NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F008181

Metagenome / Metatranscriptome Family F008181

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F008181
Family Type Metagenome / Metatranscriptome
Number of Sequences 337
Average Sequence Length 36 residues
Representative Sequence MNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR
Number of Associated Samples 223
Number of Associated Scaffolds 337

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.52 %
% of genes near scaffold ends (potentially truncated) 7.42 %
% of genes from short scaffolds (< 2000 bps) 82.79 %
Associated GOLD sequencing projects 213
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.110 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(9.199 % of family members)
Environment Ontology (ENVO) Unclassified
(29.377 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(29.377 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.38%    β-sheet: 0.00%    Coil/Unstructured: 47.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 337 Family Scaffolds
PF03100CcmE 44.21
PF01578Cytochrom_C_asm 32.34
PF03379CcmB 2.97
PF02272DHHA1 2.37
PF16327CcmF_C 2.08
PF00005ABC_tran 1.19
PF01680SOR_SNZ 0.89
PF01174SNO 0.59
PF13180PDZ_2 0.30
PF00285Citrate_synt 0.30
PF01106NifU 0.30
PF04020Phage_holin_4_2 0.30
PF13450NAD_binding_8 0.30
PF00903Glyoxalase 0.30
PF13517FG-GAP_3 0.30
PF00817IMS 0.30

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 337 Family Scaffolds
COG2332Cytochrome c biogenesis protein CcmEPosttranslational modification, protein turnover, chaperones [O] 44.21
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 2.97
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 0.89
COG0118Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisHAmino acid transport and metabolism [E] 0.59
COG0311Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase)Coenzyme transport and metabolism [H] 0.59
COG0372Citrate synthaseEnergy production and conversion [C] 0.30
COG0389Nucleotidyltransferase/DNA polymerase DinP involved in DNA repairReplication, recombination and repair [L] 0.30
COG0694Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domainPosttranslational modification, protein turnover, chaperones [O] 0.30
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 0.30


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.11 %
UnclassifiedrootN/A0.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2061766000|BDMC2_FXAG6RB01CW11BAll Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria523Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105495761All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi634Open in IMG/M
3300000956|JGI10216J12902_102874943All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria881Open in IMG/M
3300000956|JGI10216J12902_105001194All Organisms → cellular organisms → Bacteria2187Open in IMG/M
3300001213|JGIcombinedJ13530_105298310All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300001843|RCM34_1000621All Organisms → cellular organisms → Bacteria5498Open in IMG/M
3300005526|Ga0073909_10000338All Organisms → cellular organisms → Bacteria16022Open in IMG/M
3300005526|Ga0073909_10071375All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300005526|Ga0073909_10357558All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005526|Ga0073909_10374714All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium665Open in IMG/M
3300005555|Ga0066692_10435119All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium834Open in IMG/M
3300005558|Ga0066698_10023857All Organisms → cellular organisms → Bacteria3625Open in IMG/M
3300005574|Ga0066694_10380943All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300005617|Ga0068859_102672116All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005618|Ga0068864_100193329All Organisms → cellular organisms → Bacteria1866Open in IMG/M
3300005618|Ga0068864_100706453All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300005713|Ga0066905_100302873All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300005713|Ga0066905_100392393All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1123Open in IMG/M
3300005713|Ga0066905_101149462All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300005719|Ga0068861_100272906All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300005719|Ga0068861_101198161All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium734Open in IMG/M
3300005764|Ga0066903_100085110All Organisms → cellular organisms → Bacteria4158Open in IMG/M
3300005764|Ga0066903_100332724All Organisms → cellular organisms → Bacteria2437Open in IMG/M
3300005764|Ga0066903_101587721All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300005764|Ga0066903_101775844All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300005764|Ga0066903_103388674All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300005764|Ga0066903_104811391All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium718Open in IMG/M
3300005764|Ga0066903_106262099All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium622Open in IMG/M
3300005829|Ga0074479_11034826All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005831|Ga0074471_10238274All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005831|Ga0074471_10990496All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300005833|Ga0074472_10503534All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria608Open in IMG/M
3300005833|Ga0074472_11342148All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005836|Ga0074470_10947715All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1261Open in IMG/M
3300005843|Ga0068860_100397080All Organisms → cellular organisms → Bacteria1364Open in IMG/M
3300006034|Ga0066656_10969746All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006046|Ga0066652_100794757All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300006052|Ga0075029_100500413All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300006057|Ga0075026_100408272All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300006577|Ga0074050_11836791All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300006796|Ga0066665_11038610All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300006797|Ga0066659_10405280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae1073Open in IMG/M
3300006804|Ga0079221_10678663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporomusa713Open in IMG/M
3300006844|Ga0075428_100115189All Organisms → cellular organisms → Bacteria2928Open in IMG/M
3300006844|Ga0075428_101201896All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006846|Ga0075430_100232369All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300006846|Ga0075430_100933397All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300006847|Ga0075431_100651205All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300006847|Ga0075431_101135959All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria745Open in IMG/M
3300006847|Ga0075431_101499026All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300006852|Ga0075433_10017148All Organisms → cellular organisms → Bacteria5991Open in IMG/M
3300006852|Ga0075433_10084553All Organisms → cellular organisms → Bacteria2801Open in IMG/M
3300006852|Ga0075433_10172299All Organisms → cellular organisms → Bacteria1926Open in IMG/M
3300006852|Ga0075433_11586073All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300006854|Ga0075425_100158592All Organisms → cellular organisms → Bacteria2595Open in IMG/M
3300006854|Ga0075425_100505988All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300006854|Ga0075425_100621099All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300006854|Ga0075425_100885863All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300006854|Ga0075425_101285171All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300006871|Ga0075434_100329193All Organisms → cellular organisms → Bacteria1548Open in IMG/M
3300006871|Ga0075434_101236416All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300006903|Ga0075426_10443996All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300006914|Ga0075436_100349585All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300006914|Ga0075436_101563471All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium501Open in IMG/M
3300007004|Ga0079218_12305747All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300009009|Ga0105105_10749972All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium585Open in IMG/M
3300009012|Ga0066710_100392154All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum2067Open in IMG/M
3300009012|Ga0066710_100402374All Organisms → cellular organisms → Bacteria2041Open in IMG/M
3300009012|Ga0066710_100786827All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300009012|Ga0066710_100937311All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1334Open in IMG/M
3300009012|Ga0066710_101182745All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1184Open in IMG/M
3300009012|Ga0066710_101240095All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1156Open in IMG/M
3300009012|Ga0066710_101253692All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1149Open in IMG/M
3300009012|Ga0066710_104588221All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium516Open in IMG/M
3300009085|Ga0105103_10020236All Organisms → cellular organisms → Bacteria3262Open in IMG/M
3300009094|Ga0111539_10242052All Organisms → cellular organisms → Bacteria2100Open in IMG/M
3300009094|Ga0111539_10617611All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1262Open in IMG/M
3300009094|Ga0111539_10966345All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300009098|Ga0105245_13062339All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300009137|Ga0066709_100035616All Organisms → cellular organisms → Bacteria5374Open in IMG/M
3300009137|Ga0066709_100833031All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1339Open in IMG/M
3300009137|Ga0066709_101979040All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300009137|Ga0066709_103604496All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300009148|Ga0105243_11585359All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum681Open in IMG/M
3300009156|Ga0111538_10677795All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300009156|Ga0111538_13880641All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium517Open in IMG/M
3300009162|Ga0075423_10127299All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300009168|Ga0105104_10351205All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300009176|Ga0105242_11241159All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300009177|Ga0105248_10190436All Organisms → cellular organisms → Bacteria2311Open in IMG/M
3300009235|Ga0103857_10010784All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300009506|Ga0118657_10762701All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300009509|Ga0123573_10268441All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1661Open in IMG/M
3300009553|Ga0105249_10589080All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1166Open in IMG/M
3300009553|Ga0105249_12959467All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium545Open in IMG/M
3300009609|Ga0105347_1001316All Organisms → cellular organisms → Bacteria10810Open in IMG/M
3300009806|Ga0105081_1031960All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium700Open in IMG/M
3300009868|Ga0130016_10006771All Organisms → cellular organisms → Bacteria20263Open in IMG/M
3300009870|Ga0131092_10118617All Organisms → cellular organisms → Bacteria3035Open in IMG/M
3300009873|Ga0131077_10002098All Organisms → cellular organisms → Bacteria50738Open in IMG/M
3300009873|Ga0131077_10478860All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1160Open in IMG/M
3300009873|Ga0131077_10744475All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria864Open in IMG/M
3300009873|Ga0131077_11295832All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300009873|Ga0131077_11505525All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium552Open in IMG/M
3300010046|Ga0126384_10807208All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300010046|Ga0126384_11002139All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium760Open in IMG/M
3300010304|Ga0134088_10725538All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium500Open in IMG/M
3300010357|Ga0116249_11080871All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300010357|Ga0116249_11766545All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium545Open in IMG/M
3300010358|Ga0126370_11302185All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium681Open in IMG/M
3300010359|Ga0126376_12396183All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300010361|Ga0126378_10749556All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1087Open in IMG/M
3300010362|Ga0126377_10768030All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300010362|Ga0126377_12818540All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300010391|Ga0136847_10915540All Organisms → cellular organisms → Bacteria8503Open in IMG/M
3300010397|Ga0134124_10136754All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300010398|Ga0126383_10019663All Organisms → cellular organisms → Bacteria5140Open in IMG/M
3300010398|Ga0126383_10359676All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1479Open in IMG/M
3300010398|Ga0126383_11222761All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium841Open in IMG/M
3300010398|Ga0126383_11889318All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300010399|Ga0134127_11590760All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria728Open in IMG/M
3300010399|Ga0134127_11617579All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300010403|Ga0134123_10349232All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1335Open in IMG/M
3300010403|Ga0134123_13026242All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria539Open in IMG/M
3300010403|Ga0134123_13648723All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium500Open in IMG/M
3300011423|Ga0137436_1092589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales794Open in IMG/M
3300011429|Ga0137455_1194417All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300011438|Ga0137451_1023850All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300011439|Ga0137432_1235754All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300011440|Ga0137433_1262011All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium563Open in IMG/M
3300012198|Ga0137364_10421416All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300012201|Ga0137365_10493222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae900Open in IMG/M
3300012201|Ga0137365_10549358All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium848Open in IMG/M
3300012201|Ga0137365_10588042All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300012203|Ga0137399_11206843All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300012204|Ga0137374_10227931All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300012209|Ga0137379_11477910All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium581Open in IMG/M
3300012210|Ga0137378_10670897All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium947Open in IMG/M
3300012212|Ga0150985_113276738All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium517Open in IMG/M
3300012212|Ga0150985_123006559All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium535Open in IMG/M
3300012349|Ga0137387_10438108All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium948Open in IMG/M
3300012349|Ga0137387_10933456All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300012350|Ga0137372_10694593All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300012351|Ga0137386_10802055All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium676Open in IMG/M
3300012355|Ga0137369_10425665All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300012356|Ga0137371_11301693All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300012358|Ga0137368_10776591All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012668|Ga0157216_10099766All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300012683|Ga0137398_10855185All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300012685|Ga0137397_10185873All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300012685|Ga0137397_10701367All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium752Open in IMG/M
3300012685|Ga0137397_10805638All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012903|Ga0157289_10032590All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1227Open in IMG/M
3300012922|Ga0137394_10126560All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium2165Open in IMG/M
3300012922|Ga0137394_10312421All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1342Open in IMG/M
3300012922|Ga0137394_11560859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium518Open in IMG/M
3300012922|Ga0137394_11613797All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012924|Ga0137413_11322655All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium579Open in IMG/M
3300012931|Ga0153915_13468089Not Available511Open in IMG/M
3300012944|Ga0137410_10385375All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1127Open in IMG/M
3300012944|Ga0137410_12130500All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium500Open in IMG/M
3300012948|Ga0126375_10031584All Organisms → cellular organisms → Bacteria2632Open in IMG/M
3300012948|Ga0126375_10210497All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300012956|Ga0154020_10075765All Organisms → cellular organisms → Bacteria3382Open in IMG/M
3300012971|Ga0126369_10645690All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1132Open in IMG/M
3300012971|Ga0126369_11803116All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium701Open in IMG/M
3300013308|Ga0157375_13642037All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300014318|Ga0075351_1037980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes844Open in IMG/M
3300014323|Ga0075356_1193126All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300014326|Ga0157380_11283314All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300014502|Ga0182021_10908438All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300015054|Ga0137420_1383923All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300015241|Ga0137418_10870414All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium666Open in IMG/M
3300015245|Ga0137409_10820621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales765Open in IMG/M
3300015255|Ga0180077_1086807All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium653Open in IMG/M
3300015255|Ga0180077_1093407All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria631Open in IMG/M
3300015264|Ga0137403_11201823All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300015371|Ga0132258_10982007All Organisms → cellular organisms → Bacteria2134Open in IMG/M
3300015371|Ga0132258_11072691All Organisms → cellular organisms → Bacteria2036Open in IMG/M
3300015371|Ga0132258_11787469All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300015371|Ga0132258_12475188All Organisms → cellular organisms → Bacteria1299Open in IMG/M
3300015371|Ga0132258_12841555All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1205Open in IMG/M
3300015374|Ga0132255_102632921All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium769Open in IMG/M
3300017936|Ga0187821_10297089All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300017966|Ga0187776_11421352All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium529Open in IMG/M
3300018055|Ga0184616_10164227All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria825Open in IMG/M
3300018063|Ga0184637_10146753All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1455Open in IMG/M
3300018063|Ga0184637_10255204All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1068Open in IMG/M
3300018064|Ga0187773_10526201All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium710Open in IMG/M
3300018077|Ga0184633_10086551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1615Open in IMG/M
3300018077|Ga0184633_10107824All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1439Open in IMG/M
3300018078|Ga0184612_10410923All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300018082|Ga0184639_10139012All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300018083|Ga0184628_10009549All Organisms → cellular organisms → Bacteria4685Open in IMG/M
3300018083|Ga0184628_10025835All Organisms → cellular organisms → Bacteria2914Open in IMG/M
3300018083|Ga0184628_10547261All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium592Open in IMG/M
3300018433|Ga0066667_10232595All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1382Open in IMG/M
3300018433|Ga0066667_11184652All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300018482|Ga0066669_10931149All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300018920|Ga0190273_10615183All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium823Open in IMG/M
3300019238|Ga0180112_1025541All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300019265|Ga0187792_1207188All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300019458|Ga0187892_10004738All Organisms → cellular organisms → Bacteria22390Open in IMG/M
3300019458|Ga0187892_10161762All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1239Open in IMG/M
3300019487|Ga0187893_10312495All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1112Open in IMG/M
3300019487|Ga0187893_10880391All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium536Open in IMG/M
3300019880|Ga0193712_1060938All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium824Open in IMG/M
3300019880|Ga0193712_1071877All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300019880|Ga0193712_1117674All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300019998|Ga0193710_1026880All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium586Open in IMG/M
3300020004|Ga0193755_1039388All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1554Open in IMG/M
3300020057|Ga0163151_10258310All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium972Open in IMG/M
3300021081|Ga0210379_10015308All Organisms → cellular organisms → Bacteria2854Open in IMG/M
3300021082|Ga0210380_10563668All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium522Open in IMG/M
3300021329|Ga0210362_1220917All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium641Open in IMG/M
3300021344|Ga0193719_10348554All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium616Open in IMG/M
3300021445|Ga0182009_10514312All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium632Open in IMG/M
3300024245|Ga0247677_1026363All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300024254|Ga0247661_1050727All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300024275|Ga0247674_1022783All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300024323|Ga0247666_1043333All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium920Open in IMG/M
3300025324|Ga0209640_10727640All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300025535|Ga0207423_1023071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporomusa1032Open in IMG/M
3300025910|Ga0207684_10209157All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300025910|Ga0207684_11381634All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300025917|Ga0207660_11485273All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300025918|Ga0207662_10851150All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300025922|Ga0207646_10386360All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300025922|Ga0207646_10872887All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300025925|Ga0207650_10048360All Organisms → cellular organisms → Bacteria3137Open in IMG/M
3300025935|Ga0207709_10861588All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300025936|Ga0207670_10000021All Organisms → cellular organisms → Bacteria155646Open in IMG/M
3300025941|Ga0207711_10067670All Organisms → cellular organisms → Bacteria3092Open in IMG/M
3300026041|Ga0207639_11283042All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium687Open in IMG/M
3300026319|Ga0209647_1152691All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300026536|Ga0209058_1124015All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1269Open in IMG/M
3300026537|Ga0209157_1104217All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1341Open in IMG/M
3300027513|Ga0208685_1023425All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300027765|Ga0209073_10505332All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300027821|Ga0209811_10123067All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300027821|Ga0209811_10402564All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium531Open in IMG/M
3300027840|Ga0209683_10168389All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300027840|Ga0209683_10259982All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300027874|Ga0209465_10012041All Organisms → cellular organisms → Bacteria3860Open in IMG/M
3300027874|Ga0209465_10040317All Organisms → cellular organisms → Bacteria2220Open in IMG/M
3300027880|Ga0209481_10005599All Organisms → cellular organisms → Bacteria5317Open in IMG/M
3300027887|Ga0208980_10869573All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium501Open in IMG/M
3300027896|Ga0209777_10064765All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum3234Open in IMG/M
3300027900|Ga0209253_10679482All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300027902|Ga0209048_10201403All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1448Open in IMG/M
3300027907|Ga0207428_10066892All Organisms → cellular organisms → Bacteria2830Open in IMG/M
3300027907|Ga0207428_10194636All Organisms → cellular organisms → Bacteria1527Open in IMG/M
3300027909|Ga0209382_10904396All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300027911|Ga0209698_10109836All Organisms → cellular organisms → Bacteria2299Open in IMG/M
3300028381|Ga0268264_10843837All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300028381|Ga0268264_12483694All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium524Open in IMG/M
3300028587|Ga0247828_10263478All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300028647|Ga0272412_1422761All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300028666|Ga0265336_10065331All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300031170|Ga0307498_10057125All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300031170|Ga0307498_10169315All Organisms → cellular organisms → Bacteria740Open in IMG/M
(restricted) 3300031197|Ga0255310_10209692All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium546Open in IMG/M
3300031199|Ga0307495_10136973All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031232|Ga0302323_102621512All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium576Open in IMG/M
3300031543|Ga0318516_10012686All Organisms → cellular organisms → Bacteria4120Open in IMG/M
3300031543|Ga0318516_10070334All Organisms → cellular organisms → Bacteria1939Open in IMG/M
3300031543|Ga0318516_10337060All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300031544|Ga0318534_10655767All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium594Open in IMG/M
3300031576|Ga0247727_10027235All Organisms → cellular organisms → Bacteria8144Open in IMG/M
3300031576|Ga0247727_10846554All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300031576|Ga0247727_11044874All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium559Open in IMG/M
3300031707|Ga0315291_10140611All Organisms → cellular organisms → Bacteria2540Open in IMG/M
3300031707|Ga0315291_10468510All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300031716|Ga0310813_10315520All Organisms → cellular organisms → Bacteria1323Open in IMG/M
3300031716|Ga0310813_11923055All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium557Open in IMG/M
3300031720|Ga0307469_10188918All Organisms → cellular organisms → Bacteria1594Open in IMG/M
3300031720|Ga0307469_10452235All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300031720|Ga0307469_11403949All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300031723|Ga0318493_10183285All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1099Open in IMG/M
3300031740|Ga0307468_100796277All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300031740|Ga0307468_101818121All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031792|Ga0318529_10289030All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium763Open in IMG/M
3300031834|Ga0315290_10018695All Organisms → cellular organisms → Bacteria5345Open in IMG/M
3300031834|Ga0315290_10177767All Organisms → cellular organisms → Bacteria1842Open in IMG/M
3300031847|Ga0310907_10034626All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300031854|Ga0310904_10767724All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium672Open in IMG/M
3300031902|Ga0302322_102084448All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300031918|Ga0311367_11491614All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300031952|Ga0315294_10028626All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix6020Open in IMG/M
3300032009|Ga0318563_10200971All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300032012|Ga0310902_10878381All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium616Open in IMG/M
3300032091|Ga0318577_10427254All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium633Open in IMG/M
3300032118|Ga0315277_10015702All Organisms → cellular organisms → Bacteria9377Open in IMG/M
3300032157|Ga0315912_10002028All Organisms → cellular organisms → Bacteria22654Open in IMG/M
3300032163|Ga0315281_11174000All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300032173|Ga0315268_10129384All Organisms → cellular organisms → Bacteria2388Open in IMG/M
3300032173|Ga0315268_10552354All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1140Open in IMG/M
3300032173|Ga0315268_10622803All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1072Open in IMG/M
3300032177|Ga0315276_12265332All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium548Open in IMG/M
3300032180|Ga0307471_100871141All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300032180|Ga0307471_103549902All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium552Open in IMG/M
3300032180|Ga0307471_104096097All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium515Open in IMG/M
3300032342|Ga0315286_10034866All Organisms → cellular organisms → Bacteria5258Open in IMG/M
3300032397|Ga0315287_11193319All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria876Open in IMG/M
3300032516|Ga0315273_11409407All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix863Open in IMG/M
3300032770|Ga0335085_10023819All Organisms → cellular organisms → Bacteria8655Open in IMG/M
3300032770|Ga0335085_10029357All Organisms → cellular organisms → Bacteria7687Open in IMG/M
3300032770|Ga0335085_10812353All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum1028Open in IMG/M
3300032770|Ga0335085_11339249All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium753Open in IMG/M
3300032828|Ga0335080_10438470All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria1396Open in IMG/M
3300032828|Ga0335080_10840219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae946Open in IMG/M
3300032829|Ga0335070_10461228All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1208Open in IMG/M
3300032829|Ga0335070_11675757All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium577Open in IMG/M
3300032892|Ga0335081_11436004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporomusa768Open in IMG/M
3300032893|Ga0335069_10969719All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300032897|Ga0335071_10020299All Organisms → cellular organisms → Bacteria6684Open in IMG/M
3300032955|Ga0335076_10161614All Organisms → cellular organisms → Bacteria2153Open in IMG/M
3300033004|Ga0335084_10815911All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300033004|Ga0335084_11720106All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300033158|Ga0335077_11684779All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300033233|Ga0334722_10337162All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300033233|Ga0334722_10812885All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300033233|Ga0334722_11308752Not Available506Open in IMG/M
3300033412|Ga0310810_10002194All Organisms → cellular organisms → Bacteria20807Open in IMG/M
3300033432|Ga0326729_1025783All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300033433|Ga0326726_10427996All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1259Open in IMG/M
3300033433|Ga0326726_11864184All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300033482|Ga0316627_101337699All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium716Open in IMG/M
3300033486|Ga0316624_10026850All Organisms → cellular organisms → Bacteria3360Open in IMG/M
3300033513|Ga0316628_104292833All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria506Open in IMG/M
3300033814|Ga0364930_0161512All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300034099|Ga0373902_073777All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium744Open in IMG/M
3300034147|Ga0364925_0255242All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium652Open in IMG/M
3300034155|Ga0370498_032083All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300034669|Ga0314794_095192All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300034818|Ga0373950_0166605All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium512Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.20%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.34%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment5.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.97%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.37%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.78%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater1.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.19%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.19%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.19%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.89%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.89%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.89%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.89%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.89%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.89%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.59%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.59%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.59%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.59%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.59%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.59%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.59%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.59%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.59%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.59%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.59%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.30%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.30%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.30%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.30%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.30%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.30%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.30%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.30%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.30%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.30%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.30%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.30%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.30%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.30%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.30%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.30%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.30%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.30%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.30%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.30%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.30%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.30%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.30%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.30%
Benzene-Degrading BioreactorEngineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor0.30%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2061766000Benzene-degrading bioreactor microbial communities from Toronto, Ontario, Canada, that are methanogenic - September 2009 gDNA_4EngineeredOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001843Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2bEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009806Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60EnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012956Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MGEngineeredOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019265Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300019998Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021329Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300024275Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028647Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033432Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fractionEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034099Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3EngineeredOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034669Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BDMC2_001874002061766000Benzene-Degrading BioreactorEGGLDGNIVVLGVALLVWGLLFLYLLRLERRIRELEKR
INPhiseqgaiiFebDRAFT_10549576123300000364SoilMRGDLVVMAVALLVWGLLFWYLVRLERRVAELEKK*
JGI10216J12902_10287494323300000956SoilMDVSGGNLVVLGVALLVWGLLFAWLVRLDRRVRDLEKR*
JGI10216J12902_10500119433300000956SoilLNSKDLTVLLVALVVWGLLFGYLLRLERRVRDLERK*
JGIcombinedJ13530_10529831023300001213WetlandMNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR*
RCM34_100062153300001843Marine PlanktonMDHNWVVLGVSLLVWTLLFVWIVRVERRVADLERSGGTGKESR*
Ga0073909_10000338123300005526Surface SoilMDRNWVVLGVSLMLWGLLFFWILRVERRVRDVEKR*
Ga0073909_1007137523300005526Surface SoilVTGNAVVLGVSLLVWGLVFFYLIRLERRVKELERK*
Ga0073909_1035755823300005526Surface SoilMRGNGVVLGVALFVWGLLFIYLVRLERRIRDLEKQ*
Ga0073909_1037471433300005526Surface SoilMDRNWVVLGVSLMLWGLLFVWILRVERRIRDVEKR*
Ga0066692_1043511933300005555SoilMSGTWTVLGVALVAWGLLFVYLVRLERRIKELERR*
Ga0066698_1002385733300005558SoilVSGNLVVLGVALLAWLLLFFYLMRLERRIKELEKR*
Ga0066694_1038094323300005574SoilMDRNWVVLGVALLVWGLLFTWILRVERRLNEMEKR*
Ga0068859_10267211623300005617Switchgrass RhizosphereMDRNWVVLGVSLMLWGLLFIWILRVERRVRDVEKR*
Ga0068864_10019332943300005618Switchgrass RhizosphereVNANFVVAGVALLVWGMVFFYLARLERRVRELEKR*
Ga0068864_10070645333300005618Switchgrass RhizosphereVNPNWVVLGVALLVWGLVFVYLTRLERRIRELEKK*
Ga0066905_10030287333300005713Tropical Forest SoilMKGDLVVMAVALLVWGLLFWYLIRLERRVADLEKR*
Ga0066905_10039239323300005713Tropical Forest SoilMNGNWVVLGVSLLVWGMLFAWILRVERRLDEMEKK*
Ga0066905_10114946213300005713Tropical Forest SoilQGPDMDRNWVVLGVSLMLWGLLFFWILRVERRVRDMEKQ*
Ga0068861_10027290623300005719Switchgrass RhizosphereMDRNWVVLAVSLMLWGLLFFWILRVERRVRDVEKR*
Ga0068861_10119816133300005719Switchgrass RhizosphereMRGDLVVMAVALLVWGLLFWYLVRLERRVADLEKR*
Ga0066903_10008511033300005764Tropical Forest SoilMDRNWVVLGVSLLVWGLLFFWILRVERRVSEVEKR*
Ga0066903_10033272433300005764Tropical Forest SoilMKGDLVVMAVALLVWGLLFWYLIRLERRVAELEKK*
Ga0066903_10158772133300005764Tropical Forest SoilVTGNAVVLGVSLLVWGLVFFYLIRLERRIKELERK*
Ga0066903_10177584423300005764Tropical Forest SoilMDRNWVVLGVSLMLWGLLFFWILRVERRIRDVEKR*
Ga0066903_10338867413300005764Tropical Forest SoilMKGDLVVMAVALLVWGLLFWYLIRLERRVADLEKK*
Ga0066903_10481139113300005764Tropical Forest SoilRDPLDPKDLTVLGVALLVWGLLFFYVMRLERRVRDLERR*
Ga0066903_10626209913300005764Tropical Forest SoilGPDMDRNWVVLGVSLLVWGLLFFWILRVERMVRDVEKR*
Ga0074479_1103482623300005829Sediment (Intertidal)MSGGNVVMGVSLLTWGLLFYYLIRIERRVKELEKK*
Ga0074471_1023827413300005831Sediment (Intertidal)MDRNWVVLGVSLLVWGLLFGWILRVERRLNDMEKR*
Ga0074471_1099049633300005831Sediment (Intertidal)MDRNWVVLGVSLLVWGLLFVWILRVERRLNDMEKR*
Ga0074472_1050353423300005833Sediment (Intertidal)VIEGLAMDRNWVVLGVSLLVWGLLFAWILRVEKRLNDMEKR*
Ga0074472_1134214823300005833Sediment (Intertidal)VNGNWVVMGVALLVWGLLFLYLVRIEKRIRDLEKP*
Ga0074470_1094771533300005836Sediment (Intertidal)VTGNNVVLGVALLVWGLLFFYLVRLESRIKKLEK*
Ga0068860_10039708023300005843Switchgrass RhizosphereMDRNWVVLGVSLMLWGLLFFWILRVERRVREVEKR*
Ga0066656_1096974623300006034SoilVNGNLVVLGVALLGWLLLFFYLVRLERRIKELEKR*
Ga0066652_10079475723300006046SoilLNSKDLTVLFVALVVWGLLFGYLVRLERRVRDLERK*
Ga0075029_10050041323300006052WatershedsMDRNWVVLGVSLLVWGLLFSWILRVEKRVNELEKK*
Ga0075026_10040827213300006057WatershedsMDRNWVVLGVSLLVWGLLFSWLLRVEKRVRELEKR*
Ga0074050_1183679123300006577SoilMDRNWVVLGVSLMLWGLLFFWILRVERRVRVPPEG*
Ga0066665_1103861023300006796SoilMVLDANWVVLGVAMLAWGLLFYYLVRLDRRIKELEKQ*
Ga0066659_1040528023300006797SoilLNGNGVVLSVALLTWGLLFVYLVRIERRIRKLEKQ*
Ga0079221_1067866323300006804Agricultural SoilMNANLVVLLVALLTWGLLFTYLVRLEKRIRDLEKS*
Ga0075428_10011518933300006844Populus RhizosphereMTGNNVVLAVALLVWGLLFYYLLRLEGRIRKLEK*
Ga0075428_10120189633300006844Populus RhizosphereMSGGNVVMGVALLTWGLLFYYLVRIERRVKELEKK*
Ga0075430_10023236933300006846Populus RhizosphereMDRNWVVLGVSLLVWGLLFAWILRVEKRLNELERR*
Ga0075430_10093339713300006846Populus RhizosphereVTGNNVVLAVALLVWGLLFYYLLRLEGRIRKLEK*
Ga0075431_10065120523300006847Populus RhizosphereMDRNWVVLGVSLLVWGLLFAWILRVERRLDEMEKR*
Ga0075431_10113595933300006847Populus RhizosphereMDRNWVVLGVSLLVWGLLFLWILRLERRVRDVEKR*
Ga0075431_10149902623300006847Populus RhizosphereMNGNLVVLGVALLAWGLLFFYLARLERRIKELEKR*
Ga0075433_1001714873300006852Populus RhizosphereVNGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKP*
Ga0075433_1008455323300006852Populus RhizosphereVTGNVVVLGVALLTWALLFAYLLRLERRVKDLERR*
Ga0075433_1017229943300006852Populus RhizosphereMDRNWVVLGVSLLVWGLLFLWILRLERRVREVEKR*
Ga0075433_1158607323300006852Populus RhizosphereMDRNWVVLGVSLLVWGLLFTWILRLERRVREVERR*
Ga0075425_10015859233300006854Populus RhizosphereVNGNLVVLAVALLVWGLLFVYLMRIERRVRDLERK*
Ga0075425_10050598823300006854Populus RhizosphereVNGNAVVMGVALLVWGLLFFYLMRLEARINKLEK*
Ga0075425_10062109923300006854Populus RhizosphereMDRNWVVLGVSLLVWGLLFFWILRVERRVREVEKR*
Ga0075425_10088586323300006854Populus RhizosphereVRGEGGVSGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKS*
Ga0075425_10128517123300006854Populus RhizosphereVNGNAVVLGVALLVWGLVFFYLLRLEGRISKLEK*
Ga0075434_10032919323300006871Populus RhizosphereLSGTVAVLMVAILTWGLLFFYLMRLERRIKDLEKR*
Ga0075434_10123641623300006871Populus RhizosphereVNPNWVVLGVALLVWGLVFVYLSWLERRIRELEKR*
Ga0075426_1044399623300006903Populus RhizosphereMNLNWVVAGVALLTWGLVFLYLTRLERRIRELEKR*
Ga0075436_10034958533300006914Populus RhizosphereWERCMNLNWVVAGVALLTWGLVFLYLTRLERRIRELEKR*
Ga0075436_10156347123300006914Populus RhizosphereMNANLTVLAVALVAWGLLFFYLVRLERRIKELERR*
Ga0079218_1230574723300007004Agricultural SoilMNGEMTVLIVALLGWGLLFWYLIRLERRVRDLERK*
Ga0105105_1074997213300009009Freshwater SedimentVWTLNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR*
Ga0066710_10039215433300009012Grasslands SoilMNGNLTVLGVALLAWGLIFVYLWRLERRIKELERK
Ga0066710_10040237443300009012Grasslands SoilMNANVTVLGVSLLVWGLVFVYLWRLERRVKELERK
Ga0066710_10078682733300009012Grasslands SoilMNLNWVVAGVALLTWGLVFIYLTRLERRIRELEKR
Ga0066710_10093731123300009012Grasslands SoilVNGNLVVLGVTLLAWVLLFFYLVRLERRIKELEKR
Ga0066710_10118274523300009012Grasslands SoilMSGTWTVLGVALVAWGLLFVYLVRLERRIKELERR
Ga0066710_10124009523300009012Grasslands SoilMDRNWVVLGVALLVWGLLFVWILRVERRLNEMEKR
Ga0066710_10125369233300009012Grasslands SoilVSGNLVVLGVALLVWGLLFFYLARLERRIKELEKR
Ga0066710_10458822113300009012Grasslands SoilTGTGEPGMNGNQVVCGVALLVWGLVFFYLTRLERRIRELEKR
Ga0105103_1002023633300009085Freshwater SedimentVNGNLVVLGVALLAWGLLFLYLLRLERRIRDLEKR*
Ga0111539_1024205243300009094Populus RhizosphereMDRNWVVLAVSVMLWGLLFLWILRVERRVRDVEKR*
Ga0111539_1061761123300009094Populus RhizosphereLNAKDVTVLFVALVVWGLLFGYLLRLERRVRDLERK*
Ga0111539_1096634523300009094Populus RhizosphereMDRNWVVLGVSLLVWGLLFVWILRVEKRLNDMERR*
Ga0105245_1306233913300009098Miscanthus RhizosphereMIGNAVVLGVALLVWGLVFFYLVRLERRIKELGL*
Ga0066709_10003561623300009137Grasslands SoilVSGNLVVMGVSLLTWAATFFYLLRLERRIKELEKP*
Ga0066709_10083303133300009137Grasslands SoilMNGNLTVLGVALLAWGLIFVYLWRLERRIKELERK*
Ga0066709_10197904013300009137Grasslands SoilVNGNLVVLGVALLVWGLLFLYLLRLERRIADLEKR*
Ga0066709_10360449613300009137Grasslands SoilVNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKR*
Ga0105243_1158535923300009148Miscanthus RhizosphereLNGNLVVLGVALLAWGLLFFYLARLERRIKDLEKQ*
Ga0111538_1067779533300009156Populus RhizosphereMDRNWVVLGVSLMLWGLLFFWILRVERRVQEMEKR*
Ga0111538_1388064123300009156Populus RhizosphereVRADWVVLGVTLLVWGMLFAYLIRLERRVKDLEKR*
Ga0075423_1012729953300009162Populus RhizosphereVTGNAVVLGVALLTWALLFVYLLRLERRVKDLERR*
Ga0105104_1035120513300009168Freshwater SedimentRGVWTVNGNLVVLGVALLVWGLLFLYLLRLERRIRDLERR*
Ga0105242_1124115923300009176Miscanthus RhizosphereMYRNWVVLAVSLMLWGLLFFWILRVERRVRDVEKR*
Ga0105248_1019043643300009177Switchgrass RhizosphereVNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKK*
Ga0103857_1001078423300009235River WaterMDHNWVVLGVSLLVWTLLFIWIVRVERRVAELERSGGTGKESR*
Ga0118657_1076270123300009506Mangrove SedimentMSGSMTVLLVALLTWVLLFFYLVRLDRRIKDLEKR*
Ga0123573_1026844133300009509Mangrove SedimentMSGSMTVLLVALFTWVLLFFYLVRLDRRIKDLEKR*
Ga0105249_1058908023300009553Switchgrass RhizosphereVSGNVVVMGVSLLTWAATFFYLLRLERRIKELEKS*
Ga0105249_1295946723300009553Switchgrass RhizosphereMSGNLVVMAVALLVWGLLFWYLIRLERRVADLEKR*
Ga0105347_100131693300009609SoilMGGNGTVLGVALITWGALFVYLLRLERRIKELERQ*
Ga0105081_103196033300009806Groundwater SandVGANGTVLGVALLTWGALFFYLLRMERRIKELERK*
Ga0130016_1000677133300009868WastewaterMDRNFVVLGVSLLVWGLLFVWLLRVEKRVRELEKR*
Ga0131092_1011861733300009870Activated SludgeMSGNLVVLGVSLLVWGMLFFYILRVERRLKELERP*
Ga0131077_10002098423300009873WastewaterVTGNNVVLGVALLIWGLLFVYLMRLEGRIRKLEK*
Ga0131077_1047886023300009873WastewaterMDRNFVVLGVSLLVWGLLFFWLLRVEKRVRELEKR*
Ga0131077_1074447533300009873WastewaterLTGNNVVLGVALLVWGLLFVYLVRLEGRIRKLEK*
Ga0131077_1129583223300009873WastewaterLNANWVVLGVSLLTWGLLFLYLLRLERRIKELEKR*
Ga0131077_1150552523300009873WastewaterVTGNNVVLGVALLVWGLLFVYLMRLEGRIRKLEK*
Ga0126384_1080720823300010046Tropical Forest SoilVTGNAVVLGVALLVWGLVFFYLIRLDRRIKELERK*
Ga0126384_1100213923300010046Tropical Forest SoilMSKEYVVLGVALLVWGLLFLYLWRIDKRLKDMERK*
Ga0134088_1072553823300010304Grasslands SoilMNGNLTVLGVALLAWGLIFIYQWRLERRIKELERK*
Ga0116249_1108087123300010357Anaerobic Digestor SludgeMNSHDMTVLGVALLVWGLLFFWLIRVERRVKDLEKR*
Ga0116249_1176654523300010357Anaerobic Digestor SludgeMDRNWVVLGVSLLVWGLLFFWLLQVEKRVKELEKS*
Ga0126370_1130218533300010358Tropical Forest SoilMDRNWVVLGVSLMLWGLLFFWILRVERRIQEVEKR*
Ga0126376_1239618323300010359Tropical Forest SoilVTGNAVVLGVSLLVWGLVFFYLMRLERRIKELERK*
Ga0126378_1074955633300010361Tropical Forest SoilMDRNWVVLGVSLMLWGLLFFWILRLERRIRDVEKR*
Ga0126377_1076803033300010362Tropical Forest SoilMSGDLVVMAVALLVWGLLFWYLVRLDRRVSELEKK*
Ga0126377_1281854023300010362Tropical Forest SoilMDRNWVVLGVSLMLWGLLFYWILRVERRVQDMEKR*
Ga0136847_1091554073300010391Freshwater SedimentMNANLTVLGVSLLVWGLIFVYLWRLERRVKELERK*
Ga0134124_1013675433300010397Terrestrial SoilVKGDLVVMAVALLVWGLLFWYLIRLERRVADLEKR*
Ga0126383_1001966343300010398Tropical Forest SoilLNGNWVVMGVALLVWGLIFVYLLRLERRIRDLEDR*
Ga0126383_1035967633300010398Tropical Forest SoilMDRNWVVLGVSLMLWGLLFFWILRVERRVRDMEKR*
Ga0126383_1122276123300010398Tropical Forest SoilVSGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKP*
Ga0126383_1188931823300010398Tropical Forest SoilMDRNWVVLGVSLLVWGLLFFWILRVERRVRDVEKR*
Ga0134127_1159076023300010399Terrestrial SoilVNGDVVVLGVALLAWGLVFVWLLRLERRIRDLEKR*
Ga0134127_1161757923300010399Terrestrial SoilMDRNWVVLAVSVMLWGLLFVWILRVERRVRDVEKR*
Ga0134123_1034923233300010403Terrestrial SoilMDRNWVVLGVSLMLWGLLFVWILRVERRVRDVEKR*
Ga0134123_1302624213300010403Terrestrial SoilLNSKDLTVLFVALVVWGVLFVYLLRLERRVRDLERK*
Ga0134123_1364872323300010403Terrestrial SoilMRGNVVVLGVALLVWGLLFFYLWRIERRIREIEKE*
Ga0137436_109258923300011423SoilLNSKDLTVLFVALVVWGLLFGYLLRLERRVRDLERK*
Ga0137455_119441723300011429SoilVNGNLVVLAVSLLTWAVTFFYLLRLERRIKDLEKS*
Ga0137451_102385013300011438SoilGTIVSGNLVVMGVSLLTWAATFFYLLRLERRIKELEKS*
Ga0137432_123575413300011439SoilMSGNAVVMGVALLVWALLFFYIVRVERRIRELEKR*
Ga0137433_126201113300011440SoilTVTGNTVVLVVALLVWGMLFLYLVRLERRIRELERK*
Ga0137364_1042141623300012198Vadose Zone SoilVIGNAVVLGVSLLVWGLVFFYLLRLERRIKELERK*
Ga0137365_1049322223300012201Vadose Zone SoilVNANVTVLGVSLLVWGLVFVYLWRLERRVKELERK*
Ga0137365_1054935823300012201Vadose Zone SoilMDRNWVVLGVALLVWGLLFFWILRVERRLNEMEKR*
Ga0137365_1058804223300012201Vadose Zone SoilMNGNLTVLGVSLLVWGLLFVYLWRLERRLRDLERR*
Ga0137399_1120684323300012203Vadose Zone SoilVNRNWIVLGVALLVWGLVFFYLTRLERRIRELEKR*
Ga0137374_1022793123300012204Vadose Zone SoilMKGNLTVLGVALVAWGLIFVYLWRLERRIKELERK*
Ga0137379_1147791023300012209Vadose Zone SoilMNPNWVVLGVALLVWGLVFLYLTRLERRIRELEKR*
Ga0137378_1067089733300012210Vadose Zone SoilVKGSLVVLGVSLLLWGVVFFYMLRLERRIRDLEKS*
Ga0150985_11327673813300012212Avena Fatua RhizosphereRSVNGNAVVLGVALLVWGLVFFYLLRLEGRISKLEK*
Ga0150985_12300655913300012212Avena Fatua RhizosphereMDANWVVLGVALLAWGLLFAYLARLERRIKELERR*
Ga0137387_1043810823300012349Vadose Zone SoilMNGNLTVLGVALLAWGLVFVYLWRLERRIKELERK*
Ga0137387_1093345623300012349Vadose Zone SoilMNGNLTVLGVSLLVWGLLFFYLWRLERRLRDLERR*
Ga0137372_1069459313300012350Vadose Zone SoilMKGNLTVLGVALVAWGLIFVYLWRLERRVKELERK*
Ga0137386_1080205533300012351Vadose Zone SoilLKGSLVVLGVSLLLWGGLFFYLLRIERRIRDLEKS*
Ga0137369_1042566523300012355Vadose Zone SoilMDRNWVVLGVSLLVWGLLFLWILRLERRVRDVERR*
Ga0137371_1130169323300012356Vadose Zone SoilVSGNLVVLGVALLTWLLLFFYLMRLERRIKELEKR*
Ga0137368_1077659113300012358Vadose Zone SoilMNGNLTVLGVALVAWGLIFVYLWRLERRIKELERK*
Ga0157216_1009976623300012668Glacier Forefield SoilMELDANRVVLGVALLAWGLLFFYLVRLEKRIKDLEKR*
Ga0137398_1085518523300012683Vadose Zone SoilMDRNWVVLGVSLLVWGLLFGWLLRVEKRVRELEKR*
Ga0137397_1018587333300012685Vadose Zone SoilMGNTVVLGVSLLVWGLLFFYLIRLERRIQSLERK*
Ga0137397_1070136723300012685Vadose Zone SoilMGLNGNLVVLGVALLVWGLLFVYLVRLEKRIRELEKR*
Ga0137397_1080563823300012685Vadose Zone SoilVNADWVVLGVALLTWALVFGWLLRLERRIRDLEKR*
Ga0157289_1003259023300012903SoilMDRNYVVLGVSLLVWGLLFAWIVRVERRVRELEKRG*
Ga0137394_1012656033300012922Vadose Zone SoilMNGNVTVLAVSLLVWGLVFVYLWRLERRVKELERK*
Ga0137394_1031242133300012922Vadose Zone SoilMNANMTVLGVSLLVWGLIFIYLWRLERRVKELERK*
Ga0137394_1156085923300012922Vadose Zone SoilMSGNLVVLAVALLVWGLLFFYLLRLERRIKELEKR*
Ga0137394_1161379723300012922Vadose Zone SoilMDRNWVVLGGSLLVWGLLFTWILRLERRVREVERR*
Ga0137413_1132265523300012924Vadose Zone SoilMSANLTVLAVALLVWGLLFVYVWRLERRIKELERK*
Ga0153915_1346808923300012931Freshwater WetlandsMLNGNVVVLGVALLVWGLLFLYLLRLERRIRDLERR*
Ga0137410_1038537523300012944Vadose Zone SoilMSANLTVMAVALLVWGLVFVYLWRLERRIKELERK*
Ga0137410_1213050013300012944Vadose Zone SoilPQGLAMDRNWVVLGVALLVWGLLFVWILRVERRLNEMEKR*
Ga0126375_1003158423300012948Tropical Forest SoilVSGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKS*
Ga0126375_1021049733300012948Tropical Forest SoilMKGDLVVMSVALLVWGLLFWYLIRLERRVAELEKR*
Ga0154020_1007576533300012956Active SludgeMDRNWVVLGVSLLVWGLLFFWLLSVEKRVKELEKS*
Ga0126369_1064569023300012971Tropical Forest SoilMDRNWVVLGVSLLVWGLLFFWILRVERMVREVEKR*
Ga0126369_1180311633300012971Tropical Forest SoilMNANLTVLGVSLLVWGLLFIYVWRLERRVKELERK*
Ga0157375_1364203723300013308Miscanthus RhizosphereVNGNVVVAGVALLVWGMVFFYLARLERRVRELEKR*
Ga0075351_103798023300014318Natural And Restored WetlandsVSGNLVVLGVSLLAWAATFFYLLRLERRVKELEKS*
Ga0075356_119312623300014323Natural And Restored WetlandsVWTVNGNLVVLGVALLVWGLLFLYLLRLDRRVRDLEKR*
Ga0157380_1128331423300014326Switchgrass RhizosphereMDANWVVLGVALLAWGLLFGYLTRLERRIKELERR*
Ga0182021_1090843833300014502FenVWTLNGNLVVLGVALLAWGLLFLYLLRLERRIRDLEKR*
Ga0137420_138392343300015054Vadose Zone SoilMSANMTVLGVSLLVWGLIFIYLWRLERRVKELERK*
Ga0137418_1087041423300015241Vadose Zone SoilMDRNWVVLGVALLVWGLLFVWILRVERRLNEMEKR*
Ga0137409_1082062123300015245Vadose Zone SoilVNGDWVVLGVALLTWALVFGWLLRLERRIRDLEKR*
Ga0180077_108680723300015255SoilLSGNTVVLGVALLVWGMLFFYLVRLERRIRELERK*
Ga0180077_109340723300015255SoilMDRNWVVLSVSLLVWGLLFAWILRVEKRLNELERR*
Ga0137403_1120182323300015264Vadose Zone SoilMNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKR*
Ga0132258_1098200743300015371Arabidopsis RhizosphereMDRNWVVLGVSLMLWGLLFFWILRVERRIREVEKR*
Ga0132258_1107269123300015371Arabidopsis RhizosphereMTQGDWVVAGVALIVWGLVFFYLTRLDRRIKELEKR*
Ga0132258_1178746933300015371Arabidopsis RhizosphereVNSNWVVLGVSLLVWGLLFVYLVRLERRIRELERR*
Ga0132258_1247518823300015371Arabidopsis RhizosphereMRGALVVMAVALLVWGLLFWYLVRLERRVADLEKR*
Ga0132258_1284155513300015371Arabidopsis RhizosphereMSGNLAVLGVALLVWGLLFFYLARLERRIKELEKR*
Ga0132255_10263292133300015374Arabidopsis RhizosphereVNGNLVVMGVSLLTWAAMFFYLLRLERRIKDLEKP*
Ga0187821_1029708923300017936Freshwater SedimentMDRNYVVLFVSLLAWGLLFAWLLRVDRRVRELEKK
Ga0187776_1142135223300017966Tropical PeatlandVNGNWVVMGVALLVWGLLFFYLLRLEKRIRDLEKS
Ga0184616_1016422733300018055Groundwater SedimentVGGALNSKDLTVLFVALVVWGLLFGYLLRLERRVRDLERK
Ga0184637_1014675333300018063Groundwater SedimentVNGNLVVLGVSLLTWAATFFYLLRLERRIKELEKS
Ga0184637_1025520423300018063Groundwater SedimentVSGDLVVMIVAVLVWGLLFGYLWRLERRVADLEKK
Ga0187773_1052620133300018064Tropical PeatlandVNGNLVVMGVSLLTWAAMFFYLVRLERRIKDLEKS
Ga0184633_1008655133300018077Groundwater SedimentVNGNLVVLGVALLVWGMLFGYLYRLERRIKDLEKR
Ga0184633_1010782433300018077Groundwater SedimentVPRESQRECRVDRNWIVLGVALLVWGLVFFYLTRLERRIRELEKR
Ga0184612_1041092323300018078Groundwater SedimentVNPNWVVLGVALLVWGLVFFYLMRLERRIRELEKR
Ga0184639_1013901233300018082Groundwater SedimentVSGNLVVLGVSLLTWAATFFYLLRLERRIKELEKS
Ga0184628_1000954923300018083Groundwater SedimentLNSKDLTVLFVALVVWGLLFGYLLRLERRVRDLERK
Ga0184628_1002583553300018083Groundwater SedimentMNHNYVVLGVSLLVWGLLFAWILRVEARVRELEKR
Ga0184628_1054726123300018083Groundwater SedimentMDRNWVVLSVSLLVWGLLFVWILRVEKRLNDMERR
Ga0066667_1023259533300018433Grasslands SoilVSGNLVVLGVALLAWLLLFFYLMRLERRIKELEKR
Ga0066667_1118465223300018433Grasslands SoilMDRNWVVLGVALLVWGLLFTWILRVERRLNEMEKR
Ga0066669_1093114913300018482Grasslands SoilMDWNWVVLGVALLVWGLLFTWILRVARRLSEMEQR
Ga0190273_1061518323300018920SoilVNGNLAVLGVALLLWGAVFFYLMRLERRVKDLEKR
Ga0180112_102554123300019238Groundwater SedimentMKGNVVVLLVALLAWGMLFFYLSRLERRIRDLEKR
Ga0187792_120718823300019265PeatlandMDRNWVVLGVALLAWGLLFVWILRVERRLNEMEKR
Ga0187892_1000473873300019458Bio-OozeMDRNWVVLGVSLLVWGLLFAWILRVERRLHDMERR
Ga0187892_1016176233300019458Bio-OozeVIGNNVVLIVSLLAWGLLFFYLVRLERRITELERK
Ga0187893_1031249523300019487Microbial Mat On RocksMDRNWVVLGVSLLVWGLLFAWILRVERRLNDMERR
Ga0187893_1088039123300019487Microbial Mat On RocksMRGDVVVLAVALLAWGLLFFYLTRLERRIRDLEKH
Ga0193712_106093823300019880SoilMDRNWVVLGVALLVWGLLFVWILRVERRLKEMEKR
Ga0193712_107187723300019880SoilVNQNWVVLGVALLTWGLVFFYLTHLERRIRELEKR
Ga0193712_111767423300019880SoilMDRNWVVLGVALLVWGMLFVWIVRVEKRVTDLEKK
Ga0193710_102688013300019998SoilYLLSGNQVVLAVALLVWGLLFLYLLRLERRVKDLEKR
Ga0193755_103938833300020004SoilMNANVTVLGVSLLVWGLVFIYLWRLERRVKELERK
Ga0163151_1025831023300020057Freshwater Microbial MatMNSHDMTVLGVALLVWGLLFFWLIRVERRVKDLEKR
Ga0210379_1001530813300021081Groundwater SedimentVSGNLVVMGVSLLTWAATFFYLLRLERRIKELEKS
Ga0210380_1056366823300021082Groundwater SedimentLNSKDLTVLLVALVVWGLLFGYLLRLERRVRDLERK
Ga0210362_122091723300021329EstuarineMDRNFVVLGVSLLVWGLLFVWILRVERRLNDMEKR
Ga0193719_1034855423300021344SoilVNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKR
Ga0182009_1051431233300021445SoilVSPKGGRLDANWVVMGVALLAWGLLFAYLSRLERRIKELEKQ
Ga0247677_102636323300024245SoilMDRNWVVLGVSLMLWGLLFFWILRVERRIRDVEKR
Ga0247661_105072723300024254SoilMDRNWVVLGVSLMLWGLLFFWILRVERRVREVEKR
Ga0247674_102278313300024275SoilMDRNWVVLGVSLLVWGLLFVWLLRVEKRVRELEKR
Ga0247666_104333323300024323SoilMDRNWVVLGVSLMLWGLLFFWILRVERRVRDVEKQ
Ga0209640_1072764013300025324SoilMSGGNVVMGVALLTWGLLFYYLVRIERRMKELEKR
Ga0207423_102307123300025535Natural And Restored WetlandsMGANGVVLGVALLAWGLLFFYLVRLERRIRDLEKS
Ga0207684_1020915723300025910Corn, Switchgrass And Miscanthus RhizosphereMDRNWVVLAVSLMLWGLLFFWILRVERRVRDVEKR
Ga0207684_1138163423300025910Corn, Switchgrass And Miscanthus RhizosphereMSGTWTVLSVALVAWGLLFFYLVRLERRIKELERR
Ga0207660_1148527323300025917Corn RhizosphereMSGNLVVMAVALLVWGLLFWYLIRLERRVADLEKR
Ga0207662_1085115023300025918Switchgrass RhizosphereMRGDLVVMAVALLVWGLLFWYLVRLERRVADLEKR
Ga0207646_1038636033300025922Corn, Switchgrass And Miscanthus RhizosphereMDRNWVVLGVSLMLWGLLFVWILRVERRVRDVEKR
Ga0207646_1087288713300025922Corn, Switchgrass And Miscanthus RhizosphereVTGNVVVLAVSLLVWGLLFFYLIRLERRIKELERR
Ga0207650_1004836023300025925Switchgrass RhizosphereVNPNWVVLGVALLVWGLVFVYLTRLERRIRELEKK
Ga0207709_1086158823300025935Miscanthus RhizosphereLNGNLVVLGVALLAWGLLFFYLARLERRIKDLEKQ
Ga0207670_10000021133300025936Switchgrass RhizosphereMDRNWVVLGVSLMLWGLLFIWILRVERRVRDVEKR
Ga0207711_1006767033300025941Switchgrass RhizosphereVNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKK
Ga0207639_1128304233300026041Corn RhizosphereMIGNAVVLGVALLVWGLVFFYLVRLERRIKELERK
Ga0209647_115269113300026319Grasslands SoilRSHTTRTDMDRNWVVLGVALLVWGLLFTWILRVERRLKEVEKR
Ga0209058_112401533300026536SoilVNGNLVVLGVALLVWGLLFLYLLRLERRIADLEKR
Ga0209157_110421733300026537SoilGEPVSGNLVVLGVALLAWLLLFFYLMRLERRIKELEKR
Ga0208685_102342523300027513SoilMGGNGTVLGVALITWGALFVYLLRLERRIKELERQ
Ga0209073_1050533223300027765Agricultural SoilVNGNLVVMGVALLVWGLLFFYLLRIERRVRDLERK
Ga0209811_1012306723300027821Surface SoilMRGNGVVLGVALFVWGLLFIYLVRLERRIRDLEKQ
Ga0209811_1040256423300027821Surface SoilVRGEGDVSGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKS
Ga0209683_1016838923300027840Wetland SedimentMNGNMVVMGVALLTWGLVFFYLLRLDRRIRDLEKR
Ga0209683_1025998223300027840Wetland SedimentMNGNWVVMGVALLVWGLLFVYILRVERRIKDLEKR
Ga0209465_1001204153300027874Tropical Forest SoilMKGDLVVMAVALLVWGLLFWYLIRLERRVAELEKK
Ga0209465_1004031723300027874Tropical Forest SoilMDRNWVVLGVSLLVWGLLFFWILRVERMVREVEKR
Ga0209481_1000559933300027880Populus RhizosphereMDRNWVVLGVSLLVWGLLFAWILRVEKRLNELERR
Ga0208980_1086957313300027887WetlandDTVNGNLVVLGVALLVWGLLFLYLLRLERRVRDLERR
Ga0209777_1006476543300027896Freshwater Lake SedimentVNGNLVVLGVALLAWGLLFLYLLRLERRIRDLEKR
Ga0209253_1067948223300027900Freshwater Lake SedimentVWTLNGNLVVLVVALLGWGLLFLYLLRLERRIRDLEKR
Ga0209048_1020140333300027902Freshwater Lake SedimentVWTLNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR
Ga0207428_1006689233300027907Populus RhizosphereLNAKDVTVLFVALVVWGLLFGYLLRLERRVRDLERK
Ga0207428_1019463623300027907Populus RhizosphereMDRNWVVLAVSVMLWGLLFLWILRVERRVRDVEKR
Ga0209382_1090439623300027909Populus RhizosphereMSGGNVVMGVALLTWGLLFYYLVRIERRVKELEKK
Ga0209698_1010983633300027911WatershedsMDRNWVVLGVSLLVWGLLFSWILRVEKRVNELEKK
Ga0268264_1084383733300028381Switchgrass RhizospherePQESPDMDRNWVVLGVSLMLWGLLFFWILRVERRVREVEKR
Ga0268264_1248369423300028381Switchgrass RhizosphereMRGDLVVMAVALLVWGLLFWYLIRLERRVADLEKR
Ga0247828_1026347823300028587SoilMDANWVVLGVALLAWGLLFAYLSRLERRIKELERR
Ga0272412_142276123300028647Activated SludgeMDRNWVVLGVSLLVWGLLFSWLIRVERRVKELERK
Ga0265336_1006533123300028666RhizosphereMDRNWVVLGVALLVWGLLCAWLLRVEKRVRELEKR
Ga0307498_1005712533300031170SoilMDRNWVVLGVSLLVWGLLFVWILRVEKRLNDMERR
Ga0307498_1016931523300031170SoilMDRNWVVLGVALLVWGLLFFWILRVERRLNEMEKR
(restricted) Ga0255310_1020969223300031197Sandy SoilLSGNVVVLGVALLVWGLLFFYIVRLERRIKELEKS
Ga0307495_1013697323300031199SoilMDRNWVVLGVSLMLWGLLFFWILRVERRVSEVEKR
Ga0302323_10262151223300031232FenMDRNWVVLGVSLLVWGLLFSWLIRVEKRVKDLERK
Ga0318516_1001268643300031543SoilMNANLTVLGVSLLVWGLLFIYVWRLERRVKELERK
Ga0318516_1007033433300031543SoilMDRNWVVLGVSLLVWGLLFFWILRVERMVKDAEKR
Ga0318516_1033706023300031543SoilMDRNWVVLGVSLMLWGLLFFWILRVERRIRDVENR
Ga0318534_1065576713300031544SoilNRLNANLVVLGVALLVWGLLFVYLLRLERRIRELEKR
Ga0247727_1002723563300031576BiofilmMVGNAVVMGVSLLVWGLLFYYLVRLERRVSELEKK
Ga0247727_1006811133300031576BiofilmMSGGNVVMGVALLTWGLLFYYLVRIERRVKELEKR
Ga0247727_1084655423300031576BiofilmVSGNVVVLAVAVLVWGLLFLYLSRLEKRIKELEKR
Ga0247727_1104487423300031576BiofilmLNGNLVVMGVALLTWGLLFLYLVRLERRLRELEKS
Ga0315291_1014061153300031707SedimentVNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR
Ga0315291_1046851023300031707SedimentVWALNGNLVVLGVALLVWGLLFLYLLRLERRVRDLEKR
Ga0310813_1031552023300031716SoilVNPNWVVLGVALLVWGLVFVYLTRLDRRIRELEKK
Ga0310813_1192305523300031716SoilVNANFVVAGVALLVWGMVFFYLARLERRVRELEKR
Ga0307469_1018891823300031720Hardwood Forest SoilMNANMTVLGVSLLVWGLVFVYLWRLERRVKELERK
Ga0307469_1045223523300031720Hardwood Forest SoilMSKEYVVLGVALLAWGLLFLYLWRIDKRLKDLERK
Ga0307469_1140394923300031720Hardwood Forest SoilVNRNWIVLGVALLVWGLVFFYLTRLERRIRELEKR
Ga0318493_1018328533300031723SoilGNRLNANLVVLGVALLVWGLLFVYLLRLERRIRELEKR
Ga0307468_10079627723300031740Hardwood Forest SoilVIGNAVVLGVALLVWGLIFFYLIRLDRRIKELERK
Ga0307468_10181812123300031740Hardwood Forest SoilMDRNWVVLGVSLMLWGLLFFWILRVERRVRDAEKR
Ga0318529_1028903033300031792SoilLNANLVVLGVALLVWGLLFVYLLRLERRIRELEKR
Ga0315290_1001869533300031834SedimentVQLDANGVVLGVALLVWGLLFFYLVRLERRIKDLEKR
Ga0315290_1017776723300031834SedimentVIGNQVVLGVALLVWGLLFFYLVRLERRISGLEKK
Ga0310907_1003462633300031847SoilMDRNWVVLGVSLLVWGLLFAWILRVEKRLNDMERR
Ga0310904_1076772433300031854SoilEEYVLSGNQVVLAVALLVWGLLFFYLLRIERRVKDLEKR
Ga0302322_10208444823300031902FenMDHIDKNWVVLGVSLLVWGMLFVWLLLVEKRVRELERK
Ga0311367_1149161423300031918FenMDRNWVVLGVSLLVWGLLFTWLLRVEKRVRELEKR
Ga0315294_1002862653300031952SedimentVWNVNGNLVVLGVALLAWGLLFLYLLRLERRIRDLEKR
Ga0318563_1020097133300032009SoilAGGNRLNANLVVLGVALLVWGLLFVYLLRLERRIRELEKR
Ga0310902_1087838123300032012SoilVSGNLVVMGVSLLTWAATFFYLLRLERRIKELEKP
Ga0318577_1042725433300032091SoilISSGPDLDRNWVVLGVSLLVWGLLFFWILRVERMVKDAEKR
Ga0315277_10015702103300032118SedimentVWTLNGNLVVLGVALLVWGLLFLYLLRLERRVRDLEKR
Ga0315912_10002028113300032157SoilMDRNWVVLGVSLLVWGLLFGWILRVEKRLNDMERR
Ga0315281_1117400023300032163SedimentMDRNWVVLGVSLLVWGLLFSWLIRVEKRVRELEKK
Ga0315268_1012938443300032173SedimentMNGNLVVLGVALLVWGMLFLYLLRLERRIRELEKR
Ga0315268_1055235423300032173SedimentLNANLTVLGVALLVWGLLFVYLLRLERRLRDLEKR
Ga0315268_1062280323300032173SedimentVNGNLVVLGVALLVWGMLFLYLLRLERRIKELEKR
Ga0315276_1226533223300032177SedimentVWNVNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR
Ga0307471_10087114123300032180Hardwood Forest SoilMDRNWVVLGVSLLVWGLLFTWILRLERRVREVERR
Ga0307471_10354990223300032180Hardwood Forest SoilMNGNLVVLGVALLAWGLLFFYLARLERRIRELEKR
Ga0307471_10409609723300032180Hardwood Forest SoilMRGDLVVMAVALLTWGLLFWYLVRVERRVADLEKR
Ga0315286_1003486633300032342SedimentVSGNLVVMGVALLVWGLLFLFLVRLERRMKELEKR
Ga0315287_1119331923300032397SedimentVWTVNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR
Ga0315273_1140940723300032516SedimentMDRNWVVLGVSLLVWGLLFIWILRVERRLNEMEKR
Ga0335085_1002381953300032770SoilMDRNWIVLGVSLLVWGLLFLWLVRVEKRVKELERK
Ga0335085_1002935723300032770SoilMKGNWVVMGVALLVWGLIFVYLVRLEKRIRNLEDR
Ga0335085_1081235323300032770SoilVGRIDVNQNLVVLGVALLAWGLLFGYLLRLERRVKELEKQ
Ga0335085_1133924923300032770SoilMKGNWVVMGVALLVWGLIFVYLVRLERRIRDLEDR
Ga0335080_1043847033300032828SoilMDRNFVVLGVSLLVWGLIFLWLLRVDRRVRELERK
Ga0335080_1084021923300032828SoilMDRNYVVLGVSLLVWGLLFAWLLRVERRVRDLERK
Ga0335070_1046122833300032829SoilVSGNLVVLGVALLVWGLLFVYLVRLERRVRELEKR
Ga0335070_1167575723300032829SoilVRIPLNPDDTAVLLVALLVWGLLFFYVLRLERRVKDLEKR
Ga0335081_1143600423300032892SoilMDRNWVVLGVSLLIWGLLCAWLLRVESRVRELEKR
Ga0335069_1096971923300032893SoilMDRNWVVLGVSLLVWGLLFIWLVRVERRVKELEKK
Ga0335071_1002029933300032897SoilVWVLNGNLVVLGVALLVWGLLFLYLLRLERRIRDLERR
Ga0335076_1016161443300032955SoilMQGNWVVLGVALLVWGMLFFYILRVERRLTDLEKR
Ga0335084_1081591123300033004SoilMSGTMAVLLVALLAWGLVFVWLLRLERRVKEIEKS
Ga0335084_1172010623300033004SoilVNQNLVVLGVALLAWGLLFGYLLRLERRVKELEKR
Ga0335077_1168477923300033158SoilMDRNYVVLGVSLLVWGLIFLWVLRVDRRVRELEKK
Ga0334722_1033716233300033233SedimentVWIVNGNLVVLGVSLLVWGLLFLFLLRLERRIRDLERR
Ga0334722_1081288523300033233SedimentVDRNFVVLGVALLVWGLLFIYILRIERRVRELEKR
Ga0334722_1130875223300033233SedimentMDRNWVVLGVSLLVWTLLFLWLVRVERRVKELEKR
Ga0310810_10002194133300033412SoilMNGNLVVLGVALLTWGLLFTYLVRLEKRIRDLEKP
Ga0326729_102578313300033432Peat SoilVWTLNGNLVVLGVALLVWGLLFVYLIRLERRIRDLEKR
Ga0326726_1042799633300033433Peat SoilVNGNLVVLGVALLVWGLLFLYLLRLEHRIRDLEKR
Ga0326726_1186418423300033433Peat SoilMDRNWVVLGVSLLVWGLLFFWLLRVERRLNEMEKR
Ga0316627_10133769933300033482SoilMDRNFVVLGVSLLVWGLLFLWLLRVEKRVRELEKR
Ga0316624_1002685033300033486SoilLNGNLVVLGVALLVWGLLFLYLLRLERRIRELEKR
Ga0316628_10429283313300033513SoilVWTLNGNLVVLGVALLVWGLLFLYLLRLERRIRELERR
Ga0364930_0161512_384_4913300033814SedimentMNANLTVLGVSLLVWGLIFVYLWRLERRIKELERK
Ga0373902_073777_214_3303300034099Sediment SlurryVWILNGNLVVLSVALLVWGLLFLYLLRLERRVRDLEKR
Ga0364925_0255242_385_4923300034147SedimentVNGNLVVLAVSLLTWAVTFFYLLRLERRIKDLEKS
Ga0370498_032083_798_9053300034155Untreated Peat SoilMDRNFVVLGVSLLVWGLLFFWLLRVEKRVRELEKR
Ga0314794_095192_153_2603300034669SoilMDRTWVVLGVSLLVWGLLFAWILRVEKRLNELERR
Ga0373950_0166605_177_2843300034818Rhizosphere SoilMDRNWVVLGVALLVWGLLFGWVLRVERRVKELEKR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.