Basic Information | |
---|---|
Family ID | F008098 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 339 |
Average Sequence Length | 45 residues |
Representative Sequence | MKFILGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVIGMLGR |
Number of Associated Samples | 234 |
Number of Associated Scaffolds | 339 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 90.56 % |
% of genes near scaffold ends (potentially truncated) | 18.88 % |
% of genes from short scaffolds (< 2000 bps) | 75.52 % |
Associated GOLD sequencing projects | 215 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.301 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (11.504 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.139 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.888 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 339 Family Scaffolds |
---|---|---|
PF00106 | adh_short | 20.94 |
PF00497 | SBP_bac_3 | 18.88 |
PF01039 | Carboxyl_trans | 14.75 |
PF00890 | FAD_binding_2 | 2.36 |
PF08240 | ADH_N | 2.06 |
PF13561 | adh_short_C2 | 0.88 |
PF13602 | ADH_zinc_N_2 | 0.88 |
PF06823 | DUF1236 | 0.88 |
PF12276 | DUF3617 | 0.88 |
PF03401 | TctC | 0.59 |
PF00293 | NUDIX | 0.59 |
PF00107 | ADH_zinc_N | 0.59 |
PF11146 | DUF2905 | 0.29 |
PF00092 | VWA | 0.29 |
PF00149 | Metallophos | 0.29 |
PF08028 | Acyl-CoA_dh_2 | 0.29 |
PF01322 | Cytochrom_C_2 | 0.29 |
PF03737 | RraA-like | 0.29 |
PF01381 | HTH_3 | 0.29 |
PF02776 | TPP_enzyme_N | 0.29 |
PF01053 | Cys_Met_Meta_PP | 0.29 |
PF07370 | DUF1489 | 0.29 |
PF13417 | GST_N_3 | 0.29 |
PF07883 | Cupin_2 | 0.29 |
PF02353 | CMAS | 0.29 |
PF08734 | GYD | 0.29 |
PF02569 | Pantoate_ligase | 0.29 |
PF13193 | AMP-binding_C | 0.29 |
PF07394 | DUF1501 | 0.29 |
PF14378 | PAP2_3 | 0.29 |
PF13772 | AIG2_2 | 0.29 |
COG ID | Name | Functional Category | % Frequency in 339 Family Scaffolds |
---|---|---|---|
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 14.75 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 14.75 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 14.75 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.59 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.29 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.29 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.29 |
COG0414 | Panthothenate synthetase | Coenzyme transport and metabolism [H] | 0.29 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.29 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.29 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.29 |
COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.29 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.29 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.29 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.29 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.29 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.29 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.29 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.29 |
COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.29 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.29 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.29 |
COG5458 | Uncharacterized conserved protein, DUF1489 domain | Function unknown [S] | 0.29 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.30 % |
Unclassified | root | N/A | 17.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908028|beta3_all_NODE_46954_len_1951_cov_9_980523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2001 | Open in IMG/M |
3300001213|JGIcombinedJ13530_103016073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1099 | Open in IMG/M |
3300001423|JGI20199J14953_1009647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 823 | Open in IMG/M |
3300001538|A10PFW1_10015768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1274 | Open in IMG/M |
3300002549|JGI24130J36418_10005121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4432 | Open in IMG/M |
3300003369|JGI24140J50213_10000439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 19385 | Open in IMG/M |
3300003369|JGI24140J50213_10233702 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300003911|JGI25405J52794_10073314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 749 | Open in IMG/M |
3300003987|Ga0055471_10036780 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300003987|Ga0055471_10279424 | Not Available | 533 | Open in IMG/M |
3300003994|Ga0055435_10117527 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300003996|Ga0055467_10122262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 758 | Open in IMG/M |
3300003998|Ga0055472_10019957 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300004020|Ga0055440_10049189 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300004022|Ga0055432_10172758 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300004025|Ga0055433_10158637 | Not Available | 552 | Open in IMG/M |
3300004114|Ga0062593_102611430 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300004479|Ga0062595_100170588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1300 | Open in IMG/M |
3300004479|Ga0062595_101456902 | Not Available | 628 | Open in IMG/M |
3300004479|Ga0062595_102310214 | Not Available | 530 | Open in IMG/M |
3300004479|Ga0062595_102542419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 512 | Open in IMG/M |
3300004643|Ga0062591_101161745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 749 | Open in IMG/M |
3300005163|Ga0066823_10046130 | Not Available | 774 | Open in IMG/M |
3300005328|Ga0070676_10326808 | Not Available | 1048 | Open in IMG/M |
3300005329|Ga0070683_100637110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
3300005332|Ga0066388_100002012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12064 | Open in IMG/M |
3300005332|Ga0066388_100725891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1597 | Open in IMG/M |
3300005332|Ga0066388_107536354 | Not Available | 546 | Open in IMG/M |
3300005334|Ga0068869_101203639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 666 | Open in IMG/M |
3300005335|Ga0070666_10188392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1449 | Open in IMG/M |
3300005336|Ga0070680_100315573 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300005336|Ga0070680_101191373 | Not Available | 659 | Open in IMG/M |
3300005337|Ga0070682_100143204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1632 | Open in IMG/M |
3300005338|Ga0068868_100707767 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300005343|Ga0070687_100232022 | Not Available | 1136 | Open in IMG/M |
3300005367|Ga0070667_100069341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3000 | Open in IMG/M |
3300005367|Ga0070667_100073039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2924 | Open in IMG/M |
3300005435|Ga0070714_100143637 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
3300005439|Ga0070711_100052863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2797 | Open in IMG/M |
3300005445|Ga0070708_100194024 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
3300005458|Ga0070681_11580115 | Not Available | 581 | Open in IMG/M |
3300005529|Ga0070741_10003910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 35801 | Open in IMG/M |
3300005529|Ga0070741_10243155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 1719 | Open in IMG/M |
3300005532|Ga0070739_10098565 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300005538|Ga0070731_10000921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 33616 | Open in IMG/M |
3300005542|Ga0070732_10086531 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
3300005542|Ga0070732_10868720 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005545|Ga0070695_101846165 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005549|Ga0070704_100582553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
3300005713|Ga0066905_100114009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1869 | Open in IMG/M |
3300005713|Ga0066905_100446764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1062 | Open in IMG/M |
3300005713|Ga0066905_101592755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 597 | Open in IMG/M |
3300005713|Ga0066905_102178203 | Not Available | 517 | Open in IMG/M |
3300005719|Ga0068861_101930501 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005764|Ga0066903_104618550 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300005764|Ga0066903_105975705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 638 | Open in IMG/M |
3300005836|Ga0074470_11458192 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
3300005875|Ga0075293_1045038 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300005877|Ga0075296_1019748 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300005903|Ga0075279_10106741 | Not Available | 522 | Open in IMG/M |
3300005937|Ga0081455_10028947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5056 | Open in IMG/M |
3300005938|Ga0066795_10167683 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300005938|Ga0066795_10204009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 587 | Open in IMG/M |
3300005994|Ga0066789_10374775 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300006041|Ga0075023_100142072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 876 | Open in IMG/M |
3300006041|Ga0075023_100254383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 704 | Open in IMG/M |
3300006041|Ga0075023_100457823 | Not Available | 565 | Open in IMG/M |
3300006047|Ga0075024_100340255 | Not Available | 747 | Open in IMG/M |
3300006047|Ga0075024_100740088 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300006050|Ga0075028_100010375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3824 | Open in IMG/M |
3300006050|Ga0075028_100503177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 708 | Open in IMG/M |
3300006173|Ga0070716_100081928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1928 | Open in IMG/M |
3300006173|Ga0070716_100375328 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300006354|Ga0075021_10986584 | Not Available | 549 | Open in IMG/M |
3300006603|Ga0074064_11601250 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300006638|Ga0075522_10000375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 32039 | Open in IMG/M |
3300006642|Ga0075521_10011145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3474 | Open in IMG/M |
3300006642|Ga0075521_10131564 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300006755|Ga0079222_10139973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1355 | Open in IMG/M |
3300006795|Ga0075520_1071180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1624 | Open in IMG/M |
3300006797|Ga0066659_11146990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 650 | Open in IMG/M |
3300006804|Ga0079221_11213648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 587 | Open in IMG/M |
3300006854|Ga0075425_100370487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1649 | Open in IMG/M |
3300006881|Ga0068865_100778534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 824 | Open in IMG/M |
3300007769|Ga0102952_1017350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2191 | Open in IMG/M |
3300009029|Ga0066793_10641591 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300009091|Ga0102851_10402772 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300009091|Ga0102851_10957018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 928 | Open in IMG/M |
3300009091|Ga0102851_10989266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 914 | Open in IMG/M |
3300009092|Ga0105250_10175068 | Not Available | 899 | Open in IMG/M |
3300009093|Ga0105240_10527104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1310 | Open in IMG/M |
3300009167|Ga0113563_12786710 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300009174|Ga0105241_10093336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2378 | Open in IMG/M |
3300009649|Ga0105855_1262992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 537 | Open in IMG/M |
3300009650|Ga0105857_1229598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 548 | Open in IMG/M |
3300009660|Ga0105854_1076368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1030 | Open in IMG/M |
3300009660|Ga0105854_1258528 | Not Available | 596 | Open in IMG/M |
3300009661|Ga0105858_1076993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 873 | Open in IMG/M |
3300009662|Ga0105856_1244512 | Not Available | 581 | Open in IMG/M |
3300009839|Ga0116223_10644821 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300010043|Ga0126380_10022017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3079 | Open in IMG/M |
3300010047|Ga0126382_11317878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 654 | Open in IMG/M |
3300010048|Ga0126373_13171709 | Not Available | 512 | Open in IMG/M |
3300010341|Ga0074045_10165266 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300010358|Ga0126370_11971832 | Not Available | 570 | Open in IMG/M |
3300010359|Ga0126376_11847580 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300010371|Ga0134125_10066679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4007 | Open in IMG/M |
3300010371|Ga0134125_10077299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3704 | Open in IMG/M |
3300010371|Ga0134125_10126400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2846 | Open in IMG/M |
3300010371|Ga0134125_11179707 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300010371|Ga0134125_12378024 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300010373|Ga0134128_10880632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
3300010373|Ga0134128_11221256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 829 | Open in IMG/M |
3300010373|Ga0134128_11917686 | Not Available | 652 | Open in IMG/M |
3300010373|Ga0134128_11963328 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300010379|Ga0136449_104511523 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010396|Ga0134126_10031552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6703 | Open in IMG/M |
3300010396|Ga0134126_10476933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1441 | Open in IMG/M |
3300010397|Ga0134124_10001169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 21052 | Open in IMG/M |
3300010399|Ga0134127_10834770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 972 | Open in IMG/M |
3300010400|Ga0134122_10027068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4324 | Open in IMG/M |
3300010401|Ga0134121_12665900 | Not Available | 544 | Open in IMG/M |
3300010403|Ga0134123_10049602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 3154 | Open in IMG/M |
3300011119|Ga0105246_10158501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1722 | Open in IMG/M |
3300011119|Ga0105246_10757749 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300011414|Ga0137442_1123597 | Not Available | 570 | Open in IMG/M |
3300011433|Ga0137443_1125259 | Not Available | 750 | Open in IMG/M |
3300011442|Ga0137437_1248426 | Not Available | 615 | Open in IMG/M |
3300011444|Ga0137463_1215707 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300012019|Ga0120139_1134145 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300012040|Ga0137461_1049829 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300012202|Ga0137363_10866834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
3300012357|Ga0137384_10933743 | Not Available | 699 | Open in IMG/M |
3300012505|Ga0157339_1002857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1202 | Open in IMG/M |
3300012931|Ga0153915_10964915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 992 | Open in IMG/M |
3300012951|Ga0164300_10019574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2319 | Open in IMG/M |
3300012958|Ga0164299_10591767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 757 | Open in IMG/M |
3300012960|Ga0164301_10060696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1999 | Open in IMG/M |
3300012964|Ga0153916_10344383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1538 | Open in IMG/M |
3300012964|Ga0153916_12027518 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012985|Ga0164308_12062605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 531 | Open in IMG/M |
3300012987|Ga0164307_11368793 | Not Available | 594 | Open in IMG/M |
3300012989|Ga0164305_10283163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1216 | Open in IMG/M |
3300012989|Ga0164305_11659853 | Not Available | 572 | Open in IMG/M |
3300013092|Ga0163199_1351586 | Not Available | 551 | Open in IMG/M |
3300013092|Ga0163199_1371806 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300013104|Ga0157370_10183895 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
3300013104|Ga0157370_11998412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 520 | Open in IMG/M |
3300013503|Ga0120127_10002115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3171 | Open in IMG/M |
3300013831|Ga0120126_1037405 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300014054|Ga0120135_1012095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 978 | Open in IMG/M |
3300014200|Ga0181526_10101187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1842 | Open in IMG/M |
3300014263|Ga0075324_1062543 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300014321|Ga0075353_1039175 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300014322|Ga0075355_1123044 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300014657|Ga0181522_10003671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8556 | Open in IMG/M |
3300015063|Ga0167649_102949 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
3300015075|Ga0167636_1007693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1684 | Open in IMG/M |
3300015080|Ga0167639_1002449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2791 | Open in IMG/M |
3300015080|Ga0167639_1002479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2770 | Open in IMG/M |
3300015087|Ga0167637_1052941 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300015162|Ga0167653_1030006 | Not Available | 1019 | Open in IMG/M |
3300015171|Ga0167648_1076209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 727 | Open in IMG/M |
3300015195|Ga0167658_1115778 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300015373|Ga0132257_104202775 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300017936|Ga0187821_10203260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 762 | Open in IMG/M |
3300017939|Ga0187775_10121996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
3300017939|Ga0187775_10298397 | Not Available | 635 | Open in IMG/M |
3300017939|Ga0187775_10314166 | Not Available | 622 | Open in IMG/M |
3300017944|Ga0187786_10034685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1438 | Open in IMG/M |
3300017944|Ga0187786_10037203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1400 | Open in IMG/M |
3300017944|Ga0187786_10043779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1318 | Open in IMG/M |
3300017944|Ga0187786_10053690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1223 | Open in IMG/M |
3300017944|Ga0187786_10154280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 832 | Open in IMG/M |
3300017944|Ga0187786_10270187 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300017947|Ga0187785_10000413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 16075 | Open in IMG/M |
3300017947|Ga0187785_10001311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8626 | Open in IMG/M |
3300017947|Ga0187785_10107026 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300017947|Ga0187785_10370351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 680 | Open in IMG/M |
3300017947|Ga0187785_10582466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 571 | Open in IMG/M |
3300017959|Ga0187779_10052043 | Not Available | 2389 | Open in IMG/M |
3300017961|Ga0187778_10112984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1694 | Open in IMG/M |
3300017961|Ga0187778_11139581 | Not Available | 544 | Open in IMG/M |
3300017973|Ga0187780_10044501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3095 | Open in IMG/M |
3300017973|Ga0187780_10222192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1319 | Open in IMG/M |
3300017974|Ga0187777_10238392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1232 | Open in IMG/M |
3300017993|Ga0187823_10257891 | Not Available | 592 | Open in IMG/M |
3300017999|Ga0187767_10344000 | Not Available | 522 | Open in IMG/M |
3300018001|Ga0187815_10254568 | Not Available | 743 | Open in IMG/M |
3300018032|Ga0187788_10139911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 904 | Open in IMG/M |
3300018032|Ga0187788_10216814 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300018032|Ga0187788_10386916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 585 | Open in IMG/M |
3300018033|Ga0187867_10050256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2511 | Open in IMG/M |
3300018038|Ga0187855_10243725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1055 | Open in IMG/M |
3300018064|Ga0187773_10058800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1793 | Open in IMG/M |
3300018064|Ga0187773_10346120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 845 | Open in IMG/M |
3300018064|Ga0187773_11192350 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300018067|Ga0184611_1045271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1454 | Open in IMG/M |
3300018083|Ga0184628_10001451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 11699 | Open in IMG/M |
3300018083|Ga0184628_10022849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3090 | Open in IMG/M |
3300018088|Ga0187771_10000240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 31400 | Open in IMG/M |
3300018089|Ga0187774_10189852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1115 | Open in IMG/M |
3300021377|Ga0213874_10236346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 669 | Open in IMG/M |
3300021420|Ga0210394_10523011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1044 | Open in IMG/M |
3300021560|Ga0126371_10825519 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300022553|Ga0212124_10187686 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300023259|Ga0224551_1068530 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300025314|Ga0209323_10274271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1065 | Open in IMG/M |
3300025474|Ga0208479_1072183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 656 | Open in IMG/M |
3300025484|Ga0208587_1075591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 716 | Open in IMG/M |
3300025494|Ga0207928_1021979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1240 | Open in IMG/M |
3300025495|Ga0207932_1001292 | All Organisms → cellular organisms → Bacteria | 8687 | Open in IMG/M |
3300025505|Ga0207929_1047057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 821 | Open in IMG/M |
3300025664|Ga0208849_1021135 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
3300025780|Ga0210100_1001934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2106 | Open in IMG/M |
3300025878|Ga0209584_10130909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 939 | Open in IMG/M |
3300025878|Ga0209584_10282676 | Not Available | 637 | Open in IMG/M |
3300025891|Ga0209585_10271402 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300025900|Ga0207710_10377350 | Not Available | 725 | Open in IMG/M |
3300025903|Ga0207680_10081801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2031 | Open in IMG/M |
3300025906|Ga0207699_10197017 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300025907|Ga0207645_10167961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1437 | Open in IMG/M |
3300025912|Ga0207707_10078815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2877 | Open in IMG/M |
3300025916|Ga0207663_10167012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1559 | Open in IMG/M |
3300025916|Ga0207663_10268837 | Not Available | 1262 | Open in IMG/M |
3300025917|Ga0207660_10832505 | Not Available | 753 | Open in IMG/M |
3300025917|Ga0207660_11325630 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300025932|Ga0207690_11456862 | Not Available | 572 | Open in IMG/M |
3300025939|Ga0207665_10055993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2662 | Open in IMG/M |
3300025972|Ga0207668_10559432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 992 | Open in IMG/M |
3300026040|Ga0208144_1009819 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300026291|Ga0209890_10012272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3460 | Open in IMG/M |
3300026291|Ga0209890_10117338 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300027310|Ga0207983_1008842 | Not Available | 1134 | Open in IMG/M |
3300027310|Ga0207983_1020887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 792 | Open in IMG/M |
3300027523|Ga0208890_1014050 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300027629|Ga0209422_1008775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2492 | Open in IMG/M |
3300027706|Ga0209581_1002241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 19050 | Open in IMG/M |
3300027706|Ga0209581_1005311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9899 | Open in IMG/M |
3300027787|Ga0209074_10076409 | Not Available | 1084 | Open in IMG/M |
3300027792|Ga0209287_10360916 | Not Available | 558 | Open in IMG/M |
3300027815|Ga0209726_10152120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1289 | Open in IMG/M |
3300027842|Ga0209580_10060358 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
3300027854|Ga0209517_10435597 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300027869|Ga0209579_10000021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 476755 | Open in IMG/M |
3300027873|Ga0209814_10000149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 19747 | Open in IMG/M |
3300027894|Ga0209068_10014343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3802 | Open in IMG/M |
3300027894|Ga0209068_10121724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1393 | Open in IMG/M |
3300027894|Ga0209068_10202054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1093 | Open in IMG/M |
3300027894|Ga0209068_10270419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 949 | Open in IMG/M |
3300027902|Ga0209048_10117497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2024 | Open in IMG/M |
3300027910|Ga0209583_10003775 | All Organisms → cellular organisms → Bacteria | 4256 | Open in IMG/M |
3300027915|Ga0209069_10046340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2040 | Open in IMG/M |
3300028379|Ga0268266_10539362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1117 | Open in IMG/M |
3300028711|Ga0307293_10133243 | Not Available | 791 | Open in IMG/M |
3300028784|Ga0307282_10007580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4290 | Open in IMG/M |
3300028787|Ga0307323_10005692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4068 | Open in IMG/M |
3300028792|Ga0307504_10458540 | Not Available | 512 | Open in IMG/M |
3300028800|Ga0265338_10432686 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300028819|Ga0307296_10009132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5188 | Open in IMG/M |
3300028885|Ga0307304_10014129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2588 | Open in IMG/M |
3300029903|Ga0247271_103012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3540 | Open in IMG/M |
3300031226|Ga0307497_10274905 | Not Available | 762 | Open in IMG/M |
3300031226|Ga0307497_10760558 | Not Available | 505 | Open in IMG/M |
3300031238|Ga0265332_10314990 | Not Available | 646 | Open in IMG/M |
3300031241|Ga0265325_10005391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7902 | Open in IMG/M |
3300031241|Ga0265325_10091448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1500 | Open in IMG/M |
3300031241|Ga0265325_10252229 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300031247|Ga0265340_10438104 | Not Available | 576 | Open in IMG/M |
3300031247|Ga0265340_10509569 | Not Available | 530 | Open in IMG/M |
3300031344|Ga0265316_10810947 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300031562|Ga0310886_10013251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3103 | Open in IMG/M |
3300031562|Ga0310886_10082387 | Not Available | 1556 | Open in IMG/M |
3300031711|Ga0265314_10047072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3038 | Open in IMG/M |
3300031711|Ga0265314_10084938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2076 | Open in IMG/M |
3300031716|Ga0310813_10352193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1255 | Open in IMG/M |
3300031716|Ga0310813_12161123 | Not Available | 526 | Open in IMG/M |
3300031820|Ga0307473_10029488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2370 | Open in IMG/M |
3300031820|Ga0307473_10112648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1475 | Open in IMG/M |
3300031938|Ga0308175_102673981 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300031940|Ga0310901_10014087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2204 | Open in IMG/M |
3300031949|Ga0214473_10211558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2241 | Open in IMG/M |
3300031954|Ga0306926_10032054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6174 | Open in IMG/M |
3300031997|Ga0315278_10539802 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300032061|Ga0315540_10134756 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300032163|Ga0315281_10596385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1163 | Open in IMG/M |
3300032163|Ga0315281_10649557 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300032174|Ga0307470_11652085 | Not Available | 538 | Open in IMG/M |
3300032177|Ga0315276_10415842 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300032770|Ga0335085_10000391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 126953 | Open in IMG/M |
3300032770|Ga0335085_10026297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8171 | Open in IMG/M |
3300032770|Ga0335085_10072909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4536 | Open in IMG/M |
3300032770|Ga0335085_10111955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3501 | Open in IMG/M |
3300032770|Ga0335085_10216528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2331 | Open in IMG/M |
3300032770|Ga0335085_10271452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2026 | Open in IMG/M |
3300032770|Ga0335085_10335786 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
3300032770|Ga0335085_12418452 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300032782|Ga0335082_10096059 | Not Available | 2946 | Open in IMG/M |
3300032782|Ga0335082_10332453 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300032782|Ga0335082_10635377 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300032782|Ga0335082_11700332 | Not Available | 505 | Open in IMG/M |
3300032783|Ga0335079_10204301 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
3300032783|Ga0335079_10284488 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
3300032783|Ga0335079_10566965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1202 | Open in IMG/M |
3300032783|Ga0335079_11453578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
3300032805|Ga0335078_10137533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3474 | Open in IMG/M |
3300032805|Ga0335078_11016865 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300032828|Ga0335080_11462495 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300032829|Ga0335070_10015607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8833 | Open in IMG/M |
3300032829|Ga0335070_10168789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2206 | Open in IMG/M |
3300032829|Ga0335070_10985789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 778 | Open in IMG/M |
3300032829|Ga0335070_11981712 | Not Available | 524 | Open in IMG/M |
3300032829|Ga0335070_12014479 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300032892|Ga0335081_10010800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14759 | Open in IMG/M |
3300032892|Ga0335081_10065981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 5572 | Open in IMG/M |
3300032892|Ga0335081_10255549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2362 | Open in IMG/M |
3300032892|Ga0335081_10280256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2224 | Open in IMG/M |
3300032892|Ga0335081_10367564 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
3300032892|Ga0335081_10546022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1445 | Open in IMG/M |
3300032892|Ga0335081_10555525 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300032892|Ga0335081_10899138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1044 | Open in IMG/M |
3300032892|Ga0335081_11658373 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300032893|Ga0335069_10725889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1127 | Open in IMG/M |
3300033004|Ga0335084_10882988 | Not Available | 905 | Open in IMG/M |
3300033004|Ga0335084_11861044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 589 | Open in IMG/M |
3300033412|Ga0310810_10726355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 917 | Open in IMG/M |
3300033433|Ga0326726_10033886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4450 | Open in IMG/M |
3300033433|Ga0326726_10321356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1456 | Open in IMG/M |
3300033433|Ga0326726_10396217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1309 | Open in IMG/M |
3300033480|Ga0316620_10513340 | Not Available | 1110 | Open in IMG/M |
3300033486|Ga0316624_10000069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 27752 | Open in IMG/M |
3300033500|Ga0326730_1011906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1899 | Open in IMG/M |
3300033513|Ga0316628_101519013 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300033804|Ga0314863_098824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 613 | Open in IMG/M |
3300033808|Ga0314867_019987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1585 | Open in IMG/M |
3300034090|Ga0326723_0075325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1444 | Open in IMG/M |
3300034090|Ga0326723_0164455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 978 | Open in IMG/M |
3300034129|Ga0370493_0053799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1250 | Open in IMG/M |
3300034195|Ga0370501_0068855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1153 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 11.50% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.31% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.01% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.13% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.95% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.95% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.65% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.06% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.77% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.77% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.77% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.47% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.47% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.47% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.18% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.18% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.18% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.89% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.89% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.89% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.29% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.29% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.29% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.29% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.29% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.29% |
Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.29% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.29% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.29% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.29% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.29% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.29% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.29% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.29% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.29% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.29% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.29% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.59% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.59% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.59% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.59% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.59% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001423 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
3300005877 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 | Environmental | Open in IMG/M |
3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007769 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300013831 | Permafrost microbial communities from Nunavut, Canada - A21_5cm_6M | Environmental | Open in IMG/M |
3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025484 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026040 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
beta3_all_00253470 | 2124908028 | Soil | MRFILGVFVGAALLLGSAYLHDKGVVNAGPKQAFVNWDVVTGMLGR |
JGIcombinedJ13530_1030160733 | 3300001213 | Wetland | LSMRFIFGVLVGAILMLAAAYLHDIRVVHFGPKEPFVNWDRVIGLLGR* |
JGI20199J14953_10096472 | 3300001423 | Arctic Peat Soil | MRFILGIIVGAALLLGSAYLHDTGVIKAGPKEAFVNWNTVMGMLGK* |
A10PFW1_100157683 | 3300001538 | Permafrost | MKFILGIFVGAALMLVSAYLHDTGVVRAGPAQPFVNWDTVFGMMGR* |
JGI24130J36418_100051214 | 3300002549 | Arctic Peat Soil | MRFILGVFVGAALLLGSAYLHDKGVVNAGPKQAFVNWDVVTGMLGR* |
JGI24140J50213_1000043910 | 3300003369 | Arctic Peat Soil | MRFILGVFVGAALMLGSAYLHDKGVVNAGPKQAFVNWDVVTGMLGR* |
JGI24140J50213_102337022 | 3300003369 | Arctic Peat Soil | MRFILGVFVGAVLMLGSAYLHDTGMVKAGPAQPFVNWDTVFSLAGR* |
JGI25405J52794_100733142 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MKFILGVFVGAALMVGSAYVHDTGMVKAGPQQPFVNWDTVIGMLGR* |
Ga0055471_100367802 | 3300003987 | Natural And Restored Wetlands | MKFILGVFVGAALMLGSAYLHDTGVVRAGPPQPFVNWDIVFGMLGR* |
Ga0055471_102794242 | 3300003987 | Natural And Restored Wetlands | MRFILGVVVGAGLTLGSAYLHDTGRVKVGPPQPIVNWDTLVGMLGR* |
Ga0055435_101175272 | 3300003994 | Natural And Restored Wetlands | MKFIFGVIVGAALLLGAAYLHDTGVVRYGPKEPFVNWDAVFEMLQR* |
Ga0055467_101222622 | 3300003996 | Natural And Restored Wetlands | MRFIFGVFVGAILMLAAAYLHDIRVVHFGPKEPFVNWDRVIGLLGR* |
Ga0055472_100199573 | 3300003998 | Natural And Restored Wetlands | MKFILGIFVGAALMLGSAYLHDTGVVRAGPPQPFVNWDIVFGMLRR* |
Ga0055440_100491892 | 3300004020 | Natural And Restored Wetlands | MKFILGVVCGAVLMLGSAYLHDTGMVRVGPSQPLVNWDALIGMLPH* |
Ga0055432_101727581 | 3300004022 | Natural And Restored Wetlands | VIVGAALLLGAAYLHDTGVVRYGPKEPFVNWDAVFEMLQR* |
Ga0055433_101586371 | 3300004025 | Natural And Restored Wetlands | MRFIFGIFVGAALLLVSAYLHDIRVVHFGPKEPFVNWDRVVSLLGR* |
Ga0062593_1026114301 | 3300004114 | Soil | MRFILGICVGAALMLGGAYLHDTGKVQFGPAKPFVNWDTVVGLLPR* |
Ga0062595_1001705881 | 3300004479 | Soil | MRFIFGVFVGAALMVGSAYMHDTGMVRAGPKQPFVNWDTVIGMLGR* |
Ga0062595_1014569021 | 3300004479 | Soil | MKFILGVFVGAALMLGSAYVHDTGMVKAGPQQPFVNWDTVVGILGR* |
Ga0062595_1023102142 | 3300004479 | Soil | MRFIFGVFVGAALMLGSAFLHDKGVLRAGPKQPFVNWDIVMGMLAR* |
Ga0062595_1025424191 | 3300004479 | Soil | MKFILGVFVGAALMVGSAYLHNRGVVRAGPKQPFVNWDTVIGMW |
Ga0062591_1011617452 | 3300004643 | Soil | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLG |
Ga0066823_100461302 | 3300005163 | Soil | MRFIFGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0070676_103268081 | 3300005328 | Miscanthus Rhizosphere | AMRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0070683_1006371102 | 3300005329 | Corn Rhizosphere | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLRR* |
Ga0066388_10000201213 | 3300005332 | Tropical Forest Soil | MKFIFGVFVGAALMLASAYLHDTGVINAGPKQPFVNWDTVIGMLGH* |
Ga0066388_1007258912 | 3300005332 | Tropical Forest Soil | MKFILGVFVGAALMLGSAYVHDTGMVKAGPKQPFVNWDTVIGMLGR* |
Ga0066388_1075363541 | 3300005332 | Tropical Forest Soil | MKFILGVFVGAALMLASAYLHDTGVINAGPKQPFVNWDTVIGMLGH* |
Ga0068869_1012036391 | 3300005334 | Miscanthus Rhizosphere | VRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0070666_101883922 | 3300005335 | Switchgrass Rhizosphere | MKFILGVFVGAALMVGSAYLHNRGVVRAGPKQPFVNWDTVIGMWRR* |
Ga0070680_1003155733 | 3300005336 | Corn Rhizosphere | MRFILGVIVGGLLTLGGAYLHDDTGVVRAGPPQPFVNWNTVMMLWPR* |
Ga0070680_1011913731 | 3300005336 | Corn Rhizosphere | MKFVFGVVVGAALMLGSAYLHDTRVVRAGPQQPFVNWDVVVGMLGR* |
Ga0070682_1001432042 | 3300005337 | Corn Rhizosphere | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0068868_1007077672 | 3300005338 | Miscanthus Rhizosphere | MRFILGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTVIGMLRR* |
Ga0070687_1002320221 | 3300005343 | Switchgrass Rhizosphere | RFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0070667_1000693415 | 3300005367 | Switchgrass Rhizosphere | MKFILGVFVGAALMVGSAYLHDRGVVRAGPKQPFVNWDTVIGMWRR* |
Ga0070667_1000730392 | 3300005367 | Switchgrass Rhizosphere | MRFILGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0070714_1001436372 | 3300005435 | Agricultural Soil | MRFILGMFCGAVLMLGSAYIHDAGMVRVGPSQPFVNWDALIGMLR* |
Ga0070711_1000528633 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFILGVFVGAGLMVASAYVHDIGMVRAGPKQPFVNWDIVIGMLGR* |
Ga0070708_1001940242 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFILGVFVGAGLMLGSAYLHDTGFVNAGPKQPFVNWDTVIGMLGR* |
Ga0070681_115801152 | 3300005458 | Corn Rhizosphere | MRFILGVIVGGLLTLGGAYLHDTGVVRAGPPQPFVNWNTVMMLWPR* |
Ga0070741_1000391023 | 3300005529 | Surface Soil | MKFILGVFCGAVLMLGSAYLHDTGMIKAGPAQPFVNWDTVIGMLH* |
Ga0070741_102431552 | 3300005529 | Surface Soil | MRFIIGVIFGAALMLVSAYLHDTGRIQAGPKQAFVNWDVVFGMMGR* |
Ga0070739_100985654 | 3300005532 | Surface Soil | KFVLGMLCGAVLMLGSAYVHDRGMVNAAPSQPLVNWDTLIGMLGR* |
Ga0070731_100009219 | 3300005538 | Surface Soil | MRFVFGVFVGAALMLGSAYLHDTGVVRAGPSQPFVNWDIVVGLIR* |
Ga0070732_100865313 | 3300005542 | Surface Soil | MRFIFGVIVGAALILGLAYLHDTGVVKAGPAQPFVNWATVMAMMGK* |
Ga0070732_108687201 | 3300005542 | Surface Soil | MRFIFGVIVGAALMLGSAYLHDIGVVKAGPAQPFVNWATVMAMMGK* |
Ga0070695_1018461652 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRFIIGVFVGAALMLGSAYLHDIGVIHAGPKQPFVNWDTVIGLLAH* |
Ga0070704_1005825532 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFIVGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0066905_1001140092 | 3300005713 | Tropical Forest Soil | MKFILGVFVGAALMLGSAYVHDAGMVKAGPQQPFVNWDTVIGMLGR* |
Ga0066905_1004467642 | 3300005713 | Tropical Forest Soil | MKFILGVFVGAALMLGSAYVHDTGMVKAGPSQPFVNWDTVVGMLGR* |
Ga0066905_1015927552 | 3300005713 | Tropical Forest Soil | MKFILGVFVGAALMVGSAYVHDTGMLRAGPKHPFVNWDTVISMLRR* |
Ga0066905_1021782032 | 3300005713 | Tropical Forest Soil | MKFILGVFVGAVLMLGSAYVHDTGMVKAGSQQPFVNWDTVIGMLGR* |
Ga0068861_1019305012 | 3300005719 | Switchgrass Rhizosphere | WCMKFILGVFVGAALMVGSAYLHDRGVVRAGPKQPFVNWDTVIGMWRR* |
Ga0066903_1046185502 | 3300005764 | Tropical Forest Soil | MKFILGVFVGAALMVGSAYLHDTGMVRAGPKHPFVNWDTVVSMLRR* |
Ga0066903_1059757052 | 3300005764 | Tropical Forest Soil | MKFVLGVFVGAALMLGSAYIHDTGMVRAGPAQPFVNWDTLVGMLR* |
Ga0074470_114581922 | 3300005836 | Sediment (Intertidal) | MKFILGVFVGAALMLGSAYLHDTGMVRAGPPQPFVNWQIVFGMLGR* |
Ga0075293_10450381 | 3300005875 | Rice Paddy Soil | ILGVIIGAGLTLGSAYLHDTGRVKIGPPQPIVNWDTLVGMLGR* |
Ga0075296_10197482 | 3300005877 | Rice Paddy Soil | MRFILGVIVGAGLMVGSAYLHDTGVVRAGPVQPFVNWDTVIGMLGR* |
Ga0075279_101067411 | 3300005903 | Rice Paddy Soil | MKFILGVFVGAALMLGSAYLHDTGVVRAGPPQPFVNWDIV |
Ga0081455_100289475 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKFILGVFVGAALMLGSAYVHDTGMVKAGPQQPFVNWDAVIGMLGR* |
Ga0066795_101676831 | 3300005938 | Soil | VFVGAALLLGSAYLHDKGVVNAGPKQAFVNWDVVTGMLGR* |
Ga0066795_102040092 | 3300005938 | Soil | MKFILGLFVGAALLLGSAYVHDKGIVKAGPPQAFVNWDVVTGMLGR* |
Ga0066789_103747752 | 3300005994 | Soil | MRFILGMIVGAGVMLSAAYMHDTGRLRYGPPAAFVNWDVVFSMVGR* |
Ga0075023_1001420721 | 3300006041 | Watersheds | MRFILGVFVGAALMVGSAFVHDTGMVRAGPKQPFVNWDTVI |
Ga0075023_1002543832 | 3300006041 | Watersheds | MRFVLGVFVGAGLMVGSAYLHDTGMVRAGPKQPFVNWDTVIGMWGR* |
Ga0075023_1004578231 | 3300006041 | Watersheds | MKFILGVFGGAALMLGSAYLHDTGVVRAGPAKPFVNWDTVIGMLR* |
Ga0075024_1003402552 | 3300006047 | Watersheds | RMRFVLGVFVGAALMVGSAYLHDTGMVRAGPKQPFVNWDTVIGMWGR* |
Ga0075024_1007400881 | 3300006047 | Watersheds | MRFVLGMIVGAAVMLGSAYLHDTGVVRIGPAQPYVNWDMVFALVGR* |
Ga0075028_1000103754 | 3300006050 | Watersheds | MRFILGVFVGAALMVGSAYVHDIGMVRAGPKQPFVNWDTVIGMWGR* |
Ga0075028_1005031772 | 3300006050 | Watersheds | MRFVLGMIVGAAVMLGSAYLHDTGVVRVGPPQPYVNWDMVFALVGR* |
Ga0070716_1000819285 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFIFGVFVGAALMLGSAFLHDEGVLRAGPKQPFVNWDIVMGMLAR* |
Ga0070716_1003753281 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFILGVFVGAALMLGSAYLHDTGMVRAGPQQPFVNWDTVIGMWGR* |
Ga0075021_109865842 | 3300006354 | Watersheds | MNFIWGVIVGAGLLLGSAYLHDTGVIRAGPTQPFVNWDIVIGMLGK* |
Ga0074064_116012502 | 3300006603 | Soil | MRFILGVFVGAASMLGSAYLHDMGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0075522_1000037515 | 3300006638 | Arctic Peat Soil | MRFIFGVVVGAALMLGSAYLHDTGVVKAGPKQPFVDWDTVFALAGR* |
Ga0075521_100111455 | 3300006642 | Arctic Peat Soil | MRFILGMIVGAGVMLGSAYMHDTGRLNMGPRVPFVNWDVVFSLAPR* |
Ga0075521_101315642 | 3300006642 | Arctic Peat Soil | MRFILGVFVGAVLMLGSAYLHDTGMVKAGPAQPFVNWDTVFSLVGR* |
Ga0079222_101399732 | 3300006755 | Agricultural Soil | MKFILGVFVGAALMLGSAYLHDTRMVRAGPAQPFVNWDTVVGLLGR* |
Ga0075520_10711802 | 3300006795 | Arctic Peat Soil | MKFILGIFVGAALMLGSAYLHDKGVVNAGPKQAFVNWDVVTGMLGR* |
Ga0066659_111469902 | 3300006797 | Soil | MKFVLGVFVGAALMVGSAYLHDTGVVQAGPKAPFVNWDTVVGMLGR* |
Ga0079221_112136482 | 3300006804 | Agricultural Soil | MRFILGIFVGAGLMLGSAYMHDTGQLKFGPAKPLVNWDAVIGLLPR* |
Ga0075425_1003704872 | 3300006854 | Populus Rhizosphere | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGVLGR* |
Ga0068865_1007785341 | 3300006881 | Miscanthus Rhizosphere | MRFILGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTV |
Ga0102952_10173503 | 3300007769 | Soil | MQFILGVIVGAALMVGSAYLHDTGRLKAGPAQPFVNWDTVAGMWR* |
Ga0066793_106415911 | 3300009029 | Prmafrost Soil | MRFILGVFVGAVLMLGSAYLHDTGMVKAGPAQPFVNWDIVFSLAGR* |
Ga0102851_104027723 | 3300009091 | Freshwater Wetlands | MRFILGMIVGAALMLGSAYLHDTGVVRVGPPQPFVNWDLVFALAGR* |
Ga0102851_109570181 | 3300009091 | Freshwater Wetlands | MLARRETRHWEAFMRFILGMIVGAALMLGSAYLHDTGVVRVGPPQPFVNWDLV |
Ga0102851_109892662 | 3300009091 | Freshwater Wetlands | MRFIWGMIVGAALLLGSAYLHDTGVIKAGPPQAFVNWDTVVGMLGR* |
Ga0105250_101750681 | 3300009092 | Switchgrass Rhizosphere | VRFILGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0105240_105271043 | 3300009093 | Corn Rhizosphere | MKFILGVIVGAGLMVGSAYLHDTRMVRAGPQQPFVNWDVVVGMLGR* |
Ga0113563_127867102 | 3300009167 | Freshwater Wetlands | MRFILGIFVGAALMLGSAYLHDTGVVRVGPPQAFVNWDVVFALAGR* |
Ga0105241_100933363 | 3300009174 | Corn Rhizosphere | MKFILGVFVGAALMVGSAYLHDRGVVRAGPKQPFVKWDTVIGMWRR* |
Ga0105855_12629922 | 3300009649 | Permafrost Soil | MRFILGMIVGAGVMLGSAYMHDTGRLNVGPPVAFVNWDLVFSMIGR* |
Ga0105857_12295982 | 3300009650 | Permafrost Soil | MMRASDIPFWRRSMRFIFGMFVGAAVMLGSAYLHDTGRIQMGPKDAFVNWDTVFSLAGR* |
Ga0105854_10763682 | 3300009660 | Permafrost Soil | MRFIFGVIVGAALMLGSAYLHDTGRLRAEPAQQFVNWGVVFSLAGR* |
Ga0105854_12585282 | 3300009660 | Permafrost Soil | MRFIFGMIVGVIVMLGSAYLHDTGRLKVGPQAAFVNWDTVFSLAGR* |
Ga0105858_10769933 | 3300009661 | Permafrost Soil | MRFIFGVIVGAAVMLGSAYLHDTGRVRVGPAQAFVNWDVVFALAGR* |
Ga0105856_12445122 | 3300009662 | Permafrost Soil | MRFIFGVFVGAAVMLGSAYLHDTGRVRVGPAQAFVNWDVVFALAGR* |
Ga0116223_106448211 | 3300009839 | Peatlands Soil | MRFILGVFVGAALMLGSAYLHDTGRMHVGPAQPFVNWDTVFSLAGR* |
Ga0126380_100220172 | 3300010043 | Tropical Forest Soil | MKFILGVFVGAALMVGSAYLHDTGRVRVGPKHPFVNWDTVISMLRR* |
Ga0126382_113178781 | 3300010047 | Tropical Forest Soil | MKFILGVFVGAALMLGSAYVHDTGMVKAGPQQPFVNWDTVIGMLGR* |
Ga0126373_131717091 | 3300010048 | Tropical Forest Soil | MKFVLGIFVGAALMLGSAYIHDTGMVRAGPAQPFVNWDTLVGMLR* |
Ga0074045_101652665 | 3300010341 | Bog Forest Soil | MRFILGVFVGAALMLGSAYLHDTGRMRVGPAQPFVNWDTVFSLAGR* |
Ga0126370_119718322 | 3300010358 | Tropical Forest Soil | MRFLFGVFVGAALMVGSAFLHDKGVLRAGPKQPFVNWDTVMGLLAR* |
Ga0126376_118475802 | 3300010359 | Tropical Forest Soil | MKFILGVFVGAALLVGSAYLHDTGMVRAGPKHPFVNWDTVVSMLRR* |
Ga0134125_100666791 | 3300010371 | Terrestrial Soil | MKFILGVIVGAGLMVGSAYLHDTRMVRAGPQQPFVNWDVVV |
Ga0134125_100772994 | 3300010371 | Terrestrial Soil | MRFILGVIVGGLLTLGGAYLHDTGVVRAGPPQPFVNWNTVMMLWPH* |
Ga0134125_101264002 | 3300010371 | Terrestrial Soil | MRFILGIFVGAGLILGGAYMHDTGQVKFGPAKPFVNWDTVLGLLPR* |
Ga0134125_111797072 | 3300010371 | Terrestrial Soil | MRFIFGVIVGAALVLGSAYVHDMGMVRVGPPQPFVHWDTVLGMLPK* |
Ga0134125_123780242 | 3300010371 | Terrestrial Soil | MRFILGMFCGAVLMLGSAYVHDAGMVRVGPSQPFVNWDALIGMLR* |
Ga0134128_108806322 | 3300010373 | Terrestrial Soil | MRFILGIFVGAGLMLGGAYLHDTGKVQFGPAKPFVNWDTVIGLVQR* |
Ga0134128_112212562 | 3300010373 | Terrestrial Soil | MKFILGVFVGAGLMVASAYVHDTGMVRAGPKQPFVNWDTVIGMLGR* |
Ga0134128_119176861 | 3300010373 | Terrestrial Soil | MRFILGMFCRAVLMLGSAYIHDAGMVRVGPSQPFVNWDALIGMLR* |
Ga0134128_119633281 | 3300010373 | Terrestrial Soil | MKFILGVIVGAALMVGSAYLHDTGRVRAGPQQPFVNWDVVVGMLGR* |
Ga0136449_1045115231 | 3300010379 | Peatlands Soil | VRFILGIFVGAALMLGSAYLHETGRLKVGPRQPFVNWDAVIGMLGR* |
Ga0134126_100315528 | 3300010396 | Terrestrial Soil | MRFILGVIVGWALMLGGAYLHDIGVVHAGPAQPFVNWDTVMTLWPR* |
Ga0134126_104769332 | 3300010396 | Terrestrial Soil | MRFILGVIVGAALMLGGAYVHDMGMVRVGPPQPFVHWDTVLGLLPK* |
Ga0134124_100011693 | 3300010397 | Terrestrial Soil | MRFILGMFVGAGLMLGSAYLHDTGVIKAGPPQAFVNWDTVFTLIGR* |
Ga0134127_108347702 | 3300010399 | Terrestrial Soil | MKFILGVFVGAALMVGSAYLHDRGVVRASPKQPFVNWDTVIGMWRR* |
Ga0134122_100270684 | 3300010400 | Terrestrial Soil | MKFILGVFVGAVLMLGSAYLHDIGIVRVGPKQPFVNWDTVIGMLGR* |
Ga0134121_126659001 | 3300010401 | Terrestrial Soil | MNFLFGMIVGCALMLGSAYLHDTGAVRFGPPAAFVNWDTVLGMMPAR* |
Ga0134123_100496024 | 3300010403 | Terrestrial Soil | MRFILGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTVIGMRGR* |
Ga0105246_101585012 | 3300011119 | Miscanthus Rhizosphere | MRFILGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTVIGVLGR* |
Ga0105246_107577491 | 3300011119 | Miscanthus Rhizosphere | MNFILGAFVGAASMVGRAYLHNRGEVRAGPKQPFVNWDTVIGMWRR* |
Ga0137442_11235972 | 3300011414 | Soil | MRFILGMIVGAAVMLGSAYLHDTGVVRLGPPAPFVNWDAVFALAGR* |
Ga0137443_11252592 | 3300011433 | Soil | MRFILGMIVGAGVMLGSAYLHDTGVVRAGPAAPFVNWDTVFTMIGR* |
Ga0137437_12484262 | 3300011442 | Soil | RPMRFIFGMIVGAAVMLGSAYLHDTGVLRVGPPAPFVNWDAVFALAGR* |
Ga0137463_12157072 | 3300011444 | Soil | MRFIFGVFVGAAIMVGSAYMHDTGMMRAGPKQPFVNWDTVIGMLGR* |
Ga0120139_11341452 | 3300012019 | Permafrost | MRFILGVFCGAVLMLGSAYLHDTGVVRAGPAKPFVNWDTVTGMLR* |
Ga0137461_10498292 | 3300012040 | Soil | MRFILGMIVGAAVMLGSAYLHDTGVVRVGPAAPFVNWDTVFALAGR* |
Ga0137363_108668341 | 3300012202 | Vadose Zone Soil | MRFILGMFVGAAVMLGSAYLHDTGVVRIGPAQPFVNWDM |
Ga0137384_109337431 | 3300012357 | Vadose Zone Soil | MKFVLGVFVGAALMVGSAYLHDTGVVKVGPAQPFVNWDMVFALAGR* |
Ga0157339_10028573 | 3300012505 | Arabidopsis Rhizosphere | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLR |
Ga0153915_109649151 | 3300012931 | Freshwater Wetlands | MKFILGVFVGAALMLGTAYLHDTGVVRAGPAQPFVNWDTVIGM |
Ga0164300_100195743 | 3300012951 | Soil | MKFILGVFVGAALMVGSAYLHDRGVVRAGPKQPFVNWDTVLGMWRR* |
Ga0164299_105917672 | 3300012958 | Soil | MKFILGVFVGAALILGSAYLHDTGVVRAGPKQPFVNWDTVIGMLGR* |
Ga0164301_100606961 | 3300012960 | Soil | MKFILGVFVGAGLMVASAYVHDIGMVRAGPKQPFVNWDIVIGM |
Ga0153916_103443831 | 3300012964 | Freshwater Wetlands | MRFIWGMIVGAALMLGSAYLHDTGVIKAGPPQAFVNWDTVIGMLGR* |
Ga0153916_120275182 | 3300012964 | Freshwater Wetlands | MRFIVGMIVGAALLLGAAYLHDTGTLRVGPKQVFVNWDTVFGMLER* |
Ga0164308_120626052 | 3300012985 | Soil | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNW |
Ga0164307_113687931 | 3300012987 | Soil | MRFLFGIIVGAVISWGAAYLHDTGTIQAGPTKPFVNWDVVFSLIPR* |
Ga0164305_102831631 | 3300012989 | Soil | MRFIFGVFVGAALMVGSAYMHDTGMVRAGPKQPFVNWDTVIGM |
Ga0164305_116598532 | 3300012989 | Soil | MKFILGVFVGAAFMLGSAYLRDTRMVRVGPAQPFVNWDIVVGMLGR* |
Ga0163199_13515862 | 3300013092 | Freshwater | MRFVFGMIVGAAVMLGSAYLHDTGMVRVGPPQAFVNWDVVVGMIGR* |
Ga0163199_13718062 | 3300013092 | Freshwater | MRFIFGMIVGAGRMLGSAYLHDTGVVRVGPPQAFVNWDVVVGMIGR* |
Ga0157370_101838952 | 3300013104 | Corn Rhizosphere | VRFILGVFVGAALMLGSAYLHDTKRVRFGPPQPFVNWDAVVGMLGR* |
Ga0157370_119984122 | 3300013104 | Corn Rhizosphere | MRFILGIFVGAGLILGGAYMHDTGQVKFGPAKPFVNWDTALGLLPR* |
Ga0120127_100021153 | 3300013503 | Permafrost | MRFILGIIVGAALMLGSAYLHDTGRLKVGPKQAFVNWDTVIGLFPR* |
Ga0120126_10374052 | 3300013831 | Permafrost | MRFILGVVCGAVLMLGSAYLHDTGRLKVGPKQAFVNWDTVIGLFPR* |
Ga0120135_10120952 | 3300014054 | Permafrost | MRFILGVIVGAALMLGSAYLHDTGRLKVGPKQAFVNWDTVIGLFPR* |
Ga0181526_101011873 | 3300014200 | Bog | MRFILSVFVGAALMLGSAYLHDTGRMRVGPAQPFVNWDTVFSLAGR* |
Ga0075324_10625431 | 3300014263 | Natural And Restored Wetlands | MRFILGVIIGAGLTVGSAYLHDTGRVKVGPPQPIVNWDTLVGMLGR* |
Ga0075353_10391752 | 3300014321 | Natural And Restored Wetlands | MRFILGVFVGAALLIGNAYLHDVGVVRAGPKKPFVNWDIVIGMLGR* |
Ga0075355_11230441 | 3300014322 | Natural And Restored Wetlands | MKFIAGVFVGAALMLGSAYLHDTGHLRVRPAKPFVNWSTVL* |
Ga0181522_1000367113 | 3300014657 | Bog | MREADMRFLFGVAVGAALMLGSAYLHDTGVVKAGPKQPFVNWDTVFALTGR* |
Ga0167649_1029492 | 3300015063 | Glacier Forefield Soil | MRFIFGMFVGAGLMLGSAYLHDTGMLRVGPQQAFVNWDTVFALAGR* |
Ga0167636_10076931 | 3300015075 | Glacier Forefield Soils | MRFILGVFVGAALMLGSAYLHDKGVVNAGPKQAFVNWDVVT |
Ga0167639_10024491 | 3300015080 | Glacier Forefield Soil | MRFILGAVVGAALMLGIAWLHDTGMVRVGPQAAFVNWDTVFALAGH* |
Ga0167639_10024794 | 3300015080 | Glacier Forefield Soil | MRFILGIFVGAALMLGSAYLHDTGVVHAGPAQPFVNWDTVFGMMGR* |
Ga0167637_10529412 | 3300015087 | Glacier Forefield Soil | MRFIVGMIFGAALMLVSAYLHDTKRVHFGPPQAFVNWDTVFGLIGR* |
Ga0167653_10300063 | 3300015162 | Glacier Forefield Soil | MNFLFGMIVGCALMLGSAYLHDTGSVRFGPQGAFVNWDTVLSMIPAR* |
Ga0167648_10762091 | 3300015171 | Glacier Forefield Soil | MRFILGIFVGAGLMLGSAYLHDTGMLRVGPQQAFVNWDTVFALAGR* |
Ga0167658_11157782 | 3300015195 | Glacier Forefield Soil | MTFIVRERSMRFILGMFVGAGLMLGSAYLHDTGMLRVGPPTAFVNWDTVFALAGR* |
Ga0132257_1042027752 | 3300015373 | Arabidopsis Rhizosphere | MKFILGVFVGAALMLGSAYLHDTRMVRVGPAQPFVNWDTVVGMLGR* |
Ga0187821_102032601 | 3300017936 | Freshwater Sediment | ILGVIVGAALMLGSAYLHDTKRVQFGPQQPFVNWATVVGLLGR |
Ga0187775_101219962 | 3300017939 | Tropical Peatland | MRFILGVIVGAVLMLGSAYLHDTGRLQVGPAQPFVNWDTVIGLWSR |
Ga0187775_102983972 | 3300017939 | Tropical Peatland | MKFILGVFVGAALMLGSAYLHDTGMVRAGPPQPFVNWDTLTGMLGK |
Ga0187775_103141662 | 3300017939 | Tropical Peatland | MKFVLGVFVGAALMLGSAYLHDTRMVRVGPAQPFVNWDTVVGMLGR |
Ga0187786_100346852 | 3300017944 | Tropical Peatland | MKFILGVFVGAALMVSSAYLHDTGVVRAGPKQPFVNWDTVIGMWQR |
Ga0187786_100372033 | 3300017944 | Tropical Peatland | MRFILGAFVGAALMLGSAYVHDTGMVRAGPKQPFVNWDTVVSLWGR |
Ga0187786_100437793 | 3300017944 | Tropical Peatland | MKFIYGVFCGAFLMLGSAYLHDTGRIKAGPPQPFVNWDTVFGMLPH |
Ga0187786_100536902 | 3300017944 | Tropical Peatland | MRFIFGVFVGAALMLGSAFLHDKGVVRAGPKQPFVNWDTVMSMLAR |
Ga0187786_101542801 | 3300017944 | Tropical Peatland | MKFILGVFVGAALMVGSAYLHDTGMVRAGPKQPFVNWDT |
Ga0187786_102701872 | 3300017944 | Tropical Peatland | MRFIFGVFVGAALMLGSAFLHDKGVVRAGPKQPFVNWDTVMGMLAR |
Ga0187785_1000041312 | 3300017947 | Tropical Peatland | MKFILGVFVGAALMVGSAYLHDTGMVRAGPKQPFVNWDTVIGMWGR |
Ga0187785_1000131110 | 3300017947 | Tropical Peatland | MKFILGVFVGAALMVSSAYLHDTGVVRAGPKQPFVNWDTVIGMWRR |
Ga0187785_101070262 | 3300017947 | Tropical Peatland | MRFIFGVFVGAALMLGSAFLHDKGVVRAGPKQPFVNWDTVMSMMAR |
Ga0187785_103703512 | 3300017947 | Tropical Peatland | MRFIFGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVVSLWGR |
Ga0187785_105824662 | 3300017947 | Tropical Peatland | MRFILGVFVGAALMLGSAFLHDKGVVRAGPKQPFVNW |
Ga0187779_100520433 | 3300017959 | Tropical Peatland | MKFILGVFVGAALMLGSAYLHDTRMVRVGPAQPFVNWDTVIGMLGR |
Ga0187778_101129843 | 3300017961 | Tropical Peatland | MKFILGVFVGAALMLGSAYLHDTGVVRAGPQQPFVNWDTVIGMLGR |
Ga0187778_111395811 | 3300017961 | Tropical Peatland | MRFIVGMIVGAVLMLGSAYFHDTRMVQTKTQQFVNWDTMIGLIGR |
Ga0187780_100445013 | 3300017973 | Tropical Peatland | MRFILGVFCGAVLMLGSAYLHDTGMVKAGPVQPFVNWDTLIGMLPH |
Ga0187780_102221923 | 3300017973 | Tropical Peatland | MRFILGVFVGAALMLGSAYLHDTGMVRAGPKQPFVNWDTVVALWGR |
Ga0187777_102383923 | 3300017974 | Tropical Peatland | MRFILGVFCGAVLMLGSAYLHDTGMVKAGPVQPFVNWDTLIGML |
Ga0187823_102578911 | 3300017993 | Freshwater Sediment | MKFIFGVIVGAALMLGSAYLHDTKRVQFGPQQPFVNWATLVGLLGR |
Ga0187767_103440001 | 3300017999 | Tropical Peatland | MKFILGVFVGAALMLGSAYLHDTRMVHVGPAQPFVNWDTVIGMLGR |
Ga0187815_102545682 | 3300018001 | Freshwater Sediment | MRFILGVICGAVLMLGSAYVHDKGMVKAGPAQPFVNWDTVIGMLH |
Ga0187788_101399111 | 3300018032 | Tropical Peatland | MKFILGVVVGAALIVGSAYLHDTGMVQAGPKQPFVNWDT |
Ga0187788_102168141 | 3300018032 | Tropical Peatland | GGLVMRFIFGVFVGAALMLGSAFLHDKGVVRAGPKQPFVNWDTVMGMLAR |
Ga0187788_103869162 | 3300018032 | Tropical Peatland | MRFIFGVFVGAALMLGSAYLHDTGAVRMGPQQPFVNWDTLIGAFGR |
Ga0187867_100502563 | 3300018033 | Peatland | MRFILGVFVGAALMLGSAYLHDTGRMRVGPAQPFVNWDTVFSLAGR |
Ga0187855_102437253 | 3300018038 | Peatland | EAIMRFILGVFVGAALMLGSAYLHDTGRMRVGPAQPFVNWDTVFSLAGR |
Ga0187773_100588002 | 3300018064 | Tropical Peatland | MKFILGVFVGAALMVSSAYLHDTGVVRAGPKQPSVNWDTVIGMWRR |
Ga0187773_103461202 | 3300018064 | Tropical Peatland | MKFILGVVVGAVLMVGSAYLHDTGRIKAGPAQPFVNWDTVVGMLGR |
Ga0187773_111923502 | 3300018064 | Tropical Peatland | VVGAVLMVGSAYMHDTGRMKVGPAQPFVNWDTVFGMLGR |
Ga0184611_10452712 | 3300018067 | Groundwater Sediment | MKFILGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVIGMLGR |
Ga0184628_100014512 | 3300018083 | Groundwater Sediment | MNFIWGVIVGAGLLLGSAYLHDTGVIRAGPTQPFVNWDIVIGMLGR |
Ga0184628_100228493 | 3300018083 | Groundwater Sediment | MKFIWGMIIGAGLMLGSAYLHDTGVIRAGPTQPFVNWDIVIGMLGR |
Ga0187771_100002402 | 3300018088 | Tropical Peatland | MKFLLGVIVGAALMLGSAYLHDTGRLHVGPPQPFVNWDTVVGMLGR |
Ga0187774_101898523 | 3300018089 | Tropical Peatland | VFCGAALMLGSAYLHDTGRLKAGPKQPFVNWDTVIGMLPR |
Ga0213874_102363462 | 3300021377 | Plant Roots | MNFIVGVFVGALLVLGSAYVHDTGMAKFGPQQPFVNWDTVISMLPAR |
Ga0210394_105230113 | 3300021420 | Soil | MRFILGAFCGAVLMLGSAYLHDTGVVRAGPAKPFV |
Ga0126371_108255191 | 3300021560 | Tropical Forest Soil | VKFILGVFVGAVLMLGSAYLHDTKRVHFGPPQPFVNWDTVVGMLGR |
Ga0212124_101876861 | 3300022553 | Freshwater | MRFVLGMFVGAGLMLGSAYLHDTGRVKIGPAQPFVNWDTVFALAGR |
Ga0224551_10685302 | 3300023259 | Soil | MNFLFGIVVGAALMLGSAYLHDTGSVRFGPEQAFVNWDTVLSMMPGR |
Ga0209323_102742711 | 3300025314 | Soil | MRFILGMIVGAALMLGSAYLHDTGVVKAGPKQAFVNWDTVIGMLGR |
Ga0208479_10721832 | 3300025474 | Arctic Peat Soil | MRFILGVFVGAALMLGSAYLHDKGVVNAGPKQAFVNWDVVTGMLGR |
Ga0208587_10755912 | 3300025484 | Arctic Peat Soil | MKFILGLFVGAALLLGSAYVHDKGIVKAGPPQAFVNWDVVTGMLGR |
Ga0207928_10219792 | 3300025494 | Arctic Peat Soil | MKFILGIFVGAALMLGSAYVHDKGMVKVGPAQPFVNWDTVMGMLGR |
Ga0207932_10012925 | 3300025495 | Arctic Peat Soil | MRFILGIIVGAALLLGSAYLHDTGVIKAGPKEAFVNWNTVMGMLGK |
Ga0207929_10470572 | 3300025505 | Arctic Peat Soil | MRFILGLFVGAALLLGSAYLHDKGVVNAGPKQAFVNWDVVTGMLGR |
Ga0208849_10211354 | 3300025664 | Arctic Peat Soil | MRFIFGVVVGAALMLGSAYLHDTGVVKAGPKQPFVDWDTVFALAGR |
Ga0210100_10019344 | 3300025780 | Natural And Restored Wetlands | MRFILGVIIGAGLTVGSAYLHDTGRVKVGPPQPIVNWDTLVGMLGR |
Ga0209584_101309091 | 3300025878 | Arctic Peat Soil | MRFILGMIVGAGVMLGSAYMHDTGRLNMGPRVPFVNWDVVFSLAPR |
Ga0209584_102826762 | 3300025878 | Arctic Peat Soil | MKFILGVFVGAVLMLGSAYLHDTGMVKAGPAQPFVNWDTVFSLVGR |
Ga0209585_102714021 | 3300025891 | Arctic Peat Soil | MRFIWGVIVGAALLLATAYLHDTGVVRFGPPQAFVNWDTVTGMLGK |
Ga0207710_103773502 | 3300025900 | Switchgrass Rhizosphere | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGVLGR |
Ga0207680_100818014 | 3300025903 | Switchgrass Rhizosphere | MKFILGVFVGAALMVGSAYLHNRGVVRAGPKQPFVNWDT |
Ga0207699_101970173 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFILGVFVGAALMVGSAYLHDRGVVRASPKQPFVNWDTVIGMWRR |
Ga0207645_101679613 | 3300025907 | Miscanthus Rhizosphere | MRFILGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTVIGMLRR |
Ga0207707_100788151 | 3300025912 | Corn Rhizosphere | MKFILGVFVGAALMVGSAYLHDRGVVRAGPKQPFVNWD |
Ga0207663_101670123 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFIFGVFVGAALMLGSAFLHDKGVLRAGPKQPFVNWDIVMGM |
Ga0207663_102688372 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFILGVFVGAGLMVASAYVHDIGMVRAGPKQPFVNWDIVIGMLGR |
Ga0207660_108325052 | 3300025917 | Corn Rhizosphere | MRFILGIFVGAGLILGGAYMHDTGQVKFGPAKPFVNWDTVLGLLPR |
Ga0207660_113256302 | 3300025917 | Corn Rhizosphere | ARPGAALMLGSAYLHDTRVVRAGPQQPFVNWDVVVGMLGR |
Ga0207690_114568622 | 3300025932 | Corn Rhizosphere | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLRR |
Ga0207665_100559933 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFIFGVFVGAALMLGSAFLHDEGVLRAGPKQPFVNWDIVMGMLAR |
Ga0207668_105594321 | 3300025972 | Switchgrass Rhizosphere | MKFILGVFVGAALMVGSAYLHDRGVVRAGPKQPFVN |
Ga0208144_10098192 | 3300026040 | Natural And Restored Wetlands | MRFILGVVVGAGLTLGSAYLHDTGRVKVGPPQPIVNWDTLVGMLGR |
Ga0209890_100122723 | 3300026291 | Soil | MRFILGVFVGAVLMLGSAYLHDTGMVKAGPAQPFVNWDIVFSLAGR |
Ga0209890_101173381 | 3300026291 | Soil | MRFILGMIVGAGVMLSAAYMHDTGRLRYGPPAAFVNWDVVFSMVGR |
Ga0207983_10088422 | 3300027310 | Soil | ILGVFVGAALMLGSAYLHDMGVVRAGPKQPFVNWDTVIGMLGR |
Ga0207983_10208872 | 3300027310 | Soil | MRFIFGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVIGMLGR |
Ga0208890_10140503 | 3300027523 | Soil | MRFVLGVFVGAGLMVGSAYLHDTGMVRAGPKQPFVNWDTVIGMWGR |
Ga0209422_10087751 | 3300027629 | Forest Soil | MRFIFGIFIGAALMLGSAYLHDKGIVRAGPAQAFVNW |
Ga0209581_100224115 | 3300027706 | Surface Soil | VKFVLGMLCGAVLMLGSAYVHDRGMVNAAPSQPLVNWDTLIGMLGR |
Ga0209581_10053115 | 3300027706 | Surface Soil | MKFILGVFCGAVLMLGSAYLHDTGMIKAGPAQPFVNWDTVIGMLH |
Ga0209074_100764091 | 3300027787 | Agricultural Soil | MKFILGVFVGAALMLGSAYLHDTRMVRAGPAQPFVNWDTVVGLLGR |
Ga0209287_103609161 | 3300027792 | Freshwater Sediment | MRFILGMFVGAALLLGSAYFHDTGVLRAGPKEPFVNWDT |
Ga0209726_101521201 | 3300027815 | Groundwater | MRFILGVIIGAALILGSAYLHDTGVVKVGPPQAFV |
Ga0209580_100603582 | 3300027842 | Surface Soil | MRFIFGVIVGAALILGLAYLHDTGVVKAGPAQPFVNWATVMAMMGK |
Ga0209517_104355971 | 3300027854 | Peatlands Soil | ASFGEAIMRFILGVFVGAALMLGSAYLHDKGVVNAGPKQAFVNWDVVTGMLGR |
Ga0209579_10000021434 | 3300027869 | Surface Soil | MRFVFGVFVGAALMLGSAYLHDTGVVRAGPSQPFVNWDIVVGLIR |
Ga0209814_1000014911 | 3300027873 | Populus Rhizosphere | MKFILGVFVGAALMLGSAYVHDTGMVKAGPQQPFVNWDTVVGILGR |
Ga0209068_100143432 | 3300027894 | Watersheds | MRFILGVFVGAALMVGSAYVHDIGMVRAGPKQPFVNWDTVIGMWGR |
Ga0209068_101217242 | 3300027894 | Watersheds | MRFVLGMIVGAAVMLGSAYLHDTGVVRIGPAQPYVNWDMVFALVGR |
Ga0209068_102020542 | 3300027894 | Watersheds | MRFIFGVFVGAALMLGSAFLHDKGVLRAGPKQPFVNWDIVIGMLGR |
Ga0209068_102704192 | 3300027894 | Watersheds | MNFIWGVIVGAGLLLGSAYLHDTGVIRAGPTQPFVNWDIVIGMLGK |
Ga0209048_101174974 | 3300027902 | Freshwater Lake Sediment | MHFIAGVIVGAALLLGSAYVHDKNWVRFGPPQAFVNWDTVTGML |
Ga0209583_100037756 | 3300027910 | Watersheds | MRFILGVFVGAALMVGSAFVHDTGMVRAGPKQPFVNWDTVIGMWGR |
Ga0209069_100463402 | 3300027915 | Watersheds | MKFILGVFVGAVLLLGSAYLHDIGIVRAGPKQPFVNWDTVIGMLGR |
Ga0268266_105393622 | 3300028379 | Switchgrass Rhizosphere | MKFILGVFGAYLHDRGVVRAGPKQPFVNWDTVIGMWRR |
Ga0307293_101332431 | 3300028711 | Soil | STFVRASDEILGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVIG |
Ga0307282_100075803 | 3300028784 | Soil | MKFILGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVIG |
Ga0307323_100056924 | 3300028787 | Soil | MKFILGVFVGAALMLGSAYLHDTGVVRAGPKQPFVIGTR |
Ga0307504_104585401 | 3300028792 | Soil | MKFIFGVFVGAALMVGSAYLHDTRMVRVGPAQPFVNWDTVVGMLGR |
Ga0265338_104326862 | 3300028800 | Rhizosphere | MRFIFGMIVGAAVMLGSAYLHDTGRLNMGPKDAFVNWDAVFSLAGR |
Ga0307296_100091324 | 3300028819 | Soil | MAIFSTFVRASDEILGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVIG |
Ga0307304_100141293 | 3300028885 | Soil | MAIFSTFVRASDEILGVFVGAALMLGSAYLHDTGVVRAGPKQPFVIGTR |
Ga0247271_1030125 | 3300029903 | Soil | MRFLFGVAVGAALMLGSAYLHDTGVVKAGPKQPFVNWDTVFALTGR |
Ga0307497_102749052 | 3300031226 | Soil | MRFILGVFVGAALTLGSAYLHDIGVVRAGPKQPFVNWDAVIGMLGR |
Ga0307497_107605582 | 3300031226 | Soil | MRFIFGMFVGAAVMLGSAYLHDTGRLKMGPKDAFVNWDAVFSLAGR |
Ga0265332_103149902 | 3300031238 | Rhizosphere | MRFIFGVFVGAALMLGSAFLHDKGVLRAGPKQPFVNWDTVMSMLAR |
Ga0265325_100053912 | 3300031241 | Rhizosphere | MRFIFGVFVGAGLMLGSAYLHDTGVVRAGPPQPFVNWDTLVGAFH |
Ga0265325_100914481 | 3300031241 | Rhizosphere | MRFILGVFCGAVLMLGSAYLHDTGVVRAGPAKPFVNW |
Ga0265325_102522292 | 3300031241 | Rhizosphere | SAPPVDVGRQAMRFILGVFCGAVLMLGSAYLHDTGVVRAGPAKPFVNWDTVTGMLR |
Ga0265340_104381042 | 3300031247 | Rhizosphere | VRFILGVFVGAALMLGSAYLHDTKRVRFGPPQPFVNWDTVVGMLGR |
Ga0265340_105095691 | 3300031247 | Rhizosphere | MRFIGMIVGAVVMLGSAYLHDTGRIKAGPKDAFVNWDTVFSLAGR |
Ga0265316_108109472 | 3300031344 | Rhizosphere | MRFIFGMIVGAVVMLGSAYLHDTGRLNMGPKDAFVNWDAVFSLAGR |
Ga0310886_100132511 | 3300031562 | Soil | MRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDT |
Ga0310886_100823871 | 3300031562 | Soil | CHRSLFWGESAMRFILGVFVGAALMLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLGR |
Ga0265314_100470725 | 3300031711 | Rhizosphere | MRFIFGIIVGAALMLGSAYLHDTGVIKAGPPQAFVNWDTVFTLVGR |
Ga0265314_100849381 | 3300031711 | Rhizosphere | SMRFIFGMIVGAALVLGSAYLHDTGVIKAGPPQAFVNWDIVTGMLGR |
Ga0310813_103521932 | 3300031716 | Soil | MKFILGVIVGAALMVGSAYLHDTGRVRAGPQQPFVNWDVVVGMLGR |
Ga0310813_121611232 | 3300031716 | Soil | MMRFIIGVFVGAALMLGSAYLHDIGVIHAGPKQPFVNWDTVIGLLAH |
Ga0307473_100294883 | 3300031820 | Hardwood Forest Soil | MRFILGVFVGAALMLGSAYLHDKGVVKAGPPQAFVNWDVVIGMLGR |
Ga0307473_101126482 | 3300031820 | Hardwood Forest Soil | MKFILGVFVGAALMLGSAYLHDKGVVRAGPAQPFVNWDTVIGMLGR |
Ga0308175_1026739812 | 3300031938 | Soil | MRFIFGVFVGAALMLGSAFLHDKGVLRMGPKQPFVNWDTVMAMMAR |
Ga0310901_100140873 | 3300031940 | Soil | MRFILGVFVGAALVLGSAYLHDIGVVRAGPKQPFVNWDTVIGMLGR |
Ga0214473_102115582 | 3300031949 | Soil | MRFVLGMIVGAALMLGSAYLHDSGMVRVGPAQAFVNWDTVFALVGR |
Ga0306926_100320542 | 3300031954 | Soil | MRLLRVFVGDVGSAYMHNTDMVKARPTQPFVKWDTVVGMWPR |
Ga0315278_105398022 | 3300031997 | Sediment | MRFIFGMFVGAAVMLGSAYLHDTGRLKIGPAQPFVNWDTVFSLAGR |
Ga0315540_101347563 | 3300032061 | Salt Marsh Sediment | MKFILGVVVGAGLTLGSAYLHDTGRVKVGPPQPFVNWGTLMQAFAR |
Ga0315281_105963851 | 3300032163 | Sediment | MRFLFGVVIGAALILGGAFVHDSGMVRFGPAQPFVNWTAVFAVIGR |
Ga0315281_106495572 | 3300032163 | Sediment | MRFIVGVVVGAALLLGAAYLHDSGMVRFGPAQPFVNWATVLGIIGR |
Ga0307470_116520852 | 3300032174 | Hardwood Forest Soil | MKFILGVFVGAALMLGSAYVHDTGMVKAGPKQPFVNWDTVIGMLGR |
Ga0315276_104158421 | 3300032177 | Sediment | MRFIFGMFVGAAVMLGSAYLHDTGRLKIGPSQPFVNWATVFSLAGR |
Ga0335085_10000391121 | 3300032770 | Soil | MKFVLGVFVGAALMLGSAYLHDTGRIHVGPKQPLVNWDIVVGMLGR |
Ga0335085_100262975 | 3300032770 | Soil | MRFIMGVIVGAALTLGSAYMHDTGRIHVGPPQPFVNWDTVIGMLGR |
Ga0335085_100729093 | 3300032770 | Soil | MRFIFGVFVGAALMLGSAYLHDTGVVRAGPKQPFVNWDTVVGLLGH |
Ga0335085_101119556 | 3300032770 | Soil | MKFVLGVFVGAALMLGSAYLHDTGRIKAGPPQPFVNWDTVVGLLGR |
Ga0335085_102165282 | 3300032770 | Soil | MKFILGVVVGAVLMVGSAYLHDTGRIKAGPAQPFVNWDTVFGMMGR |
Ga0335085_102714522 | 3300032770 | Soil | MKFILGVFVGAALMLGSAYLHDTKRVRFGPPQPFVNWDAVIGMLGR |
Ga0335085_103357862 | 3300032770 | Soil | VRFILGVFIGAALMLGSAYLHDTKRVHFGPPQPFVNWDTVIGMLGR |
Ga0335085_124184521 | 3300032770 | Soil | MKFILGMIVGAALMLGSAYLHDTGMIKAGPPQAFVNWDTVIGMLGR |
Ga0335082_100960592 | 3300032782 | Soil | MRFILGVFVGAALMVGSAYLHDTGMVRAGPKQPFVNWDTVIRMWGR |
Ga0335082_103324533 | 3300032782 | Soil | MRFILGVFVGAALMLASAYLHDIGVVRAGPPQPFVNWDTVIGMLGR |
Ga0335082_106353772 | 3300032782 | Soil | MRFIFGVFVGAALMLGSAFLHDKGVLRAGPKQPFVNWDTVIGMLGR |
Ga0335082_117003322 | 3300032782 | Soil | MKFILGVFVGAALMLGSAYLHDTGRLRAGPAQPFVNWDTVVGMLGR |
Ga0335079_102043014 | 3300032783 | Soil | MKFILGVVMGAVLMVGSAYLHDTGRIKAGPAQPFVNWDTVVGMLGR |
Ga0335079_102844881 | 3300032783 | Soil | MKFVLGVFVGAALMLGSAYLHDTGRAHFGPPQPFVNWDTVVGMLGR |
Ga0335079_105669652 | 3300032783 | Soil | MKFILGVFVGAALMLGSAYLHDTGRIKAGPPQPFVNWDTVVGMLGH |
Ga0335079_114535782 | 3300032783 | Soil | MRFIYGVFCGAFLMLGSAYLHDTGRIKAGPPQPFVNWDTVFGMLPH |
Ga0335078_101375332 | 3300032805 | Soil | MRFLFGVVCGAVLMLGSAYLHDTGVVRAGPAKPFVNWDTVIGMLH |
Ga0335078_110168652 | 3300032805 | Soil | MRFILGVVCGAVLILGLAYLHDTGVVKAGPAQPFVNWDTVVGMLH |
Ga0335080_114624952 | 3300032828 | Soil | MRFILGVFCGAALMLGSAYLHDTGVVRAGPAQPFVNWDTVVGMLR |
Ga0335070_100156077 | 3300032829 | Soil | MRFILGVFVGAALMLGSAYLHDTGRMPIGPQQPFVNWDTLIGALGH |
Ga0335070_101687894 | 3300032829 | Soil | MRFILGVFFGAALMLGSAYLHDTGVLKAGPPQPFVNWDIVIGMLPH |
Ga0335070_109857892 | 3300032829 | Soil | MRFIFGVLVGAALMLGSAFLHDKGVLRAGPKQPFVNWDTVIGMLGR |
Ga0335070_119817121 | 3300032829 | Soil | VTIRFILGVFVGAALMLGSAYVHDTGVVRAGPKQPFVNWDTVVSLWRR |
Ga0335070_120144792 | 3300032829 | Soil | MKFILGVVVGAVLMVGSAYLHDTGRMKVGPAQPFVNWDTVFGMLGR |
Ga0335081_1001080011 | 3300032892 | Soil | MKFILGVVCGAVLMLGSAYLHDTGVVRAGPAQPFVNWDTVIGMLH |
Ga0335081_100659812 | 3300032892 | Soil | MRFILGVFVGAALMLGSAYLHDTGRMPIGPQQPFVNWGTLIGALGH |
Ga0335081_102555491 | 3300032892 | Soil | MRFIFGVFVGAALMLGSAYLHDTGRMRVGPAQPFV |
Ga0335081_102802562 | 3300032892 | Soil | MKFILGVFVGAALMLGSAYLHDKGVVKAGPAQPFVNWDTVIGMLGR |
Ga0335081_103675643 | 3300032892 | Soil | MRFILGVFVGAALMLGSAYLHDTGVVRAGPTQPFVNWDTVIGMLGH |
Ga0335081_105460223 | 3300032892 | Soil | MKFVLGVFVGAALMLGSAYLHDTGVVRVGPPQPFVNWDTLT |
Ga0335081_105555253 | 3300032892 | Soil | MKFILGLFCGAALMLGSAYLHDTGVVKAGPAQPFVNWDIVIGMLPH |
Ga0335081_108991381 | 3300032892 | Soil | MKFILGMVVGAVLMVGSAYLHDTGRIKAGPAQPFVNWDI |
Ga0335081_116583732 | 3300032892 | Soil | MRFVVGMIVGAGLMLGSAYLHDTGTLRVGPKQAFVNWDTVFGMMGR |
Ga0335069_107258891 | 3300032893 | Soil | YGVFCGAFLMLGSAYLHDTGRIKAGPPQPFVNWDTVFGMLPH |
Ga0335084_108829881 | 3300033004 | Soil | TTIAQEAQLMKFILGVFVGAALMLGSAYLHDTRVVRVGPAQPFVNWDTVVGMLGR |
Ga0335084_118610441 | 3300033004 | Soil | VRFILGMVAGAVLMVGSAYVHDTRMTQARTQQFVNWDTVIGLIGR |
Ga0310810_107263552 | 3300033412 | Soil | MRFIFGVFVGAALMVGSAYMHDTGMVRAGPKQPFVNWDTVIGMLGR |
Ga0326726_100338863 | 3300033433 | Peat Soil | MRFVLGVFVGAALMVGSAYLHDTGMVRAGPKQPFVNWDTVIGMWGR |
Ga0326726_103213563 | 3300033433 | Peat Soil | MKFILGVFVGAALMLGSAYLHDTGVVRAGPAKPFVNWDTVVGMLGR |
Ga0326726_103962172 | 3300033433 | Peat Soil | MRFIFGVFVGASLMLGSAFLHDKGVLRAGPKQPFVNWDTVIGMLGR |
Ga0316620_105133402 | 3300033480 | Soil | MKFILGVVVGAVLMLGSAYLHDTGRLRVGPAQPFVTWDTVIGMLGK |
Ga0316624_1000006914 | 3300033486 | Soil | MKFILGVVVGAVLMLGSAYLHDTGRLRVGPAQPFVNWDTVIGMLGK |
Ga0326730_10119062 | 3300033500 | Peat Soil | MRFVLGVFVGAALMVGSAYLHDTGMVRAGPKQPFVNWDTVIRMWGR |
Ga0316628_1015190131 | 3300033513 | Soil | VGTALMLGSAYLHDTGRLKVGPRQPFVNWATVIWLLGR |
Ga0314863_098824_103_243 | 3300033804 | Peatland | MRFILGMIFGAALMLVSAYLHDTGRIKAGPPQAFVNWDVVFAMMGR |
Ga0314867_019987_2_124 | 3300033808 | Peatland | MMKFIYGVFCGAFLMLGSAYLHDTGRIKAGPPQPFVNWDTV |
Ga0326723_0075325_942_1082 | 3300034090 | Peat Soil | MRFILGVFVGAALLIGSAYLHDIGVVRAGPKKPFVNWDIVIGMLGR |
Ga0326723_0164455_168_305 | 3300034090 | Peat Soil | MKFILGVFVGAALMLGSAYLHDTGVVRAGPAKPFVNWDIVIGMLR |
Ga0370493_0053799_17_157 | 3300034129 | Untreated Peat Soil | MRFIFGMFVGAAVVLGSAYLHDTGRLKMGPNEALVNWDAVFSLAGR |
Ga0370501_0068855_170_313 | 3300034195 | Untreated Peat Soil | MKFILGVFVGAVLMLGSAYLHDIGVVRAGPAQPFVNWDTVVGMLAGR |
⦗Top⦘ |