/M
3300005764|Ga0066903_100205826All Organisms → cellular organisms → Bacteria2954Open in IMG/M
3300005764|Ga0066903_100341184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2412Open in IMG/M
3300005764|Ga0066903_100410323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2235Open in IMG/M
3300005764|Ga0066903_100702193Not Available1783Open in IMG/M
3300005764|Ga0066903_100740488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp.1743Open in IMG/M
3300005764|Ga0066903_101066530All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300005764|Ga0066903_101155265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium1433Open in IMG/M
3300005764|Ga0066903_101412467All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1308Open in IMG/M
3300005764|Ga0066903_101446814All Organisms → cellular organisms → Bacteria → Proteobacteria1294Open in IMG/M
3300005764|Ga0066903_101891281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium1143Open in IMG/M
3300005764|Ga0066903_101963822All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1123Open in IMG/M
3300005764|Ga0066903_102630344All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300005764|Ga0066903_103151355All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300005764|Ga0066903_103922119All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005764|Ga0066903_104088257All Organisms → cellular organisms → Bacteria → Proteobacteria782Open in IMG/M
3300005764|Ga0066903_104582607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria737Open in IMG/M
3300005764|Ga0066903_105079050Not Available697Open in IMG/M
3300005764|Ga0066903_105462464Not Available670Open in IMG/M
3300005764|Ga0066903_105534303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp.666Open in IMG/M
3300005764|Ga0066903_106509272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Candidatus Afipia apatlaquensis609Open in IMG/M
3300005764|Ga0066903_107141979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.578Open in IMG/M
3300005764|Ga0066903_108419928Not Available526Open in IMG/M
3300005921|Ga0070766_10489950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium815Open in IMG/M
3300005921|Ga0070766_10641246Not Available716Open in IMG/M
3300005921|Ga0070766_10675967All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium698Open in IMG/M
3300005983|Ga0081540_1000183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria65356Open in IMG/M
3300005983|Ga0081540_1325382All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300005985|Ga0081539_10013948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas5997Open in IMG/M
3300006028|Ga0070717_10038681All Organisms → cellular organisms → Bacteria → Proteobacteria3878Open in IMG/M
3300006028|Ga0070717_10236476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp.1610Open in IMG/M
3300006028|Ga0070717_10705525All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300006028|Ga0070717_10867336Not Available822Open in IMG/M
3300006028|Ga0070717_11014378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria756Open in IMG/M
3300006028|Ga0070717_11152608All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria706Open in IMG/M
3300006028|Ga0070717_11297931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300006032|Ga0066696_10894863All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria565Open in IMG/M
3300006038|Ga0075365_10826087All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300006052|Ga0075029_100184340Not Available1297Open in IMG/M
3300006057|Ga0075026_100081798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1576Open in IMG/M
3300006057|Ga0075026_101062144Not Available507Open in IMG/M
3300006059|Ga0075017_101374381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales555Open in IMG/M
3300006163|Ga0070715_10004479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4589Open in IMG/M
3300006163|Ga0070715_10147655Not Available1149Open in IMG/M
3300006163|Ga0070715_10215783Not Available983Open in IMG/M
3300006172|Ga0075018_10436996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria672Open in IMG/M
3300006173|Ga0070716_100968836All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05671Open in IMG/M
3300006173|Ga0070716_101438367All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006175|Ga0070712_100522093All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300006175|Ga0070712_101076831All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300006175|Ga0070712_101448801Not Available600Open in IMG/M
3300006175|Ga0070712_101472544All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300006176|Ga0070765_100462175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1190Open in IMG/M
3300006176|Ga0070765_100532865Not Available1105Open in IMG/M
3300006176|Ga0070765_101396399Not Available660Open in IMG/M
3300006176|Ga0070765_101963283All Organisms → cellular organisms → Bacteria → Proteobacteria548Open in IMG/M
3300006794|Ga0066658_10572111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae614Open in IMG/M
3300006796|Ga0066665_11417262All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300006797|Ga0066659_11841132Not Available513Open in IMG/M
3300006806|Ga0079220_11211857All Organisms → cellular organisms → Bacteria → Proteobacteria624Open in IMG/M
3300006854|Ga0075425_100512573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1381Open in IMG/M
3300006854|Ga0075425_100799615All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300006854|Ga0075425_100804840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1077Open in IMG/M
3300006871|Ga0075434_101382823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium714Open in IMG/M
3300006871|Ga0075434_101474151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300006893|Ga0073928_10416084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria980Open in IMG/M
3300006903|Ga0075426_11515918All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006904|Ga0075424_102313652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
3300006914|Ga0075436_100077857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2297Open in IMG/M
3300006914|Ga0075436_100795816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300006953|Ga0074063_13547546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae764Open in IMG/M
3300007004|Ga0079218_11506384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300009143|Ga0099792_11000656Not Available558Open in IMG/M
3300009174|Ga0105241_10979205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria790Open in IMG/M
3300009235|Ga0103857_10083657All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300009553|Ga0105249_11001568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria904Open in IMG/M
3300009799|Ga0105075_1036321All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
3300010040|Ga0126308_10089545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium R_SAG101867Open in IMG/M
3300010043|Ga0126380_11561351All Organisms → cellular organisms → Bacteria → Proteobacteria587Open in IMG/M
3300010043|Ga0126380_12232898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300010046|Ga0126384_11299640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales675Open in IMG/M
3300010046|Ga0126384_11571810Not Available618Open in IMG/M
3300010052|Ga0133944_1001835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales39768Open in IMG/M
3300010326|Ga0134065_10351894Not Available579Open in IMG/M
3300010358|Ga0126370_12316170All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300010360|Ga0126372_11022983All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300010360|Ga0126372_11866735All Organisms → cellular organisms → Bacteria → Proteobacteria645Open in IMG/M
3300010360|Ga0126372_12506594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria567Open in IMG/M
3300010360|Ga0126372_12626927All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300010361|Ga0126378_10561191All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300010362|Ga0126377_13401120All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010362|Ga0126377_13496908Not Available508Open in IMG/M
3300010366|Ga0126379_12347238Not Available633Open in IMG/M
3300010366|Ga0126379_12513276All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300010376|Ga0126381_100049411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5142Open in IMG/M
3300010376|Ga0126381_100789221All Organisms → cellular organisms → Bacteria → Proteobacteria1363Open in IMG/M
3300010376|Ga0126381_102185230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae796Open in IMG/M
3300010376|Ga0126381_102737551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp.704Open in IMG/M
3300010398|Ga0126383_10279256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1656Open in IMG/M
3300010398|Ga0126383_11673502Not Available725Open in IMG/M
3300010398|Ga0126383_13560019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 41S5509Open in IMG/M
3300010398|Ga0126383_13597673Not Available506Open in IMG/M
3300010399|Ga0134127_13234872Not Available532Open in IMG/M
3300010400|Ga0134122_10341037All Organisms → cellular organisms → Bacteria → Proteobacteria1301Open in IMG/M
3300010860|Ga0126351_1093772Not Available709Open in IMG/M
3300011271|Ga0137393_10438673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1119Open in IMG/M
3300011413|Ga0137333_1067446All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria818Open in IMG/M
3300011445|Ga0137427_10186071All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales861Open in IMG/M
3300012149|Ga0153941_1024039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1187Open in IMG/M
3300012168|Ga0137357_1031929All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300012169|Ga0153990_1148844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales522Open in IMG/M
3300012181|Ga0153922_1038222All Organisms → cellular organisms → Bacteria → Proteobacteria1068Open in IMG/M
3300012199|Ga0137383_10050883All Organisms → cellular organisms → Bacteria → Proteobacteria2961Open in IMG/M
3300012677|Ga0153928_1000131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales39286Open in IMG/M
3300012685|Ga0137397_11273319Not Available525Open in IMG/M
3300012912|Ga0157306_10071418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales934Open in IMG/M
3300012917|Ga0137395_10306278All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1126Open in IMG/M
3300012930|Ga0137407_10877182All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300012971|Ga0126369_10169139Not Available2076Open in IMG/M
3300012971|Ga0126369_10322476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1555Open in IMG/M
3300012971|Ga0126369_10597983Not Available1173Open in IMG/M
3300012971|Ga0126369_13580621Not Available509Open in IMG/M
3300013297|Ga0157378_11790161Not Available662Open in IMG/M
3300013306|Ga0163162_13299304Not Available517Open in IMG/M
3300014199|Ga0181535_10118266Not Available1689Open in IMG/M
3300014325|Ga0163163_11216475Not Available816Open in IMG/M
3300014326|Ga0157380_10745776Not Available990Open in IMG/M
3300014326|Ga0157380_12512150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium581Open in IMG/M
3300014654|Ga0181525_10159444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1236Open in IMG/M
3300015245|Ga0137409_10037951All Organisms → cellular organisms → Bacteria → Proteobacteria4639Open in IMG/M
3300015264|Ga0137403_10284329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1554Open in IMG/M
3300015371|Ga0132258_12704997Not Available1238Open in IMG/M
3300015374|Ga0132255_104288072Not Available605Open in IMG/M
3300016294|Ga0182041_11178990Not Available698Open in IMG/M
3300016319|Ga0182033_10217845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1530Open in IMG/M
3300016319|Ga0182033_11377548All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300016404|Ga0182037_10937683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae752Open in IMG/M
3300017822|Ga0187802_10000138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales16449Open in IMG/M
3300017928|Ga0187806_1047310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1304Open in IMG/M
3300017970|Ga0187783_10010021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14626965Open in IMG/M
3300017972|Ga0187781_10131488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1750Open in IMG/M
3300017972|Ga0187781_10302303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1135Open in IMG/M
3300017972|Ga0187781_10465735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila906Open in IMG/M
3300017972|Ga0187781_10656425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300017975|Ga0187782_10368757Not Available1088Open in IMG/M
3300017975|Ga0187782_10437998Not Available996Open in IMG/M
3300017975|Ga0187782_10537076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium896Open in IMG/M
3300017975|Ga0187782_10612143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria837Open in IMG/M
3300017975|Ga0187782_11241375Not Available584Open in IMG/M
3300017994|Ga0187822_10354399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei531Open in IMG/M
3300018028|Ga0184608_10479795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300018058|Ga0187766_10341805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales978Open in IMG/M
3300018062|Ga0187784_10005157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10576Open in IMG/M
3300018064|Ga0187773_10771861Not Available608Open in IMG/M
3300018066|Ga0184617_1165587All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300018085|Ga0187772_10508800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria850Open in IMG/M
3300018422|Ga0190265_10985153All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300018468|Ga0066662_10347898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1273Open in IMG/M
3300018482|Ga0066669_10842586All Organisms → cellular organisms → Bacteria → Proteobacteria815Open in IMG/M
3300020579|Ga0210407_11317869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales539Open in IMG/M
3300020583|Ga0210401_10124452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2418Open in IMG/M
3300020583|Ga0210401_10458818Not Available1137Open in IMG/M
3300020583|Ga0210401_10947016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300020583|Ga0210401_11262576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria597Open in IMG/M
3300021088|Ga0210404_10129854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1303Open in IMG/M
3300021088|Ga0210404_10470977All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300021088|Ga0210404_10587039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria633Open in IMG/M
3300021088|Ga0210404_10771314All Organisms → cellular organisms → Bacteria → Proteobacteria549Open in IMG/M
3300021170|Ga0210400_10736492Not Available810Open in IMG/M
3300021170|Ga0210400_10795038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales776Open in IMG/M
3300021178|Ga0210408_10001493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales24410Open in IMG/M
3300021178|Ga0210408_10002061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales20080Open in IMG/M
3300021178|Ga0210408_10003067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales15618Open in IMG/M
3300021362|Ga0213882_10131584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1021Open in IMG/M
3300021374|Ga0213881_10046827All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300021374|Ga0213881_10094358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1291Open in IMG/M
3300021374|Ga0213881_10105791Not Available1219Open in IMG/M
3300021374|Ga0213881_10124120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1124Open in IMG/M
3300021384|Ga0213876_10046722All Organisms → cellular organisms → Bacteria → Proteobacteria2289Open in IMG/M
3300021384|Ga0213876_10175794All Organisms → cellular organisms → Bacteria → Proteobacteria1139Open in IMG/M
3300021384|Ga0213876_10187594All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300021388|Ga0213875_10390313Not Available663Open in IMG/M
3300021388|Ga0213875_10588503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium537Open in IMG/M
3300021407|Ga0210383_11390435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae584Open in IMG/M
3300021432|Ga0210384_10178347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1909Open in IMG/M
3300021432|Ga0210384_10202562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601784Open in IMG/M
3300021439|Ga0213879_10170354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria639Open in IMG/M
3300021476|Ga0187846_10048621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1881Open in IMG/M
3300021476|Ga0187846_10276633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus696Open in IMG/M
3300021476|Ga0187846_10381184All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300021478|Ga0210402_11395601All Organisms → cellular organisms → Bacteria → Proteobacteria628Open in IMG/M
3300021559|Ga0210409_10008185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales10676Open in IMG/M
3300021560|Ga0126371_10025926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5450Open in IMG/M
3300025297|Ga0209758_1104827Not Available795Open in IMG/M
3300025474|Ga0208479_1089993All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium567Open in IMG/M
3300025901|Ga0207688_10191783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1222Open in IMG/M
3300025904|Ga0207647_10405194Not Available768Open in IMG/M
3300025904|Ga0207647_10803021Not Available506Open in IMG/M
3300025906|Ga0207699_10506859All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300025906|Ga0207699_10863498All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300025908|Ga0207643_10204423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1204Open in IMG/M
3300025914|Ga0207671_10345337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Rc2d1180Open in IMG/M
3300025928|Ga0207700_10459688Not Available1123Open in IMG/M
3300025929|Ga0207664_10406573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621211Open in IMG/M
3300025929|Ga0207664_10568537Not Available1018Open in IMG/M
3300025933|Ga0207706_11523562All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300025936|Ga0207670_11396950Not Available594Open in IMG/M
3300025938|Ga0207704_11652226Not Available550Open in IMG/M
3300025986|Ga0207658_10956462Not Available781Open in IMG/M
3300026088|Ga0207641_11577505All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300026309|Ga0209055_1111495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides daphniae1064Open in IMG/M
3300026530|Ga0209807_1054676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1828Open in IMG/M
3300026550|Ga0209474_10461317All Organisms → cellular organisms → Bacteria → Proteobacteria645Open in IMG/M
3300026552|Ga0209577_10035697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4294Open in IMG/M
3300026552|Ga0209577_10138614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1927Open in IMG/M
3300026552|Ga0209577_10176630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1659Open in IMG/M
3300026552|Ga0209577_10411908Not Available967Open in IMG/M
3300026552|Ga0209577_10431706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales930Open in IMG/M
3300026863|Ga0209902_103672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3159Open in IMG/M
3300026988|Ga0207834_1025796All Organisms → cellular organisms → Bacteria → Proteobacteria701Open in IMG/M
3300027857|Ga0209166_10271865All Organisms → cellular organisms → Bacteria → Proteobacteria896Open in IMG/M
3300027869|Ga0209579_10404010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales740Open in IMG/M
3300027874|Ga0209465_10116047All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300027874|Ga0209465_10496134Not Available610Open in IMG/M
3300027889|Ga0209380_10123471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1507Open in IMG/M
3300027898|Ga0209067_10932309Not Available511Open in IMG/M
3300028720|Ga0307317_10157263Not Available764Open in IMG/M
3300028824|Ga0307310_10645670Not Available541Open in IMG/M
3300028906|Ga0308309_10629618All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300028906|Ga0308309_11136370Not Available675Open in IMG/M
3300028906|Ga0308309_11648426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales545Open in IMG/M
3300029636|Ga0222749_10166291All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300031057|Ga0170834_104548438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1237Open in IMG/M
3300031128|Ga0170823_15951238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1432Open in IMG/M
3300031226|Ga0307497_10170933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales919Open in IMG/M
3300031446|Ga0170820_11242908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria969Open in IMG/M
3300031446|Ga0170820_15065383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2361Open in IMG/M
3300031543|Ga0318516_10780041All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031544|Ga0318534_10538718Not Available665Open in IMG/M
3300031545|Ga0318541_10039669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2377Open in IMG/M
3300031547|Ga0310887_10780036Not Available599Open in IMG/M
3300031564|Ga0318573_10734023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales531Open in IMG/M
3300031682|Ga0318560_10084349All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300031711|Ga0265314_10005299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales11670Open in IMG/M
3300031715|Ga0307476_10676740Not Available764Open in IMG/M
3300031715|Ga0307476_10764869Not Available715Open in IMG/M
3300031718|Ga0307474_11078360Not Available636Open in IMG/M
3300031720|Ga0307469_11234681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales708Open in IMG/M
3300031720|Ga0307469_11919128Not Available574Open in IMG/M
3300031730|Ga0307516_10761931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium628Open in IMG/M
3300031744|Ga0306918_11338355All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300031753|Ga0307477_10390864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → Rhodobium → Rhodobium orientis953Open in IMG/M
3300031753|Ga0307477_10799874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales626Open in IMG/M
3300031765|Ga0318554_10585779Not Available629Open in IMG/M
3300031768|Ga0318509_10452311Not Available718Open in IMG/M
3300031768|Ga0318509_10491478All Organisms → cellular organisms → Bacteria → Proteobacteria686Open in IMG/M
3300031782|Ga0318552_10526354All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300031797|Ga0318550_10129320All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300031820|Ga0307473_11448076All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300031823|Ga0307478_10465632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1052Open in IMG/M
3300031823|Ga0307478_10595769Not Available924Open in IMG/M
3300031823|Ga0307478_11547669Not Available548Open in IMG/M
3300031845|Ga0318511_10439477All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300031854|Ga0310904_10634318Not Available733Open in IMG/M
3300031858|Ga0310892_11290434Not Available522Open in IMG/M
3300031879|Ga0306919_11206137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300031890|Ga0306925_11948966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria556Open in IMG/M
3300031912|Ga0306921_10831275All Organisms → cellular organisms → Bacteria → Proteobacteria1053Open in IMG/M
3300031912|Ga0306921_11751775Not Available670Open in IMG/M
3300031941|Ga0310912_11203529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300031954|Ga0306926_11360957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales826Open in IMG/M
3300031959|Ga0318530_10215219All Organisms → cellular organisms → Bacteria → Proteobacteria789Open in IMG/M
3300032039|Ga0318559_10460897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium593Open in IMG/M
3300032059|Ga0318533_10790554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860696Open in IMG/M
3300032059|Ga0318533_10801756All Organisms → cellular organisms → Bacteria → Proteobacteria691Open in IMG/M
3300032068|Ga0318553_10631302Not Available561Open in IMG/M
3300032076|Ga0306924_12239925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria556Open in IMG/M
3300032174|Ga0307470_10112709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1587Open in IMG/M
3300032174|Ga0307470_11853545Not Available512Open in IMG/M
3300032205|Ga0307472_100479727All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300032205|Ga0307472_101246647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales713Open in IMG/M
3300032205|Ga0307472_102025890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium577Open in IMG/M
3300032261|Ga0306920_102138839All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300032892|Ga0335081_10000845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales49278Open in IMG/M
3300032892|Ga0335081_10701264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1228Open in IMG/M
3300032954|Ga0335083_11406695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium ivorense533Open in IMG/M
3300033004|Ga0335084_11434861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria684Open in IMG/M
3300033158|Ga0335077_10768210All Organisms → cellular organisms → Bacteria → Proteobacteria985Open in IMG/M
3300033158|Ga0335077_10876279All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300033158|Ga0335077_11152356Not Available762Open in IMG/M
3300033289|Ga0310914_10045808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3584Open in IMG/M
3300033550|Ga0247829_10508301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium998Open in IMG/M
3300034155|Ga0370498_066558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria813Open in IMG/M
3300034155|Ga0370498_134200Not Available591Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil10.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.35%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.05%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.47%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.47%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots1.47%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.17%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.17%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.17%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens1.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.88%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.88%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.88%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.88%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.59%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.59%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.59%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.59%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.59%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.29%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.29%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.29%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.29%
LiquidEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Liquid0.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.29%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.29%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.29%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.29%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.29%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.29%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.29%
CyanobacterialHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial0.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.29%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.29%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.29%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.29%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.29%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.29%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.29%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.29%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.29%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005511Combined assembly of arab plate scrape MF_Col (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010052Microbial community associated with the xenic strain of Eucapsis sp. UTEX 1529EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012149Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ025 MetaGHost-AssociatedOpen in IMG/M
3300012168Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2EnvironmentalOpen in IMG/M
3300012169Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaGHost-AssociatedOpen in IMG/M
3300012181Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaGHost-AssociatedOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012677Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaGHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300025297Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes)Host-AssociatedOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026863Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-27 (SPAdes)Host-AssociatedOpen in IMG/M
3300026988Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 5 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10086515823300000364SoilMILSDLPTPPEATFHAMGPWKGFAQAGNRCPLFGIM
INPhiseqgaiiFebDRAFT_10586452713300000364SoilMILSDLPTPASVHATGSCKGFAQAGNRYALLRIMRQ
JGI1027J12803_10140000313300000955SoilCLRMILSDLPTPAEASVRAVRPRKGFAQAGTRYTLFGIMR*
JGI1027J12803_10245319613300000955SoilMILSDLPTPAEASVHAIGSRKGFAQAGNRFTSRIKS
JGIcombinedJ26739_10079797713300002245Forest SoilIFSDLPSPAEASSQMTNRATGFAQAGNRCPLFGIML*
JGI25404J52841_1007272913300003659Tabebuia Heterophylla RhizosphereLSDLPLPAEASSQTESPAKGFAQAGNRSPFFGIMLYQRTR*
Ga0066672_1022891123300005167SoilMSMIFSDLPSPAEASSRATNSAKGFAQAGNRYPLFGIML*
Ga0065715_1075576623300005293Miscanthus RhizosphereLSLCLRMVLSDLPTPAEASGHATGPRKGFAQAGNRFTLFGIMR*
Ga0066388_10020593833300005332Tropical Forest SoilVHAFSESMIFSDLASPAEASGHATKRTKGFAQAGNRYPLFGIML*
Ga0066388_10125479423300005332Tropical Forest SoilMILSDLASFAEASNETANGWRGFAQAGNRYPLFGIILQAVRA*
Ga0066388_10330053823300005332Tropical Forest SoilYLSMIFSDLASPAEALTEGTSRWQGFAQAGNRFPLFRIML*
Ga0066388_10386322823300005332Tropical Forest SoilWWSMIFSDLPSPAEASVLTAGACKGSAQAGNRFTLFGIML*
Ga0066388_10619888223300005332Tropical Forest SoilMIFSGLASPAEASNRNNGPIMGFAKAGNRYPLFGIMLWARDKGWR
Ga0070668_10071895413300005347Switchgrass RhizosphereWSMIFSDLPSPAEASIHAGGPRHGFAQAGNRYPLFGIMLEGY*
Ga0070669_10081934223300005353Switchgrass RhizosphereMRMILSDLPTPAEASVREIRGCPGFAQAGNRYPLFGIMRYRGASAS
Ga0070714_10006637443300005435Agricultural SoilMIFSDLASPAEASNQVTKRCKGFAQAGNRYPLFGIMRYAANGCLT*
Ga0070714_10069675033300005435Agricultural SoilMISRVFWSMMFSDLPSPAEALSHTTSNAAGFAQAGNRYPLFGIML*
Ga0070713_10160312623300005436Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEASTRTEGLCRGFAQAENRYPVFGIMLKRDCEP*
Ga0077121_1038143423300005511Arabidopsis RhizosphereMIFSDLPAPAEASVLPTRICRGFAQAGNRDTLFGIMLAGS*
Ga0070741_1007912253300005529Surface SoilVILSDLPSPAEASILHEVRRDGFAQAGNRCERFGITRETTSQAS*
Ga0070741_1064518323300005529Surface SoilMIFSDLPSPAEASIRWEDRCDGFAQAGNRHPLFGIML*
Ga0070730_1004612043300005537Surface SoilMIFSDLPSPAEASSRTNNASQGFAQAENRFPLFRIML*
Ga0070730_1005457153300005537Surface SoilMIFSDLPSPAEASGRMEGLCTGFAQAGNRCTLFRIML*
Ga0070731_1006657343300005538Surface SoilMIFSDLPSPAEASSQIDEQCQGFAQAGNRRPLFGIML*
Ga0070731_1074430223300005538Surface SoilMILSDLPWPAEASSQTDAPCQGFAQAGNRRPLFGIMLYGFK
Ga0070672_10016449823300005543Miscanthus RhizosphereMRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGIMR*
Ga0070672_10051622113300005543Miscanthus RhizosphereMIFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR*
Ga0066661_1003499023300005554SoilMIFSDLPSPAEASSQTTDRGRGFAQAGNRYPLFGIML*
Ga0066661_1019308023300005554SoilMIFSDLPSPAEASSQVTSLATGFAQAGNRYPLFGIML*
Ga0066670_1033899223300005560SoilMIFSDLPSPAEALSESATRCHGFAQAGNRFPLFGIML*
Ga0066699_1081066623300005561SoilCLSMIFPDLPSPAEATNERTGVSQGFAQAGNRHPLFGIMR*
Ga0058697_1037625423300005562AgaveMIFSDLPTPAEASVDSQTVQGFAQAGNRYPLFGIML*
Ga0066705_1007223223300005569SoilMIFSDLASPAEARVATRDRYEGFAQAGNRYSLFGIML*
Ga0066705_1009433723300005569SoilMIFSDLASPAEAANESRGGWPGFAQAGNRYPLFGIML*
Ga0066654_1085086623300005587SoilYCLSMIFSDLPSPAEASNETANRCLGFAQAGNRFPLFGIML*
Ga0066706_1149732413300005598SoilMILSDLPSPAEASNETTNRCLGFAQAGNRFPLFGIM
Ga0068856_10161063833300005614Corn RhizosphereMIFPDLPSPAEAAIHEFGRCRGFAQAGNRFPLFGIML*
Ga0068859_10136576523300005617Switchgrass RhizosphereMIFSDQPSPAEASIHNRRRCQGFAQAGNCFTLFGIMRPSPERA*
Ga0068859_10168162923300005617Switchgrass RhizosphereMIFSDLPTPAEASVLSTRMCRGFAQAGNRDTLFGIMLAGS*
Ga0066905_10074511013300005713Tropical Forest SoilMIFSDLPSPAEALSHTTGLCKGFAQAGNRYPLLARA
Ga0066905_10104726223300005713Tropical Forest SoilMIFSDLASPAEALTESTGRRQGFAQAGNRYPLFRTML*
Ga0066905_10138138123300005713Tropical Forest SoilMIFSDLPSPAEASSHRAGCANGFAQAGNRYPLFGIMLYARSACRTERKN*
Ga0066903_10014168423300005764Tropical Forest SoilMIFSDLPSPAEASSHTTNSAKGFAQAGNRYPLFGIVL*
Ga0066903_10020582623300005764Tropical Forest SoilMMFSDLPSPAEASSQTTTGATGFAQAGNRYPLFGIML*
Ga0066903_10034118443300005764Tropical Forest SoilMIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIML*
Ga0066903_10041032323300005764Tropical Forest SoilMDSSFIVWSMIFSDLPSPAEASSKTTNRARGFAQAGNRYPLFGIML*
Ga0066903_10070219323300005764Tropical Forest SoilMMFSDLPSPAEASSQTTDGAKGFAQAGNRYPLFGIML*
Ga0066903_10074048823300005764Tropical Forest SoilMIFSDLPSPAEALSQSMTDATGFAQAGNRFPLFGIMR*
Ga0066903_10106653033300005764Tropical Forest SoilMIFSDLPSLAEASSQTTKRATGFAQAGNRYPLFGIML*
Ga0066903_10115526523300005764Tropical Forest SoilMIFSDLPSPAEAPSRTMNLATGFAQAGNRYPLFGIML*
Ga0066903_10141246723300005764Tropical Forest SoilMIFTDLPSPAEASSRTTDGAKGFAQAGNRYPLFGIM
Ga0066903_10144681433300005764Tropical Forest SoilMIFSDLPSPAEASCEQISGWQSFAQAENPSPLFRIML*
Ga0066903_10189128123300005764Tropical Forest SoilMIFSDLPSPAEASFYALEACQGFAQAGNRFPLFGIMHR*
Ga0066903_10196382223300005764Tropical Forest SoilMSFSDLPSPAEAFFDAAGVCQGFAQAGNRCTLFGIML*
Ga0066903_10237356233300005764Tropical Forest SoilMIFSDLASPAEASCKTMNRTKGYAQAGNRYPLFGIMLQGHFAAFASL*
Ga0066903_10263034423300005764Tropical Forest SoilMIFSDLPSPAEASSQTTIGATGFAQAGNRYPLFGIML*
Ga0066903_10315135543300005764Tropical Forest SoilMIYSDLPSPAEASSHTTDCAKGFAQVGNRHPLFGIML*
Ga0066903_10392211923300005764Tropical Forest SoilMIFSDLASPAEATSHMKFGGQGFAQAGNRYPLFGIMR*
Ga0066903_10408825723300005764Tropical Forest SoilMIFSDLASPAEALTESTGRRQGFAQAGNRYPLFRTMR*
Ga0066903_10458260723300005764Tropical Forest SoilMIFSDLPSPAEASSQTTNGAKGFAQAGNRYPLFGIML*
Ga0066903_10507905023300005764Tropical Forest SoilMILSDLASPAEASSRTTDSAKGFAQAGNRYPLFAIML*
Ga0066903_10546246413300005764Tropical Forest SoilMIFSDLPSPAEASAHTPRACKGFAQAGNRYPLFGIVL
Ga0066903_10553430323300005764Tropical Forest SoilMIFSDLPSPAEASSQTTTGATGFAQAGNRYPLFGIML*
Ga0066903_10650927223300005764Tropical Forest SoilSDLPSPAEASFHTAGVCGGFAQAGNRFTLFGIMLEERMR*
Ga0066903_10714197923300005764Tropical Forest SoilMIFSDLPSPAEASSHATDRAKGFAQAGNRYPLFGIML*
Ga0066903_10841992823300005764Tropical Forest SoilMIFSDLPSPAEASNQAMDCAKGFAQAGNRYPLFGIMR
Ga0070766_1048995023300005921SoilSMILSDLPSPAEAGFAQAGNRYPLFGTMRCCPYPLTAPVSPAT*
Ga0070766_1064124623300005921SoilMIFSDLPSPAEAPGQMTSPYQGFAQAGNRYPLFGIM
Ga0070766_1067596723300005921SoilSFPDLPSPAEASSQTDQRRQGFAQAGNRYPLFGIML*
Ga0081540_1000183583300005983Tabebuia Heterophylla RhizosphereMIFSDLPSPAEATSRTAEAHQGFAQAGNRHPLFGIVL*
Ga0081540_132538223300005983Tabebuia Heterophylla RhizosphereMIFSDLPWPAEACFDAAGARQGFAQAGDRVSLFGIMR*
Ga0081539_1001394863300005985Tabebuia Heterophylla RhizosphereMIFSDLPAPAEALVDRVRPCQGFAQAGNRFPLFEIML*
Ga0070717_1003868133300006028Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEASSQTANCAKGFAQAGNRYPLFGIML*
Ga0070717_1023647613300006028Corn, Switchgrass And Miscanthus RhizosphereMIFSDLASPAEARRHTMNRAKGFAQAGNRFPLFGIML*
Ga0070717_1070552523300006028Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEASSRMDGSLEGFAQAGNRYPLFGIMLA*
Ga0070717_1086733613300006028Corn, Switchgrass And Miscanthus RhizosphereTSSWSMIFSDLPSPAEASSETAKRATGFAQAGNRFPLFGVMLE*
Ga0070717_1101437823300006028Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEASNNTKNRCQGFAQAGNRFPLFGIVL*
Ga0070717_1115260823300006028Corn, Switchgrass And Miscanthus RhizosphereMIFSDLASPAEASSQTNFGGQGFAQAGNRFPLFGIML*
Ga0070717_1129793133300006028Corn, Switchgrass And Miscanthus RhizosphereMIFSDLASPAEASSHTKLGGQGFAQAGNRFPLFGIML*
Ga0066696_1089486323300006032SoilMIFSDQPSPAEASNETTNRWLGFAQAGNRFPLFGIML*
Ga0075365_1082608723300006038Populus EndosphereLSVIFSDLPSPAEALIHTRGLSKGFAQAGNRFPLFGIML
Ga0075029_10018434013300006052WatershedsMIFSDLPSPAEAPLETTDQHAGFAQAGNRYALFWIML*
Ga0075026_10008179823300006057WatershedsMILSDLPSPAEAVSEIAMFAKGFAQAGNRFPLFGIMR*
Ga0075026_10106214423300006057WatershedsMIFSDPASPAEAGHESNSGQSFAQAGNRHPLFGIML
Ga0075017_10137438123300006059WatershedsMIFSDLASPAEALYETISRLHGFAQAGNRRPLFGIML*
Ga0070715_1000447933300006163Corn, Switchgrass And Miscanthus RhizosphereMFSDLASPAEAPSHTMKRSKGFAQAGNRYPLFGIMLYCSGP*
Ga0070715_1014765523300006163Corn, Switchgrass And Miscanthus RhizosphereMMFSDLPSPAEASTQTTSRATGFAQAGKPYPLFGIMR*
Ga0070715_1021578323300006163Corn, Switchgrass And Miscanthus RhizosphereVAAVYFWSMIFSDLPSPAEASSHTTSRATGFAQAGNRYPLFGIMR*
Ga0075018_1043699623300006172WatershedsMIFSDLPSPAEASNGKTKVWQGFAQAGNRFPLFRILL*
Ga0070716_10096883623300006173Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEASSQMTEQLQGFAQAGNRSPLFGIMLR*
Ga0070716_10143836723300006173Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEAPSQTTNRAKGFAQAGNRYPLFGIML*
Ga0070712_10052209323300006175Corn, Switchgrass And Miscanthus RhizosphereMIFSDLASPAEASSPNDGPIMGFAKAGNRYPLFGIML*
Ga0070712_10107683113300006175Corn, Switchgrass And Miscanthus RhizosphereIFSDLASPAEASSPTTFDGQGFAQAGNRLLLFGIML*
Ga0070712_10144880113300006175Corn, Switchgrass And Miscanthus RhizosphereSMMFSDLPSPAEASTQTTSRATGFAQAGKPYPLFGIML*
Ga0070712_10147254423300006175Corn, Switchgrass And Miscanthus RhizosphereMIFSDLASPAEAWNGDTSSWHGFAQAGNRYPLFGIML*
Ga0070765_10046217523300006176SoilMMFPDLPSPAEALCQTTNGTMGFAQAGNRYPLFGIML*
Ga0070765_10053286513300006176SoilMIFSDLPSPAEAPSQMTSRNQGFAQAGNRYPLFGIML
Ga0070765_10139639923300006176SoilMIFSDLPSPAEASNNTTNRCHGFAQAGNRFPLFGIMP*
Ga0070765_10196328313300006176SoilMILPDLPSPAEASGQSHRLRQGFAQAGTRHPLFGIML*
Ga0066658_1057211123300006794SoilMILSDLPTPAEVFVHEKRLRQGFAQAGNRCPLFGIMR*
Ga0066665_1141726223300006796SoilFSDLPSPAEASNETTNRCLGFAQAENRFPLFGIMP*
Ga0066659_1184113213300006797SoilMIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIMR*
Ga0079220_1121185723300006806Agricultural SoilMIFPDLPSPAEASKKDKQLLGFAQAGNRYPLSGIML*
Ga0075425_10051257323300006854Populus RhizosphereMIFSDLPSPAEASSQTMIGATGFAQAGNRFPLFGIML*
Ga0075425_10079961523300006854Populus RhizosphereMIFSDLPSPAEAASKTTTGATGFAQAGNRFPLFGIML*
Ga0075425_10080484033300006854Populus RhizosphereMIFSDLPSPAEASSQTTTGTTGFAQAGNRYPLFGIML*
Ga0075434_10138282313300006871Populus RhizospherePFCWSMIFSDLPSPAEASSQTTNRNKGFAQAGNRSPLFGIML*
Ga0075434_10147415123300006871Populus RhizosphereMIFSDLASPPEASSQTNFGGQGFAQAGNRFSLFGIML*
Ga0073928_1041608423300006893Iron-Sulfur Acid SpringMIFSDLPSPAEASNEPTRSWLSFAQAGNRYPLFGIML*
Ga0075426_1151591823300006903Populus RhizosphereCLSMIFSDLPSPAEASTRTEGLCRGFAQAENRYPVFGIMLKRDCEP*
Ga0075424_10231365213300006904Populus RhizosphereMIFSDLPSPAEAPSPSSRYRLGFAQAGNRYPLFGIML
Ga0075436_10007785723300006914Populus RhizosphereMICSDLPSPAEASSQMTEPSQGFAQAGNRYPLFGIML*
Ga0075436_10079581623300006914Populus RhizosphereMIFSDLASPAEASSHTTFSGQGFAQAGNRYPLFGIML*
Ga0074063_1354754633300006953SoilSMILSDLPTPAEASVHKSGPYLGFAQAGNRFPLFGIMR*
Ga0079218_1150638423300007004Agricultural SoilMILSDLPSPAEASSKKGEPCQGFAQAGNRFPLFGIML
Ga0099792_1100065623300009143Vadose Zone SoilMIFSDLPSPAEAPSHSSRYRLGFAQAGNRYPLFGIML*
Ga0105241_1097920523300009174Corn RhizosphereAAHDFSFWSMIFSDLPSPAEAGFAKAGNRFPLFGIMLTPPR*
Ga0103857_1008365723300009235River WaterMIFSDLPSPAEASGNTTRTYQGFAQAGNRFPLFGIML*
Ga0105249_1100156823300009553Switchgrass RhizosphereCLRMVLSDLPTPAEASGHATGPRKGFAQAGNRFTLFGIMR*
Ga0105075_103632123300009799Groundwater SandSDLPSPAEASSQNDEPCQGFAQAGNRFPLFGIML*
Ga0126308_1008954543300010040Serpentine SoilAKSLCMIFSDPPSPAEAFVHKNGPCQGFAQAGNRCPLFGIML*
Ga0126380_1156135113300010043Tropical Forest SoilMISSDLPSPAEAPNHPTGFAKDFAQAGNRRPLFGIMLYCSSGLP
Ga0126380_1223289813300010043Tropical Forest SoilMISSDLPSPAEASSRKDDLNEGFAQAENRRTLFRIAR*
Ga0126384_1129964023300010046Tropical Forest SoilMILSDLPSPAEAAKRMPNQATGFVQAGNRYPLFGIML*
Ga0126384_1157181013300010046Tropical Forest SoilISFSDLPSPAKASSHAKNLAKGFAQAGNRRPLFRDMR*
Ga0133944_1001835373300010052LiquidMIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML*
Ga0134065_1035189423300010326Grasslands SoilLDSDWSMILSDLPSPAEASSLTAKNCKGFAQAGNRFPLFGNML*
Ga0126370_1231617013300010358Tropical Forest SoilLGYCWSMMSSDLPSPAEASSQTIDGTKGFAQAGNRFPLFGIML*
Ga0126372_1102298323300010360Tropical Forest SoilMILYDLPSPAEASFQMEGACQGFAQAANRFPLFGIML*
Ga0126372_1186673523300010360Tropical Forest SoilMIFSDLASPAEASSQTTNRAKGFAQAGNRYPLFGIML*
Ga0126372_1250659423300010360Tropical Forest SoilMILSDLPSPAEASSKTSNRARGFAQAGNRFPLFGIMRW*
Ga0126372_1262692723300010360Tropical Forest SoilSSDLPSPAEASSQTIDGTKGFAQAGNRFPLFGIML*
Ga0126378_1056119113300010361Tropical Forest SoilMIFSDLPSPAEAPSKNERHCHGFAQAGNRHPLFGIML*
Ga0126377_1340112023300010362Tropical Forest SoilMIFSDLPSPAEALFDTAGPCRGFAQAGNRVTLFGIML*
Ga0126377_1349690823300010362Tropical Forest SoilLCLIFSNLPSRAEASIHVHERCEGFAQGGNRFPLFGIMH*
Ga0126379_1234723823300010366Tropical Forest SoilCWSMMFSDLPSPAEASSQTTTRATGFAQAGNRYPLFGLML*
Ga0126379_1251327623300010366Tropical Forest SoilMILSDLPSPAEASSHEMNYAKGFAQAGNRYPLFGIMH
Ga0126381_10004941183300010376Tropical Forest SoilMIFSDLPSPAEASSRMKRWFEGFAQAGNRYPLFGIML*
Ga0126381_10078922123300010376Tropical Forest SoilMIFPDLPSPAEASSGMPNQATGFAQAGNHYTLFGIML*
Ga0126381_10218523023300010376Tropical Forest SoilMILFDLPSPAEAPTETANHSDGFAQAGNRFPLVGIMR*
Ga0126381_10273755123300010376Tropical Forest SoilMIFSDLPSPAEALSENSTGLLGFAQVGNRFPLFRIML*
Ga0126383_1027925623300010398Tropical Forest SoilMIFSDLPSPAEASSNAHGFRQGFAQAGNRCTLSWIVR*
Ga0126383_1167350213300010398Tropical Forest SoilMIFSDLPSPAEASSHATDRAKGFAQAGNRYPLFGIMLLLRT
Ga0126383_1356001923300010398Tropical Forest SoilMIFSDLASPAEALTEKRGRWQGFALAENRYPLFRIML*
Ga0126383_1359767323300010398Tropical Forest SoilMIFSDLSSPAEASSRVKRWLKGFAQAGNRYPLFGIML*
Ga0134127_1323487223300010399Terrestrial SoilMIFSDLPSPAEEGFAKAGNRYPLFGIMRLRRARERLL
Ga0134122_1034103723300010400Terrestrial SoilMIFSDLPTPAEASVNATGPRQGFAQAGNRFTLFGIMLYAPASQ*
Ga0126351_109377223300010860Boreal Forest SoilSMIFSDLPSPAEAPSQTTNRAKGFAQAGNRYPLFGIML*
Ga0137393_1043867323300011271Vadose Zone SoilMIFSDLASPAEASDEVQMVAKSFAQAGNRFPLFRIML*
Ga0137333_106744613300011413SoilMILCFAFYWGMTFSDLPSPAKASSQNGEPYQGFAQAGNRFPLFGV
Ga0137427_1018607123300011445SoilLSDLPSPAEAGFAKAGNRYPLFGIMRSNPFDDALAE
Ga0153941_102403923300012149Attine Ant Fungus GardensMFFSNPPSPAEAPSQTTIRAKGFAQAGNRYPLFGIML*
Ga0137357_103192923300012168SoilMILSGLPSPAEAGFAKAGNRFPLFGIMLYDSGTTAICSLNAGRDE
Ga0153990_114884423300012169Attine Ant Fungus GardensMIFSDLPSPAEAPSHMMNRTKGFAQAGNRFPLFGIMR*
Ga0153922_103822213300012181Attine Ant Fungus GardensIFSDLASPAEAAAGTTNGSQGFAQAGNRCPFLGIML*
Ga0137383_1005088373300012199Vadose Zone SoilMMFPDLPSPAEASSQMTNSAKGFAQAGNRYPLFGIML
Ga0153928_100013183300012677Attine Ant Fungus GardensMIFSDLPSPAEASSQTTIGDTGFAQAGNRYPLFGIML*
Ga0137397_1127331923300012685Vadose Zone SoilMIFFDLPTPAEASAHTIALRQGFAQAGNRHPLFGIMP*
Ga0157306_1007141823300012912SoilMILSDLPTPAEASFYTTGRRKGFAQAGNRCTLFGIMR*
Ga0137395_1030627823300012917Vadose Zone SoilMIFFDLPSPAEASAHTIALREGFAQAGNRHPLFGIMP*
Ga0137407_1087718213300012930Vadose Zone SoilMIFSDLPTPAEASVHTIELRQGFAQAGNRYPLFGIM
Ga0126369_1016913933300012971Tropical Forest SoilMIFSDLPSPAEAASHTTDRAKGFAQAGNRYPLFGIMLCALVA
Ga0126369_1032247613300012971Tropical Forest SoilLAYCWSMMFSDLPSPAEAPSQMTTGATGFAQAGNRCPLFGIML*
Ga0126369_1059798323300012971Tropical Forest SoilSMIFSDLPSPAEASSHTTNSAKGFAQAGNRYPLFGIVL*
Ga0126369_1358062113300012971Tropical Forest SoilMIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIMLW
Ga0157378_1179016123300013297Miscanthus RhizosphereSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR*
Ga0163162_1329930413300013306Switchgrass RhizosphereDLPTPAEASILSTRMCRGFAQAGNRDTLFGIMLAGS*
Ga0181535_1011826623300014199BogFSDLPSPAEADEFREGRKEGGFAKAGNRYPLFGIML*
Ga0163163_1121647513300014325Switchgrass RhizosphereIFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR*
Ga0157380_1074577623300014326Switchgrass RhizosphereMILSDLPTPAEAFVHQSGGRQGFAQAGNRVQLFGIMRYGLNP
Ga0157380_1251215013300014326Switchgrass RhizosphereMRMILSDLPTPAEASVREIRGCPGFAQAGNRYPLFGIM
Ga0181525_1015944423300014654BogMIFSDLPSPAEADEFREGRKEGGFAKAGNRYPLFGIML*
Ga0137409_1003795123300015245Vadose Zone SoilMIFSDLPSPAEASGRMNGWLEGFAQAGNRYPLFGIML*
Ga0137403_1028432923300015264Vadose Zone SoilMFAYSWSMIFSDLPSPAEAPSHSSRHRLGFAQAGNRYPLFGIML*
Ga0132258_1270499723300015371Arabidopsis RhizosphereWSMIFSDLASPAEASSHTKFGGQAFAQAGNRYPLFGIML*
Ga0132255_10428807213300015374Arabidopsis RhizosphereMIFSDLPTPAEASIHMTRPCQGFAQAGNRYPLFGIMLYF
Ga0182041_1117899033300016294SoilMIFFRLPSPAEASSHTTDRAKGFAQAGNRYPLFGIML
Ga0182033_1021784523300016319SoilMIFSDLASPAEASSETTKPDKGFAQAENRFPLFGIML
Ga0182033_1137754813300016319SoilYWWSMIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIMLEHDR
Ga0182037_1093768323300016404SoilMIFSDLPSPAEASSHTTDRAKGFAQAGNRHPLFGIMR
Ga0187802_1000013883300017822Freshwater SedimentMIFSDLPSPAEAPLETTDQHAGFAQAGNRYALFWIML
Ga0187806_104731023300017928Freshwater SedimentMIFSDLPSPAEASNEDTSGWRGFAQAGNRFPLFWIML
Ga0187783_1001002153300017970Tropical PeatlandMIFSDLASPAEANPPKPSARAGFAKAENRFPLFGIML
Ga0187781_1013148813300017972Tropical PeatlandMISSDLPSPAEALIYRENRCAGFAQAGNRFPLFGIMR
Ga0187781_1030230323300017972Tropical PeatlandMIFSDLPSPAEASSQTASRAKGFAQAGNRFPLFGIML
Ga0187781_1046573523300017972Tropical PeatlandMIFSDLPSPAEASSQTMNRAKGFAQAGNRYPLFGIML
Ga0187781_1065642523300017972Tropical PeatlandWRMMFSDLLSPAETLRETTNRATGFAQAGNRYPLFGIMR
Ga0187782_1036875723300017975Tropical PeatlandMIFSDLPSPAEASLQSKGWGEGFAQAGNRYTLFGIMF
Ga0187782_1043799823300017975Tropical PeatlandMIFSDLPSPAEASNQTMNRPKGFAQAGNRYPLFGIML
Ga0187782_1053707623300017975Tropical PeatlandMIFSDLPSPAEASTQHEGWCASFAQAGNRYTLFGIML
Ga0187782_1061214323300017975Tropical PeatlandMIFSDLPSPAEALIRREGGREGYAQAGNRCTLFGIML
Ga0187782_1124137513300017975Tropical PeatlandMIFSDLPSPAEASIQCERWREGFAQAGNRCTLFGIM
Ga0187822_1035439923300017994Freshwater SedimentFSMSMILSDLASPAEASNETAISCGSFAQAGNRHPLFGIMLY
Ga0187866_104785813300018015PeatlandMIFSHLPAPADAGFAEAENWNPLFGIMLALARDGAA
Ga0184608_1047979523300018028Groundwater SedimentLSDLPSPAEASSQNGEPCQGFAQAGNRFPLFGIMRYLRI
Ga0187766_1034180523300018058Tropical PeatlandMIFSDLASPAEASSQTMIGATGFAQAGNLYPLFGIML
Ga0187784_1000515763300018062Tropical PeatlandMIFSDLPSPAEASTQTMNRAKGFAQAGNRHPFFGIML
Ga0187784_1014063833300018062Tropical PeatlandMIFSDLASLAEAACRHGSDCELTGHAKAGNRYPLFGIML
Ga0187773_1077186123300018064Tropical PeatlandLFEHDLSDLASPAEAENEDASGLHGFAQAANRRPLFGIML
Ga0184617_116558723300018066Groundwater SedimentSSRSFRLSMIFSDLPTPAEASIHEIGRRQGFAQAGNRYPLFGIML
Ga0187772_1050880013300018085Tropical PeatlandMIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGITL
Ga0190265_1098515323300018422SoilIFSDLPSPAEAFVHAMGPCQGFAQAGNRCTLFGIML
Ga0066662_1034789833300018468Grasslands SoilMIFSDLPSPAEASSQTTNGAKGFAQAGNRFPLFGIML
Ga0066669_1084258633300018482Grasslands SoilMIFSDLPSPAEASSETTNRCQGFAQAGNRYPLFGI
Ga0210407_1131786923300020579SoilMMFSDLPSPAEASNGTTKVRRGFAQAGNRYSLFGIVL
Ga0210401_1012445223300020583SoilMLSWSMIFSDLPSPAEASSQTMKRAMGFAQAGNRVPLFGIML
Ga0210401_1045881823300020583SoilMMFSDLASPAEASSQTMDCTKGFAQAGNRYPLFGIML
Ga0210401_1094701623300020583SoilMIFSDLPSPAEASSQTTERAKGYAQAGNRFPLFGIMR
Ga0210401_1126257613300020583SoilMIFSDLPSPAEAPSHMMNRTKGFAQAGNRFPLFGIML
Ga0210401_1161053223300020583SoilDGNDYRSGFWWSMIFSDLPSPGEASNETTNRCLGFAQAGNRYLLFGIML
Ga0210404_1012985433300021088SoilMIFSDLASPAEAPSHTMKRTKGFAQAGNRFPLFGIML
Ga0210404_1047097723300021088SoilMIFSDLPSPAEASNHTISSAMGFAQAGNRYPLFGIML
Ga0210404_1058703913300021088SoilSMIFSDLPSPAEASSQTTDSARGFAQAGNRYPLFGIML
Ga0210404_1077131423300021088SoilHPTLAYSWSMIFSDLPSPAEASSETTKHATGLAQAGNRFPLFGTML
Ga0210400_1073649213300021170SoilFSDLASPAEAPSHTMNRRKGFAQAGNRYPLFGIMLYL
Ga0210400_1079503823300021170SoilMLSWSMIFSDLPSPAEASSQMMKRAMGFAQAGNRVPLFGIML
Ga0210408_1000149363300021178SoilMISCDLPSPAEASTHMMNPTKGFAQAGNRYPFFAIML
Ga0210408_10002061163300021178SoilMMFSDLPSPAEASNHTTSSAAGFAQAGNRYPLFGIML
Ga0210408_1000306763300021178SoilMFSDLASPAEAPSHTMNRRKGFAQAGNRYPLFGIMLYL
Ga0213882_1013158423300021362Exposed RockMIFSDLPSPAEASFRYEKRRDGFAQAGNRYPLFGIMR
Ga0213881_1004682733300021374Exposed RockMIFSDLFSPAEAPSQTTKRANGFAQAGNRFLVFGIML
Ga0213881_1009435823300021374Exposed RockMIFSDLPSPAEASSQTTDRAKGFAQAGNRYPLFGIMR
Ga0213881_1010579113300021374Exposed RockMIFSDLPSPAEASSQTTNSTTGFAQAGNRYPNFGIMRY
Ga0213881_1012412023300021374Exposed RockMIFSDLPSSAEASSQPTKRAKGFAQAGNRCPLFGIMR
Ga0213876_1004672223300021384Plant RootsMIFSDLSSPAEASSRHDEMRQGFARAGNRFTLFGIMR
Ga0213876_1017579413300021384Plant RootsVFFKAYWSMIFSDLPSPAEASNPTTNSTKGFAQAGNRYPLFGI
Ga0213876_1018759413300021384Plant RootsMIFSDLPSPAEASADCEERSNGFAQAGNRHPLFGIML
Ga0213875_1039031313300021388Plant RootsMMFSDLPSPAEASSQTTNRATGYAQAGNRYPLFGIML
Ga0213875_1058850313300021388Plant RootsALGYCWSMMFSDLPSPAEASSDTTNSALGFAQAGSR
Ga0210383_1139043523300021407SoilMIFSDLSSPAEAASQTTIDSAGFAQAGNRCPLFGIML
Ga0210384_1017834733300021432SoilMIFSDLPSPAEASTQNDEPCKGFAQAGNRFPLFGIML
Ga0210384_1020256233300021432SoilMIFSDLPSPAEASSQMTEQLQGFAQAGTRSPLFGIML
Ga0213879_1017035413300021439Bulk SoilFWSMTFSDLASPAEAPSHMMKATKGFAQAGNRFPLFGIMLYLL
Ga0187846_1004862123300021476BiofilmMMFSDLPSPAEASSQLLSRATGFAQAGNRYPLFGIML
Ga0187846_1027663313300021476BiofilmYWSMIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFRIML
Ga0187846_1038118423300021476BiofilmMMFSDLPSPAEASSQLLSRASGFAQAGNRYPLFGIMF
Ga0210402_1139560123300021478SoilMIFSDLSSPAEASSRMNGWLEGFAQAGNRYPLFGIML
Ga0210409_1000818553300021559SoilMFSDLASPAEASSQTMDCTKGFAQAGNRYPLFGIML
Ga0126371_1002592653300021560Tropical Forest SoilMIFSDLPSPAEAPSKNERHCHGFAQAGNRHPLFGIML
Ga0212124_1064011023300022553FreshwaterMIFSDLPSPAEAGFAKAGNRVPLFGIMLAHAPFQQC
Ga0209758_110482713300025297Arabidopsis RhizosphereGAALLRWSMIFSDLPAPAEASVLPTRICRGFAQAGNRDTLFGIMLAGS
Ga0208479_108999313300025474Arctic Peat SoilMILSDLPSPAEAGFAKAGNRFPLFGIMRLLPIPQHRLNQRQRRHR
Ga0207688_1019178333300025901Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPTPAEASIHMDGTRQGFAQAGNRCTLFAIMR
Ga0207647_1040519423300025904Corn RhizosphereMILSDLPAPAEALARVTGSCEGFAQAGNRFTLFGIMRLVTCAAKP
Ga0207647_1080302113300025904Corn RhizosphereVVLRMIFSDLPSPSEAPARTGGLCWGFAQAGNRFPLFGIMRA
Ga0207699_1050685923300025906Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEASSRAEGLPKGFAQAGNRCTLFRIMRSERAADRQ
Ga0207699_1086349823300025906Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEASSKNEQPCEGFAQAGNRRPLFGIML
Ga0207643_1020442313300025908Miscanthus RhizosphereMIFSDLPSPAEALVYATGPCQGFAQAGNRRPLFGI
Ga0207671_1034533713300025914Corn RhizosphereYCVRMILSDLPTPAEASGHATGPRKGFAQAGNRFTLFESRR
Ga0207700_1045968813300025928Corn, Switchgrass And Miscanthus RhizosphereMIFSDLPSPAEASNETTNRCLGFAQAGNRYPLFGIMLRIS
Ga0207664_1040657313300025929Agricultural SoilMIFSDLPSPAEAGFAKAGNRYPLFGIMRLRRARERLLSGRR
Ga0207664_1056853713300025929Agricultural SoilGHALACCLSMIFSDLPSPAEASSQPTIGATGFAQAGNRYTLFGIML
Ga0207706_1152356223300025933Corn RhizosphereMRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLF
Ga0207670_1139695023300025936Switchgrass RhizosphereSMIWSDLPSPAEASVRSVASCQGFAQAGNRFPLFGIMLL
Ga0207704_1165222623300025938Miscanthus RhizosphereYWWSMIISDLPSPAEAFVHTAGLCQGFAQAGNRSTLFGIKH
Ga0207658_1095646223300025986Switchgrass RhizosphereEPGQRSVIRLLIFLSTIFSDLPSPAEAGFAKAGNRFTLFGIMP
Ga0207641_1157750523300026088Switchgrass RhizosphereMRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGISG
Ga0209055_111149533300026309SoilMIFSDLPSPAEASSQVTSLATGFAQAGNRYPLFGIML
Ga0209807_105467623300026530SoilMIFSDLASPAEAANESRGGWPGFAQAGNRYPLFGIML
Ga0209474_1046131713300026550SoilLNMIFSNLPSPAEASNETTSRCLGFAQAGNQFPLFGIML
Ga0209577_1003569723300026552SoilMSMIFSDLPSPAEASSRATNSAKGFAQAGNRYPLFGIML
Ga0209577_1013861423300026552SoilMMFSDLPSPAEASNGTTKVRRGFAQAGNRYPLFGIVL
Ga0209577_1017663013300026552SoilHLYLLIRRAFCLSMIFSDLPSPAEAGFAQAGNRLPLFGIML
Ga0209577_1041190823300026552SoilMIFSDLPSPAEASSQTTNRAKGFAQAGNRYPLFGIMR
Ga0209577_1043170623300026552SoilMIFSDLPSPAEASSQMTPSAKGFAQAGNRYPLFGIMSEAYSTQGVRL
Ga0209902_10367233300026863CyanobacterialMIFSDLPSPAEALPTQKRLSKGSAQAGNRLPLLGIML
Ga0207834_102579613300026988Tropical Forest SoilLLQLFVLSMIFSDLASPAVASTERLGRLHGFAQAGNRYPLFGIML
Ga0209166_1027186523300027857Surface SoilMIFSDLPSPAEASGRMEGLCGGFAQAGNRFPLFRIMLYDRQ
Ga0209579_1040401013300027869Surface SoilTCSDLPSPAEASSQDDQLCQGFAQAGNRHPLFGVML
Ga0209465_1011604713300027874Tropical Forest SoilMIFSDLPSPAEASSETTTRNRGFAQAGNRFPPRIK
Ga0209465_1049613423300027874Tropical Forest SoilMIYSDLPSPAEASSHTTDCAKGFAQVGNRHPLFGIML
Ga0209380_1012347123300027889SoilMIFSDLPSPAEASSQTDQRRQGFAQAGNRYPLFGIML
Ga0209067_1093230913300027898WatershedsLSMIFSDLTSPAEASNETANGWRGFAQAGNRRPLFGIMR
Ga0307317_1015726323300028720SoilMIFSDLPSPAEAPIHPRETMLGFAQAGNRRLLFGIMLY
Ga0307310_1064567013300028824SoilIFSDLPTPAEASVHEVGRREGFAQAGNRFPLFGIMRL
Ga0308309_1062961823300028906SoilMIFSDLASPAEAGFAKAGNRYPLFGIMLCRSVEHRR
Ga0308309_1113637013300028906SoilDLPDLPSPAEASNESTRDWLGFAQAGNRYPLFGIML
Ga0308309_1164842623300028906SoilMTFLRIVIPLYLIGWSMIFSDLPSPAEAGFAQAGNRCPLFGIML
Ga0222749_1016629113300029636SoilLEHDFSDLPSATEASSQATKRAKGFAQAGNQYSLFG
Ga0170834_10454843843300031057Forest SoilAFCLSMIFSDLASPAEASNERASDCRGFAQAGNRHPLFGIKP
Ga0170823_1595123813300031128Forest SoilPYHFCLRMIFSDLPSPAEASKERTRDCLGFAQAGNRLPLFGIMR
Ga0307497_1017093323300031226SoilMRMILSDLPAPAEASVHAIRPCKGFAQAGNRFTLFGIMR
Ga0170820_1124290833300031446Forest SoilMIFSDLASPAEALDETISRLHGFAQAGNRRPLFGIML
Ga0170820_1506538333300031446Forest SoilMFPLFRIMQFWWSMIFSDLPSPAEASNETTNWCLGFAQAGNRLPLFRIML
Ga0318516_1078004123300031543SoilMIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIML
Ga0318534_1053871823300031544SoilMIFSDLASPAGALTEWAGRWQGFAQAGNRYPLFGIVL
Ga0318541_1003966913300031545SoilMIFSDLASPAGALTEWAGRWQGFAQAGNRYPLFGI
Ga0310887_1078003623300031547SoilMILSDLPTPAEASARVTGPREGFAQAGNRFTLFGIIRL
Ga0318573_1073402313300031564SoilSPHSYWWSMIFSDLPSPAEASTHTTDRAKGFAQAGNRSPLFGIML
Ga0318560_1008434913300031682SoilMIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIMR
Ga0265314_10005299123300031711RhizosphereMIFSDLPSPAEASSNTKSLGKGFAQAGNRCTLFGIMH
Ga0307476_1067674013300031715Hardwood Forest SoilWSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML
Ga0307476_1076486913300031715Hardwood Forest SoilAVLYCWSMIFSNLPSPAEASSQNDQPCQGFAQAGNRCPLFGIML
Ga0307474_1107836013300031718Hardwood Forest SoilYWWSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML
Ga0307469_1123468113300031720Hardwood Forest SoilMICSDLPSPAEASGHTTGLCKGVAQPGNRYALFGIML
Ga0307469_1191912823300031720Hardwood Forest SoilMMFSDLPSPAEASSQMKNRAKGFAQAGNQYPLFGIML
Ga0307516_1076193113300031730EctomycorrhizaVFSDLPSPAEASVRTMGPSQGFAQAGNRCTLFGIMF
Ga0306918_1133835513300031744SoilLWSMTLSDLPSPAEASNDQTATWLGFAQAENRYPLFGVML
Ga0307477_1039086433300031753Hardwood Forest SoilHCWSMIFSDLPSPAEASSQVTTGATGFAQAGNRYPLFGIMLY
Ga0307477_1079987413300031753Hardwood Forest SoilMILTDPASLASPAEASTAITSRWHGFAQAGNRHPLFGIMLGS
Ga0318554_1058577923300031765SoilDYVLRMIFSDRASPAEAPSHTTNRTKCFAQAGNRYPLFGIMR
Ga0318509_1045231123300031768SoilYVLRMIFSDRASPAEAPSHTTNRTKCFAQAGNRYPLFGIMR
Ga0318509_1049147813300031768SoilMIFSDLPSPAEASSHTTDRAKGFAQAGNRCPLFGIML
Ga0318552_1052635413300031782SoilLFVLSMIFSNLASPAVTSTERLGRLHGFAQAGNRYPLFGIML
Ga0318550_1012932023300031797SoilMIFSDLASPAEASSETTKPDKGFAQAGNRFPLFGIM
Ga0307473_1144807613300031820Hardwood Forest SoilYWRMILSDLPSPAEASSHTTTSASGFAQAGNRFPLFGIMR
Ga0307478_1046563213300031823Hardwood Forest SoilMIFSELPSPAEASSQNNQPCQGFAQAGNRYPLFGI
Ga0307478_1059576913300031823Hardwood Forest SoilWWSMIFSDLPSPAEASSQNNRPCQGFAQAGNRCPLFGIML
Ga0307478_1154766923300031823Hardwood Forest SoilMIFSDLPSPAEASSQNDQPCQGFAQAGNRYPLFGI
Ga0318511_1043947723300031845SoilVLSMIFSELASPAAASTERLGRLHGFAQAGNRYPLFGIML
Ga0310904_1063431813300031854SoilMILSDLPTPAEASARVTGPREGFAQAGNRFTLFGIIRLVTCAAKQA
Ga0310892_1129043413300031858SoilALCLSMIFSDLASPPEASSQTNFGGQGFAQAGNRFSLFGIML
Ga0306919_1120613713300031879SoilMIFSDLPSPAEASSLTTDRAKGFAQAGNRRPLFRIMLLPIS
Ga0306925_1194896613300031890SoilMIFSDLASPAGALTEWAGRWQGFAQAGTRYPLFGIVLGALSAGGRSS
Ga0306921_1083127523300031912SoilMIFSDLPSPAEASTHTTDRAKGFAQAGNRYPLFGIML
Ga0306921_1175177513300031912SoilMIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGIML
Ga0310912_1120352913300031941SoilAFCLSMTLSDLASPAEASNGRNRDWRGFAQAGNRFSVFGIML
Ga0306926_1136095723300031954SoilMILSDLPSPAEAPRHSSRYRLGFAQAGNRYPLSGIMLEHDR
Ga0318530_1021521923300031959SoilVLLQLFVLSMIFSDLASPAAASTERLGRLHGFAQAGNRYPLFGIML
Ga0318559_1046089723300032039SoilMIFSDLPSLAEASSHWDGLRQGFAQAGNRRPLFGIML
Ga0318533_1079055413300032059SoilSMTLSDLPSPAEASNDQTATWLGFAQAENRYPLFGVML
Ga0318533_1080175623300032059SoilMILSDLPSPAEAPRHSSRYRLGFAQAGNRYPLFGIMLEHDR
Ga0318553_1063130223300032068SoilMIFSDLPSPAEASSHTTDRAKGFAQAGNRHPLFGIML
Ga0306924_1223992523300032076SoilMIFSDLPSPAEASTHTTDRAKGFAQAGNRYPLFGIMLY
Ga0307470_1011270923300032174Hardwood Forest SoilMIFSDLPSPTEASGHTTGLCKGVAQAGNRYALFGIML
Ga0307470_1185354513300032174Hardwood Forest SoilMIFSDLPSPAEASSRAEGLKGFAQAGNRCTLFRIMRSERAADR
Ga0307472_10047972723300032205Hardwood Forest SoilMIFSDLPSPAEAASKTTTGATGFAQAGNRFPLFGIML
Ga0307472_10124664723300032205Hardwood Forest SoilMIFSDLPSPAEAASQTTSGATGFAQAGNRFPLFGIMR
Ga0307472_10202589023300032205Hardwood Forest SoilMIISDLPSPAEAPSQTTDRERGFAQAGNRFPLFGIML
Ga0306920_10213883913300032261SoilMIFSDLPSPAEASSHTTDRAKGFAQAGNRYPLFGI
Ga0335081_10000845283300032892SoilMIFSDLPSPAEAPTQVINGSQGFAQAANRCTLFAIML
Ga0335081_1070126423300032892SoilMIFSDLPSPAEASSNTKNLTKGFAQAGNRFPLFGIMREHHAPAP
Ga0335083_1140669523300032954SoilMIFSDLASPAEAGFAKAGNRFPLFRIMLAIQAIRQMTKAR
Ga0335084_1143486123300033004SoilMIFSGQASPAEAFFHIEGVRPGFAQAGNRYPLFGIML
Ga0335077_1076821023300033158SoilMILSDLPSPAEASSQTKKSAKGFAQAENRFPLFGIML
Ga0335077_1087627923300033158SoilMIFSDLASPAEAPSHTTVRAMGFAQAGNRFPLFGIML
Ga0335077_1115235623300033158SoilMIFSGPPSPAEASLGMSSRAAGFAQAGNQYPLFGIMF
Ga0310914_1004580833300033289SoilMIVSDLPSSAEAGNEDAGGWHGFAQAGNRLPLFGIML
Ga0247829_1050830123300033550SoilMSCSDLPSHAENQNNDPCQGFAQAGNRFSLFRDMR
Ga0370498_066558_659_7723300034155Untreated Peat SoilMILSDLPTPAEAFVNEIGRHQGFAQAGNRFPLFGIML
Ga0370498_134200_11_1243300034155Untreated Peat SoilMILSDLPSPAEASSHNNDPCQGFAQAGNRIPLFGIML

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.