Basic Information | |
---|---|
Family ID | F008181 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 337 |
Average Sequence Length | 36 residues |
Representative Sequence | MNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR |
Number of Associated Samples | 223 |
Number of Associated Scaffolds | 337 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 84.52 % |
% of genes near scaffold ends (potentially truncated) | 7.42 % |
% of genes from short scaffolds (< 2000 bps) | 82.79 % |
Associated GOLD sequencing projects | 213 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.110 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.199 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.377 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (29.377 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 337 Family Scaffolds |
---|---|---|
PF03100 | CcmE | 44.21 |
PF01578 | Cytochrom_C_asm | 32.34 |
PF03379 | CcmB | 2.97 |
PF02272 | DHHA1 | 2.37 |
PF16327 | CcmF_C | 2.08 |
PF00005 | ABC_tran | 1.19 |
PF01680 | SOR_SNZ | 0.89 |
PF01174 | SNO | 0.59 |
PF13180 | PDZ_2 | 0.30 |
PF00285 | Citrate_synt | 0.30 |
PF01106 | NifU | 0.30 |
PF04020 | Phage_holin_4_2 | 0.30 |
PF13450 | NAD_binding_8 | 0.30 |
PF00903 | Glyoxalase | 0.30 |
PF13517 | FG-GAP_3 | 0.30 |
PF00817 | IMS | 0.30 |
COG ID | Name | Functional Category | % Frequency in 337 Family Scaffolds |
---|---|---|---|
COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 44.21 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 2.97 |
COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.89 |
COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.59 |
COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.59 |
COG0372 | Citrate synthase | Energy production and conversion [C] | 0.30 |
COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.30 |
COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.30 |
COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.30 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.11 % |
Unclassified | root | N/A | 0.89 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2061766000|BDMC2_FXAG6RB01CW11B | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 523 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105495761 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi | 634 | Open in IMG/M |
3300000956|JGI10216J12902_102874943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 881 | Open in IMG/M |
3300000956|JGI10216J12902_105001194 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
3300001213|JGIcombinedJ13530_105298310 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300001843|RCM34_1000621 | All Organisms → cellular organisms → Bacteria | 5498 | Open in IMG/M |
3300005526|Ga0073909_10000338 | All Organisms → cellular organisms → Bacteria | 16022 | Open in IMG/M |
3300005526|Ga0073909_10071375 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300005526|Ga0073909_10357558 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005526|Ga0073909_10374714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 665 | Open in IMG/M |
3300005555|Ga0066692_10435119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 834 | Open in IMG/M |
3300005558|Ga0066698_10023857 | All Organisms → cellular organisms → Bacteria | 3625 | Open in IMG/M |
3300005574|Ga0066694_10380943 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300005617|Ga0068859_102672116 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005618|Ga0068864_100193329 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
3300005618|Ga0068864_100706453 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300005713|Ga0066905_100302873 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300005713|Ga0066905_100392393 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1123 | Open in IMG/M |
3300005713|Ga0066905_101149462 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300005719|Ga0068861_100272906 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
3300005719|Ga0068861_101198161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 734 | Open in IMG/M |
3300005764|Ga0066903_100085110 | All Organisms → cellular organisms → Bacteria | 4158 | Open in IMG/M |
3300005764|Ga0066903_100332724 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
3300005764|Ga0066903_101587721 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300005764|Ga0066903_101775844 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
3300005764|Ga0066903_103388674 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300005764|Ga0066903_104811391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 718 | Open in IMG/M |
3300005764|Ga0066903_106262099 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 622 | Open in IMG/M |
3300005829|Ga0074479_11034826 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300005831|Ga0074471_10238274 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300005831|Ga0074471_10990496 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300005833|Ga0074472_10503534 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 608 | Open in IMG/M |
3300005833|Ga0074472_11342148 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300005836|Ga0074470_10947715 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1261 | Open in IMG/M |
3300005843|Ga0068860_100397080 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300006034|Ga0066656_10969746 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006046|Ga0066652_100794757 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300006052|Ga0075029_100500413 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300006057|Ga0075026_100408272 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300006577|Ga0074050_11836791 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300006796|Ga0066665_11038610 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300006797|Ga0066659_10405280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae | 1073 | Open in IMG/M |
3300006804|Ga0079221_10678663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporomusa | 713 | Open in IMG/M |
3300006844|Ga0075428_100115189 | All Organisms → cellular organisms → Bacteria | 2928 | Open in IMG/M |
3300006844|Ga0075428_101201896 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006846|Ga0075430_100232369 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300006846|Ga0075430_100933397 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300006847|Ga0075431_100651205 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300006847|Ga0075431_101135959 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 745 | Open in IMG/M |
3300006847|Ga0075431_101499026 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300006852|Ga0075433_10017148 | All Organisms → cellular organisms → Bacteria | 5991 | Open in IMG/M |
3300006852|Ga0075433_10084553 | All Organisms → cellular organisms → Bacteria | 2801 | Open in IMG/M |
3300006852|Ga0075433_10172299 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
3300006852|Ga0075433_11586073 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300006854|Ga0075425_100158592 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
3300006854|Ga0075425_100505988 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300006854|Ga0075425_100621099 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300006854|Ga0075425_100885863 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300006854|Ga0075425_101285171 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300006871|Ga0075434_100329193 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
3300006871|Ga0075434_101236416 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300006903|Ga0075426_10443996 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300006914|Ga0075436_100349585 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300006914|Ga0075436_101563471 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 501 | Open in IMG/M |
3300007004|Ga0079218_12305747 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300009009|Ga0105105_10749972 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 585 | Open in IMG/M |
3300009012|Ga0066710_100392154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 2067 | Open in IMG/M |
3300009012|Ga0066710_100402374 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
3300009012|Ga0066710_100786827 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
3300009012|Ga0066710_100937311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1334 | Open in IMG/M |
3300009012|Ga0066710_101182745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1184 | Open in IMG/M |
3300009012|Ga0066710_101240095 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1156 | Open in IMG/M |
3300009012|Ga0066710_101253692 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1149 | Open in IMG/M |
3300009012|Ga0066710_104588221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 516 | Open in IMG/M |
3300009085|Ga0105103_10020236 | All Organisms → cellular organisms → Bacteria | 3262 | Open in IMG/M |
3300009094|Ga0111539_10242052 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
3300009094|Ga0111539_10617611 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1262 | Open in IMG/M |
3300009094|Ga0111539_10966345 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300009098|Ga0105245_13062339 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300009137|Ga0066709_100035616 | All Organisms → cellular organisms → Bacteria | 5374 | Open in IMG/M |
3300009137|Ga0066709_100833031 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1339 | Open in IMG/M |
3300009137|Ga0066709_101979040 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300009137|Ga0066709_103604496 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300009148|Ga0105243_11585359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 681 | Open in IMG/M |
3300009156|Ga0111538_10677795 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
3300009156|Ga0111538_13880641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 517 | Open in IMG/M |
3300009162|Ga0075423_10127299 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
3300009168|Ga0105104_10351205 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300009176|Ga0105242_11241159 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300009177|Ga0105248_10190436 | All Organisms → cellular organisms → Bacteria | 2311 | Open in IMG/M |
3300009235|Ga0103857_10010784 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300009506|Ga0118657_10762701 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300009509|Ga0123573_10268441 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1661 | Open in IMG/M |
3300009553|Ga0105249_10589080 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1166 | Open in IMG/M |
3300009553|Ga0105249_12959467 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 545 | Open in IMG/M |
3300009609|Ga0105347_1001316 | All Organisms → cellular organisms → Bacteria | 10810 | Open in IMG/M |
3300009806|Ga0105081_1031960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 700 | Open in IMG/M |
3300009868|Ga0130016_10006771 | All Organisms → cellular organisms → Bacteria | 20263 | Open in IMG/M |
3300009870|Ga0131092_10118617 | All Organisms → cellular organisms → Bacteria | 3035 | Open in IMG/M |
3300009873|Ga0131077_10002098 | All Organisms → cellular organisms → Bacteria | 50738 | Open in IMG/M |
3300009873|Ga0131077_10478860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1160 | Open in IMG/M |
3300009873|Ga0131077_10744475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 864 | Open in IMG/M |
3300009873|Ga0131077_11295832 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300009873|Ga0131077_11505525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 552 | Open in IMG/M |
3300010046|Ga0126384_10807208 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300010046|Ga0126384_11002139 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 760 | Open in IMG/M |
3300010304|Ga0134088_10725538 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 500 | Open in IMG/M |
3300010357|Ga0116249_11080871 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300010357|Ga0116249_11766545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 545 | Open in IMG/M |
3300010358|Ga0126370_11302185 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 681 | Open in IMG/M |
3300010359|Ga0126376_12396183 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300010361|Ga0126378_10749556 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1087 | Open in IMG/M |
3300010362|Ga0126377_10768030 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300010362|Ga0126377_12818540 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300010391|Ga0136847_10915540 | All Organisms → cellular organisms → Bacteria | 8503 | Open in IMG/M |
3300010397|Ga0134124_10136754 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
3300010398|Ga0126383_10019663 | All Organisms → cellular organisms → Bacteria | 5140 | Open in IMG/M |
3300010398|Ga0126383_10359676 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1479 | Open in IMG/M |
3300010398|Ga0126383_11222761 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 841 | Open in IMG/M |
3300010398|Ga0126383_11889318 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300010399|Ga0134127_11590760 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 728 | Open in IMG/M |
3300010399|Ga0134127_11617579 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300010403|Ga0134123_10349232 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1335 | Open in IMG/M |
3300010403|Ga0134123_13026242 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 539 | Open in IMG/M |
3300010403|Ga0134123_13648723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 500 | Open in IMG/M |
3300011423|Ga0137436_1092589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales | 794 | Open in IMG/M |
3300011429|Ga0137455_1194417 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300011438|Ga0137451_1023850 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
3300011439|Ga0137432_1235754 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300011440|Ga0137433_1262011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 563 | Open in IMG/M |
3300012198|Ga0137364_10421416 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300012201|Ga0137365_10493222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae | 900 | Open in IMG/M |
3300012201|Ga0137365_10549358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 848 | Open in IMG/M |
3300012201|Ga0137365_10588042 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300012203|Ga0137399_11206843 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300012204|Ga0137374_10227931 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300012209|Ga0137379_11477910 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 581 | Open in IMG/M |
3300012210|Ga0137378_10670897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 947 | Open in IMG/M |
3300012212|Ga0150985_113276738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 517 | Open in IMG/M |
3300012212|Ga0150985_123006559 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 535 | Open in IMG/M |
3300012349|Ga0137387_10438108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 948 | Open in IMG/M |
3300012349|Ga0137387_10933456 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300012350|Ga0137372_10694593 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300012351|Ga0137386_10802055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 676 | Open in IMG/M |
3300012355|Ga0137369_10425665 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300012356|Ga0137371_11301693 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300012358|Ga0137368_10776591 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300012668|Ga0157216_10099766 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300012683|Ga0137398_10855185 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300012685|Ga0137397_10185873 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300012685|Ga0137397_10701367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 752 | Open in IMG/M |
3300012685|Ga0137397_10805638 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300012903|Ga0157289_10032590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1227 | Open in IMG/M |
3300012922|Ga0137394_10126560 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 2165 | Open in IMG/M |
3300012922|Ga0137394_10312421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1342 | Open in IMG/M |
3300012922|Ga0137394_11560859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 518 | Open in IMG/M |
3300012922|Ga0137394_11613797 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012924|Ga0137413_11322655 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 579 | Open in IMG/M |
3300012931|Ga0153915_13468089 | Not Available | 511 | Open in IMG/M |
3300012944|Ga0137410_10385375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1127 | Open in IMG/M |
3300012944|Ga0137410_12130500 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 500 | Open in IMG/M |
3300012948|Ga0126375_10031584 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
3300012948|Ga0126375_10210497 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300012956|Ga0154020_10075765 | All Organisms → cellular organisms → Bacteria | 3382 | Open in IMG/M |
3300012971|Ga0126369_10645690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1132 | Open in IMG/M |
3300012971|Ga0126369_11803116 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 701 | Open in IMG/M |
3300013308|Ga0157375_13642037 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300014318|Ga0075351_1037980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 844 | Open in IMG/M |
3300014323|Ga0075356_1193126 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300014326|Ga0157380_11283314 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300014502|Ga0182021_10908438 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300015054|Ga0137420_1383923 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
3300015241|Ga0137418_10870414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 666 | Open in IMG/M |
3300015245|Ga0137409_10820621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales | 765 | Open in IMG/M |
3300015255|Ga0180077_1086807 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 653 | Open in IMG/M |
3300015255|Ga0180077_1093407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 631 | Open in IMG/M |
3300015264|Ga0137403_11201823 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300015371|Ga0132258_10982007 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300015371|Ga0132258_11072691 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
3300015371|Ga0132258_11787469 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300015371|Ga0132258_12475188 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300015371|Ga0132258_12841555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1205 | Open in IMG/M |
3300015374|Ga0132255_102632921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 769 | Open in IMG/M |
3300017936|Ga0187821_10297089 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300017966|Ga0187776_11421352 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 529 | Open in IMG/M |
3300018055|Ga0184616_10164227 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 825 | Open in IMG/M |
3300018063|Ga0184637_10146753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1455 | Open in IMG/M |
3300018063|Ga0184637_10255204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1068 | Open in IMG/M |
3300018064|Ga0187773_10526201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 710 | Open in IMG/M |
3300018077|Ga0184633_10086551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1615 | Open in IMG/M |
3300018077|Ga0184633_10107824 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1439 | Open in IMG/M |
3300018078|Ga0184612_10410923 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300018082|Ga0184639_10139012 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300018083|Ga0184628_10009549 | All Organisms → cellular organisms → Bacteria | 4685 | Open in IMG/M |
3300018083|Ga0184628_10025835 | All Organisms → cellular organisms → Bacteria | 2914 | Open in IMG/M |
3300018083|Ga0184628_10547261 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 592 | Open in IMG/M |
3300018433|Ga0066667_10232595 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1382 | Open in IMG/M |
3300018433|Ga0066667_11184652 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300018482|Ga0066669_10931149 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300018920|Ga0190273_10615183 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 823 | Open in IMG/M |
3300019238|Ga0180112_1025541 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300019265|Ga0187792_1207188 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300019458|Ga0187892_10004738 | All Organisms → cellular organisms → Bacteria | 22390 | Open in IMG/M |
3300019458|Ga0187892_10161762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1239 | Open in IMG/M |
3300019487|Ga0187893_10312495 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1112 | Open in IMG/M |
3300019487|Ga0187893_10880391 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 536 | Open in IMG/M |
3300019880|Ga0193712_1060938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 824 | Open in IMG/M |
3300019880|Ga0193712_1071877 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300019880|Ga0193712_1117674 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300019998|Ga0193710_1026880 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 586 | Open in IMG/M |
3300020004|Ga0193755_1039388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1554 | Open in IMG/M |
3300020057|Ga0163151_10258310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 972 | Open in IMG/M |
3300021081|Ga0210379_10015308 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
3300021082|Ga0210380_10563668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 522 | Open in IMG/M |
3300021329|Ga0210362_1220917 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 641 | Open in IMG/M |
3300021344|Ga0193719_10348554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 616 | Open in IMG/M |
3300021445|Ga0182009_10514312 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 632 | Open in IMG/M |
3300024245|Ga0247677_1026363 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300024254|Ga0247661_1050727 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300024275|Ga0247674_1022783 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300024323|Ga0247666_1043333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 920 | Open in IMG/M |
3300025324|Ga0209640_10727640 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300025535|Ga0207423_1023071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporomusa | 1032 | Open in IMG/M |
3300025910|Ga0207684_10209157 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300025910|Ga0207684_11381634 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300025917|Ga0207660_11485273 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300025918|Ga0207662_10851150 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300025922|Ga0207646_10386360 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300025922|Ga0207646_10872887 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300025925|Ga0207650_10048360 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
3300025935|Ga0207709_10861588 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300025936|Ga0207670_10000021 | All Organisms → cellular organisms → Bacteria | 155646 | Open in IMG/M |
3300025941|Ga0207711_10067670 | All Organisms → cellular organisms → Bacteria | 3092 | Open in IMG/M |
3300026041|Ga0207639_11283042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 687 | Open in IMG/M |
3300026319|Ga0209647_1152691 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300026536|Ga0209058_1124015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1269 | Open in IMG/M |
3300026537|Ga0209157_1104217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1341 | Open in IMG/M |
3300027513|Ga0208685_1023425 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300027765|Ga0209073_10505332 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300027821|Ga0209811_10123067 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300027821|Ga0209811_10402564 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 531 | Open in IMG/M |
3300027840|Ga0209683_10168389 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300027840|Ga0209683_10259982 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300027874|Ga0209465_10012041 | All Organisms → cellular organisms → Bacteria | 3860 | Open in IMG/M |
3300027874|Ga0209465_10040317 | All Organisms → cellular organisms → Bacteria | 2220 | Open in IMG/M |
3300027880|Ga0209481_10005599 | All Organisms → cellular organisms → Bacteria | 5317 | Open in IMG/M |
3300027887|Ga0208980_10869573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 501 | Open in IMG/M |
3300027896|Ga0209777_10064765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 3234 | Open in IMG/M |
3300027900|Ga0209253_10679482 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300027902|Ga0209048_10201403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1448 | Open in IMG/M |
3300027907|Ga0207428_10066892 | All Organisms → cellular organisms → Bacteria | 2830 | Open in IMG/M |
3300027907|Ga0207428_10194636 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300027909|Ga0209382_10904396 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300027911|Ga0209698_10109836 | All Organisms → cellular organisms → Bacteria | 2299 | Open in IMG/M |
3300028381|Ga0268264_10843837 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300028381|Ga0268264_12483694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 524 | Open in IMG/M |
3300028587|Ga0247828_10263478 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300028647|Ga0272412_1422761 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300028666|Ga0265336_10065331 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300031170|Ga0307498_10057125 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300031170|Ga0307498_10169315 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10209692 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 546 | Open in IMG/M |
3300031199|Ga0307495_10136973 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031232|Ga0302323_102621512 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 576 | Open in IMG/M |
3300031543|Ga0318516_10012686 | All Organisms → cellular organisms → Bacteria | 4120 | Open in IMG/M |
3300031543|Ga0318516_10070334 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
3300031543|Ga0318516_10337060 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300031544|Ga0318534_10655767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 594 | Open in IMG/M |
3300031576|Ga0247727_10027235 | All Organisms → cellular organisms → Bacteria | 8144 | Open in IMG/M |
3300031576|Ga0247727_10846554 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031576|Ga0247727_11044874 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 559 | Open in IMG/M |
3300031707|Ga0315291_10140611 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
3300031707|Ga0315291_10468510 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300031716|Ga0310813_10315520 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
3300031716|Ga0310813_11923055 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 557 | Open in IMG/M |
3300031720|Ga0307469_10188918 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
3300031720|Ga0307469_10452235 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300031720|Ga0307469_11403949 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300031723|Ga0318493_10183285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1099 | Open in IMG/M |
3300031740|Ga0307468_100796277 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300031740|Ga0307468_101818121 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300031792|Ga0318529_10289030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 763 | Open in IMG/M |
3300031834|Ga0315290_10018695 | All Organisms → cellular organisms → Bacteria | 5345 | Open in IMG/M |
3300031834|Ga0315290_10177767 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
3300031847|Ga0310907_10034626 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
3300031854|Ga0310904_10767724 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 672 | Open in IMG/M |
3300031902|Ga0302322_102084448 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300031918|Ga0311367_11491614 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300031952|Ga0315294_10028626 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix | 6020 | Open in IMG/M |
3300032009|Ga0318563_10200971 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300032012|Ga0310902_10878381 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 616 | Open in IMG/M |
3300032091|Ga0318577_10427254 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 633 | Open in IMG/M |
3300032118|Ga0315277_10015702 | All Organisms → cellular organisms → Bacteria | 9377 | Open in IMG/M |
3300032157|Ga0315912_10002028 | All Organisms → cellular organisms → Bacteria | 22654 | Open in IMG/M |
3300032163|Ga0315281_11174000 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300032173|Ga0315268_10129384 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
3300032173|Ga0315268_10552354 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1140 | Open in IMG/M |
3300032173|Ga0315268_10622803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1072 | Open in IMG/M |
3300032177|Ga0315276_12265332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 548 | Open in IMG/M |
3300032180|Ga0307471_100871141 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300032180|Ga0307471_103549902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 552 | Open in IMG/M |
3300032180|Ga0307471_104096097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 515 | Open in IMG/M |
3300032342|Ga0315286_10034866 | All Organisms → cellular organisms → Bacteria | 5258 | Open in IMG/M |
3300032397|Ga0315287_11193319 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 876 | Open in IMG/M |
3300032516|Ga0315273_11409407 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix | 863 | Open in IMG/M |
3300032770|Ga0335085_10023819 | All Organisms → cellular organisms → Bacteria | 8655 | Open in IMG/M |
3300032770|Ga0335085_10029357 | All Organisms → cellular organisms → Bacteria | 7687 | Open in IMG/M |
3300032770|Ga0335085_10812353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1028 | Open in IMG/M |
3300032770|Ga0335085_11339249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 753 | Open in IMG/M |
3300032828|Ga0335080_10438470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 1396 | Open in IMG/M |
3300032828|Ga0335080_10840219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae | 946 | Open in IMG/M |
3300032829|Ga0335070_10461228 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1208 | Open in IMG/M |
3300032829|Ga0335070_11675757 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 577 | Open in IMG/M |
3300032892|Ga0335081_11436004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporomusa | 768 | Open in IMG/M |
3300032893|Ga0335069_10969719 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300032897|Ga0335071_10020299 | All Organisms → cellular organisms → Bacteria | 6684 | Open in IMG/M |
3300032955|Ga0335076_10161614 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
3300033004|Ga0335084_10815911 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300033004|Ga0335084_11720106 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300033158|Ga0335077_11684779 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300033233|Ga0334722_10337162 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300033233|Ga0334722_10812885 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300033233|Ga0334722_11308752 | Not Available | 506 | Open in IMG/M |
3300033412|Ga0310810_10002194 | All Organisms → cellular organisms → Bacteria | 20807 | Open in IMG/M |
3300033432|Ga0326729_1025783 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300033433|Ga0326726_10427996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1259 | Open in IMG/M |
3300033433|Ga0326726_11864184 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300033482|Ga0316627_101337699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 716 | Open in IMG/M |
3300033486|Ga0316624_10026850 | All Organisms → cellular organisms → Bacteria | 3360 | Open in IMG/M |
3300033513|Ga0316628_104292833 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria | 506 | Open in IMG/M |
3300033814|Ga0364930_0161512 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300034099|Ga0373902_073777 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 744 | Open in IMG/M |
3300034147|Ga0364925_0255242 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 652 | Open in IMG/M |
3300034155|Ga0370498_032083 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300034669|Ga0314794_095192 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300034818|Ga0373950_0166605 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 512 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.20% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.90% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.34% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.04% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.97% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.37% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.37% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.78% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.78% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.19% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.89% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.89% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.59% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.59% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.59% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.59% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.59% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.59% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.59% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.59% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.59% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.59% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.59% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.30% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.30% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.30% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.30% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.30% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.30% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.30% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.30% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.30% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.30% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.30% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.30% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.30% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.30% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.30% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.30% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.30% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.30% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.30% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.30% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.30% |
Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.30% |
Benzene-Degrading Bioreactor | Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor | 0.30% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2061766000 | Benzene-degrading bioreactor microbial communities from Toronto, Ontario, Canada, that are methanogenic - September 2009 gDNA_4 | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010357 | AD_USSTca | Engineered | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034099 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3 | Engineered | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BDMC2_00187400 | 2061766000 | Benzene-Degrading Bioreactor | EGGLDGNIVVLGVALLVWGLLFLYLLRLERRIRELEKR |
INPhiseqgaiiFebDRAFT_1054957612 | 3300000364 | Soil | MRGDLVVMAVALLVWGLLFWYLVRLERRVAELEKK* |
JGI10216J12902_1028749432 | 3300000956 | Soil | MDVSGGNLVVLGVALLVWGLLFAWLVRLDRRVRDLEKR* |
JGI10216J12902_1050011943 | 3300000956 | Soil | LNSKDLTVLLVALVVWGLLFGYLLRLERRVRDLERK* |
JGIcombinedJ13530_1052983102 | 3300001213 | Wetland | MNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR* |
RCM34_10006215 | 3300001843 | Marine Plankton | MDHNWVVLGVSLLVWTLLFVWIVRVERRVADLERSGGTGKESR* |
Ga0073909_1000033812 | 3300005526 | Surface Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRVRDVEKR* |
Ga0073909_100713752 | 3300005526 | Surface Soil | VTGNAVVLGVSLLVWGLVFFYLIRLERRVKELERK* |
Ga0073909_103575582 | 3300005526 | Surface Soil | MRGNGVVLGVALFVWGLLFIYLVRLERRIRDLEKQ* |
Ga0073909_103747143 | 3300005526 | Surface Soil | MDRNWVVLGVSLMLWGLLFVWILRVERRIRDVEKR* |
Ga0066692_104351193 | 3300005555 | Soil | MSGTWTVLGVALVAWGLLFVYLVRLERRIKELERR* |
Ga0066698_100238573 | 3300005558 | Soil | VSGNLVVLGVALLAWLLLFFYLMRLERRIKELEKR* |
Ga0066694_103809432 | 3300005574 | Soil | MDRNWVVLGVALLVWGLLFTWILRVERRLNEMEKR* |
Ga0068859_1026721162 | 3300005617 | Switchgrass Rhizosphere | MDRNWVVLGVSLMLWGLLFIWILRVERRVRDVEKR* |
Ga0068864_1001933294 | 3300005618 | Switchgrass Rhizosphere | VNANFVVAGVALLVWGMVFFYLARLERRVRELEKR* |
Ga0068864_1007064533 | 3300005618 | Switchgrass Rhizosphere | VNPNWVVLGVALLVWGLVFVYLTRLERRIRELEKK* |
Ga0066905_1003028733 | 3300005713 | Tropical Forest Soil | MKGDLVVMAVALLVWGLLFWYLIRLERRVADLEKR* |
Ga0066905_1003923932 | 3300005713 | Tropical Forest Soil | MNGNWVVLGVSLLVWGMLFAWILRVERRLDEMEKK* |
Ga0066905_1011494621 | 3300005713 | Tropical Forest Soil | QGPDMDRNWVVLGVSLMLWGLLFFWILRVERRVRDMEKQ* |
Ga0068861_1002729062 | 3300005719 | Switchgrass Rhizosphere | MDRNWVVLAVSLMLWGLLFFWILRVERRVRDVEKR* |
Ga0068861_1011981613 | 3300005719 | Switchgrass Rhizosphere | MRGDLVVMAVALLVWGLLFWYLVRLERRVADLEKR* |
Ga0066903_1000851103 | 3300005764 | Tropical Forest Soil | MDRNWVVLGVSLLVWGLLFFWILRVERRVSEVEKR* |
Ga0066903_1003327243 | 3300005764 | Tropical Forest Soil | MKGDLVVMAVALLVWGLLFWYLIRLERRVAELEKK* |
Ga0066903_1015877213 | 3300005764 | Tropical Forest Soil | VTGNAVVLGVSLLVWGLVFFYLIRLERRIKELERK* |
Ga0066903_1017758442 | 3300005764 | Tropical Forest Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRIRDVEKR* |
Ga0066903_1033886741 | 3300005764 | Tropical Forest Soil | MKGDLVVMAVALLVWGLLFWYLIRLERRVADLEKK* |
Ga0066903_1048113911 | 3300005764 | Tropical Forest Soil | RDPLDPKDLTVLGVALLVWGLLFFYVMRLERRVRDLERR* |
Ga0066903_1062620991 | 3300005764 | Tropical Forest Soil | GPDMDRNWVVLGVSLLVWGLLFFWILRVERMVRDVEKR* |
Ga0074479_110348262 | 3300005829 | Sediment (Intertidal) | MSGGNVVMGVSLLTWGLLFYYLIRIERRVKELEKK* |
Ga0074471_102382741 | 3300005831 | Sediment (Intertidal) | MDRNWVVLGVSLLVWGLLFGWILRVERRLNDMEKR* |
Ga0074471_109904963 | 3300005831 | Sediment (Intertidal) | MDRNWVVLGVSLLVWGLLFVWILRVERRLNDMEKR* |
Ga0074472_105035342 | 3300005833 | Sediment (Intertidal) | VIEGLAMDRNWVVLGVSLLVWGLLFAWILRVEKRLNDMEKR* |
Ga0074472_113421482 | 3300005833 | Sediment (Intertidal) | VNGNWVVMGVALLVWGLLFLYLVRIEKRIRDLEKP* |
Ga0074470_109477153 | 3300005836 | Sediment (Intertidal) | VTGNNVVLGVALLVWGLLFFYLVRLESRIKKLEK* |
Ga0068860_1003970802 | 3300005843 | Switchgrass Rhizosphere | MDRNWVVLGVSLMLWGLLFFWILRVERRVREVEKR* |
Ga0066656_109697462 | 3300006034 | Soil | VNGNLVVLGVALLGWLLLFFYLVRLERRIKELEKR* |
Ga0066652_1007947572 | 3300006046 | Soil | LNSKDLTVLFVALVVWGLLFGYLVRLERRVRDLERK* |
Ga0075029_1005004132 | 3300006052 | Watersheds | MDRNWVVLGVSLLVWGLLFSWILRVEKRVNELEKK* |
Ga0075026_1004082721 | 3300006057 | Watersheds | MDRNWVVLGVSLLVWGLLFSWLLRVEKRVRELEKR* |
Ga0074050_118367912 | 3300006577 | Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRVRVPPEG* |
Ga0066665_110386102 | 3300006796 | Soil | MVLDANWVVLGVAMLAWGLLFYYLVRLDRRIKELEKQ* |
Ga0066659_104052802 | 3300006797 | Soil | LNGNGVVLSVALLTWGLLFVYLVRIERRIRKLEKQ* |
Ga0079221_106786632 | 3300006804 | Agricultural Soil | MNANLVVLLVALLTWGLLFTYLVRLEKRIRDLEKS* |
Ga0075428_1001151893 | 3300006844 | Populus Rhizosphere | MTGNNVVLAVALLVWGLLFYYLLRLEGRIRKLEK* |
Ga0075428_1012018963 | 3300006844 | Populus Rhizosphere | MSGGNVVMGVALLTWGLLFYYLVRIERRVKELEKK* |
Ga0075430_1002323693 | 3300006846 | Populus Rhizosphere | MDRNWVVLGVSLLVWGLLFAWILRVEKRLNELERR* |
Ga0075430_1009333971 | 3300006846 | Populus Rhizosphere | VTGNNVVLAVALLVWGLLFYYLLRLEGRIRKLEK* |
Ga0075431_1006512052 | 3300006847 | Populus Rhizosphere | MDRNWVVLGVSLLVWGLLFAWILRVERRLDEMEKR* |
Ga0075431_1011359593 | 3300006847 | Populus Rhizosphere | MDRNWVVLGVSLLVWGLLFLWILRLERRVRDVEKR* |
Ga0075431_1014990262 | 3300006847 | Populus Rhizosphere | MNGNLVVLGVALLAWGLLFFYLARLERRIKELEKR* |
Ga0075433_100171487 | 3300006852 | Populus Rhizosphere | VNGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKP* |
Ga0075433_100845532 | 3300006852 | Populus Rhizosphere | VTGNVVVLGVALLTWALLFAYLLRLERRVKDLERR* |
Ga0075433_101722994 | 3300006852 | Populus Rhizosphere | MDRNWVVLGVSLLVWGLLFLWILRLERRVREVEKR* |
Ga0075433_115860732 | 3300006852 | Populus Rhizosphere | MDRNWVVLGVSLLVWGLLFTWILRLERRVREVERR* |
Ga0075425_1001585923 | 3300006854 | Populus Rhizosphere | VNGNLVVLAVALLVWGLLFVYLMRIERRVRDLERK* |
Ga0075425_1005059882 | 3300006854 | Populus Rhizosphere | VNGNAVVMGVALLVWGLLFFYLMRLEARINKLEK* |
Ga0075425_1006210992 | 3300006854 | Populus Rhizosphere | MDRNWVVLGVSLLVWGLLFFWILRVERRVREVEKR* |
Ga0075425_1008858632 | 3300006854 | Populus Rhizosphere | VRGEGGVSGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKS* |
Ga0075425_1012851712 | 3300006854 | Populus Rhizosphere | VNGNAVVLGVALLVWGLVFFYLLRLEGRISKLEK* |
Ga0075434_1003291932 | 3300006871 | Populus Rhizosphere | LSGTVAVLMVAILTWGLLFFYLMRLERRIKDLEKR* |
Ga0075434_1012364162 | 3300006871 | Populus Rhizosphere | VNPNWVVLGVALLVWGLVFVYLSWLERRIRELEKR* |
Ga0075426_104439962 | 3300006903 | Populus Rhizosphere | MNLNWVVAGVALLTWGLVFLYLTRLERRIRELEKR* |
Ga0075436_1003495853 | 3300006914 | Populus Rhizosphere | WERCMNLNWVVAGVALLTWGLVFLYLTRLERRIRELEKR* |
Ga0075436_1015634712 | 3300006914 | Populus Rhizosphere | MNANLTVLAVALVAWGLLFFYLVRLERRIKELERR* |
Ga0079218_123057472 | 3300007004 | Agricultural Soil | MNGEMTVLIVALLGWGLLFWYLIRLERRVRDLERK* |
Ga0105105_107499721 | 3300009009 | Freshwater Sediment | VWTLNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR* |
Ga0066710_1003921543 | 3300009012 | Grasslands Soil | MNGNLTVLGVALLAWGLIFVYLWRLERRIKELERK |
Ga0066710_1004023744 | 3300009012 | Grasslands Soil | MNANVTVLGVSLLVWGLVFVYLWRLERRVKELERK |
Ga0066710_1007868273 | 3300009012 | Grasslands Soil | MNLNWVVAGVALLTWGLVFIYLTRLERRIRELEKR |
Ga0066710_1009373112 | 3300009012 | Grasslands Soil | VNGNLVVLGVTLLAWVLLFFYLVRLERRIKELEKR |
Ga0066710_1011827452 | 3300009012 | Grasslands Soil | MSGTWTVLGVALVAWGLLFVYLVRLERRIKELERR |
Ga0066710_1012400952 | 3300009012 | Grasslands Soil | MDRNWVVLGVALLVWGLLFVWILRVERRLNEMEKR |
Ga0066710_1012536923 | 3300009012 | Grasslands Soil | VSGNLVVLGVALLVWGLLFFYLARLERRIKELEKR |
Ga0066710_1045882211 | 3300009012 | Grasslands Soil | TGTGEPGMNGNQVVCGVALLVWGLVFFYLTRLERRIRELEKR |
Ga0105103_100202363 | 3300009085 | Freshwater Sediment | VNGNLVVLGVALLAWGLLFLYLLRLERRIRDLEKR* |
Ga0111539_102420524 | 3300009094 | Populus Rhizosphere | MDRNWVVLAVSVMLWGLLFLWILRVERRVRDVEKR* |
Ga0111539_106176112 | 3300009094 | Populus Rhizosphere | LNAKDVTVLFVALVVWGLLFGYLLRLERRVRDLERK* |
Ga0111539_109663452 | 3300009094 | Populus Rhizosphere | MDRNWVVLGVSLLVWGLLFVWILRVEKRLNDMERR* |
Ga0105245_130623391 | 3300009098 | Miscanthus Rhizosphere | MIGNAVVLGVALLVWGLVFFYLVRLERRIKELGL* |
Ga0066709_1000356162 | 3300009137 | Grasslands Soil | VSGNLVVMGVSLLTWAATFFYLLRLERRIKELEKP* |
Ga0066709_1008330313 | 3300009137 | Grasslands Soil | MNGNLTVLGVALLAWGLIFVYLWRLERRIKELERK* |
Ga0066709_1019790401 | 3300009137 | Grasslands Soil | VNGNLVVLGVALLVWGLLFLYLLRLERRIADLEKR* |
Ga0066709_1036044961 | 3300009137 | Grasslands Soil | VNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKR* |
Ga0105243_115853592 | 3300009148 | Miscanthus Rhizosphere | LNGNLVVLGVALLAWGLLFFYLARLERRIKDLEKQ* |
Ga0111538_106777953 | 3300009156 | Populus Rhizosphere | MDRNWVVLGVSLMLWGLLFFWILRVERRVQEMEKR* |
Ga0111538_138806412 | 3300009156 | Populus Rhizosphere | VRADWVVLGVTLLVWGMLFAYLIRLERRVKDLEKR* |
Ga0075423_101272995 | 3300009162 | Populus Rhizosphere | VTGNAVVLGVALLTWALLFVYLLRLERRVKDLERR* |
Ga0105104_103512051 | 3300009168 | Freshwater Sediment | RGVWTVNGNLVVLGVALLVWGLLFLYLLRLERRIRDLERR* |
Ga0105242_112411592 | 3300009176 | Miscanthus Rhizosphere | MYRNWVVLAVSLMLWGLLFFWILRVERRVRDVEKR* |
Ga0105248_101904364 | 3300009177 | Switchgrass Rhizosphere | VNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKK* |
Ga0103857_100107842 | 3300009235 | River Water | MDHNWVVLGVSLLVWTLLFIWIVRVERRVAELERSGGTGKESR* |
Ga0118657_107627012 | 3300009506 | Mangrove Sediment | MSGSMTVLLVALLTWVLLFFYLVRLDRRIKDLEKR* |
Ga0123573_102684413 | 3300009509 | Mangrove Sediment | MSGSMTVLLVALFTWVLLFFYLVRLDRRIKDLEKR* |
Ga0105249_105890802 | 3300009553 | Switchgrass Rhizosphere | VSGNVVVMGVSLLTWAATFFYLLRLERRIKELEKS* |
Ga0105249_129594672 | 3300009553 | Switchgrass Rhizosphere | MSGNLVVMAVALLVWGLLFWYLIRLERRVADLEKR* |
Ga0105347_10013169 | 3300009609 | Soil | MGGNGTVLGVALITWGALFVYLLRLERRIKELERQ* |
Ga0105081_10319603 | 3300009806 | Groundwater Sand | VGANGTVLGVALLTWGALFFYLLRMERRIKELERK* |
Ga0130016_100067713 | 3300009868 | Wastewater | MDRNFVVLGVSLLVWGLLFVWLLRVEKRVRELEKR* |
Ga0131092_101186173 | 3300009870 | Activated Sludge | MSGNLVVLGVSLLVWGMLFFYILRVERRLKELERP* |
Ga0131077_1000209842 | 3300009873 | Wastewater | VTGNNVVLGVALLIWGLLFVYLMRLEGRIRKLEK* |
Ga0131077_104788602 | 3300009873 | Wastewater | MDRNFVVLGVSLLVWGLLFFWLLRVEKRVRELEKR* |
Ga0131077_107444753 | 3300009873 | Wastewater | LTGNNVVLGVALLVWGLLFVYLVRLEGRIRKLEK* |
Ga0131077_112958322 | 3300009873 | Wastewater | LNANWVVLGVSLLTWGLLFLYLLRLERRIKELEKR* |
Ga0131077_115055252 | 3300009873 | Wastewater | VTGNNVVLGVALLVWGLLFVYLMRLEGRIRKLEK* |
Ga0126384_108072082 | 3300010046 | Tropical Forest Soil | VTGNAVVLGVALLVWGLVFFYLIRLDRRIKELERK* |
Ga0126384_110021392 | 3300010046 | Tropical Forest Soil | MSKEYVVLGVALLVWGLLFLYLWRIDKRLKDMERK* |
Ga0134088_107255382 | 3300010304 | Grasslands Soil | MNGNLTVLGVALLAWGLIFIYQWRLERRIKELERK* |
Ga0116249_110808712 | 3300010357 | Anaerobic Digestor Sludge | MNSHDMTVLGVALLVWGLLFFWLIRVERRVKDLEKR* |
Ga0116249_117665452 | 3300010357 | Anaerobic Digestor Sludge | MDRNWVVLGVSLLVWGLLFFWLLQVEKRVKELEKS* |
Ga0126370_113021853 | 3300010358 | Tropical Forest Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRIQEVEKR* |
Ga0126376_123961832 | 3300010359 | Tropical Forest Soil | VTGNAVVLGVSLLVWGLVFFYLMRLERRIKELERK* |
Ga0126378_107495563 | 3300010361 | Tropical Forest Soil | MDRNWVVLGVSLMLWGLLFFWILRLERRIRDVEKR* |
Ga0126377_107680303 | 3300010362 | Tropical Forest Soil | MSGDLVVMAVALLVWGLLFWYLVRLDRRVSELEKK* |
Ga0126377_128185402 | 3300010362 | Tropical Forest Soil | MDRNWVVLGVSLMLWGLLFYWILRVERRVQDMEKR* |
Ga0136847_109155407 | 3300010391 | Freshwater Sediment | MNANLTVLGVSLLVWGLIFVYLWRLERRVKELERK* |
Ga0134124_101367543 | 3300010397 | Terrestrial Soil | VKGDLVVMAVALLVWGLLFWYLIRLERRVADLEKR* |
Ga0126383_100196634 | 3300010398 | Tropical Forest Soil | LNGNWVVMGVALLVWGLIFVYLLRLERRIRDLEDR* |
Ga0126383_103596763 | 3300010398 | Tropical Forest Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRVRDMEKR* |
Ga0126383_112227612 | 3300010398 | Tropical Forest Soil | VSGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKP* |
Ga0126383_118893182 | 3300010398 | Tropical Forest Soil | MDRNWVVLGVSLLVWGLLFFWILRVERRVRDVEKR* |
Ga0134127_115907602 | 3300010399 | Terrestrial Soil | VNGDVVVLGVALLAWGLVFVWLLRLERRIRDLEKR* |
Ga0134127_116175792 | 3300010399 | Terrestrial Soil | MDRNWVVLAVSVMLWGLLFVWILRVERRVRDVEKR* |
Ga0134123_103492323 | 3300010403 | Terrestrial Soil | MDRNWVVLGVSLMLWGLLFVWILRVERRVRDVEKR* |
Ga0134123_130262421 | 3300010403 | Terrestrial Soil | LNSKDLTVLFVALVVWGVLFVYLLRLERRVRDLERK* |
Ga0134123_136487232 | 3300010403 | Terrestrial Soil | MRGNVVVLGVALLVWGLLFFYLWRIERRIREIEKE* |
Ga0137436_10925892 | 3300011423 | Soil | LNSKDLTVLFVALVVWGLLFGYLLRLERRVRDLERK* |
Ga0137455_11944172 | 3300011429 | Soil | VNGNLVVLAVSLLTWAVTFFYLLRLERRIKDLEKS* |
Ga0137451_10238501 | 3300011438 | Soil | GTIVSGNLVVMGVSLLTWAATFFYLLRLERRIKELEKS* |
Ga0137432_12357541 | 3300011439 | Soil | MSGNAVVMGVALLVWALLFFYIVRVERRIRELEKR* |
Ga0137433_12620111 | 3300011440 | Soil | TVTGNTVVLVVALLVWGMLFLYLVRLERRIRELERK* |
Ga0137364_104214162 | 3300012198 | Vadose Zone Soil | VIGNAVVLGVSLLVWGLVFFYLLRLERRIKELERK* |
Ga0137365_104932222 | 3300012201 | Vadose Zone Soil | VNANVTVLGVSLLVWGLVFVYLWRLERRVKELERK* |
Ga0137365_105493582 | 3300012201 | Vadose Zone Soil | MDRNWVVLGVALLVWGLLFFWILRVERRLNEMEKR* |
Ga0137365_105880422 | 3300012201 | Vadose Zone Soil | MNGNLTVLGVSLLVWGLLFVYLWRLERRLRDLERR* |
Ga0137399_112068432 | 3300012203 | Vadose Zone Soil | VNRNWIVLGVALLVWGLVFFYLTRLERRIRELEKR* |
Ga0137374_102279312 | 3300012204 | Vadose Zone Soil | MKGNLTVLGVALVAWGLIFVYLWRLERRIKELERK* |
Ga0137379_114779102 | 3300012209 | Vadose Zone Soil | MNPNWVVLGVALLVWGLVFLYLTRLERRIRELEKR* |
Ga0137378_106708973 | 3300012210 | Vadose Zone Soil | VKGSLVVLGVSLLLWGVVFFYMLRLERRIRDLEKS* |
Ga0150985_1132767381 | 3300012212 | Avena Fatua Rhizosphere | RSVNGNAVVLGVALLVWGLVFFYLLRLEGRISKLEK* |
Ga0150985_1230065591 | 3300012212 | Avena Fatua Rhizosphere | MDANWVVLGVALLAWGLLFAYLARLERRIKELERR* |
Ga0137387_104381082 | 3300012349 | Vadose Zone Soil | MNGNLTVLGVALLAWGLVFVYLWRLERRIKELERK* |
Ga0137387_109334562 | 3300012349 | Vadose Zone Soil | MNGNLTVLGVSLLVWGLLFFYLWRLERRLRDLERR* |
Ga0137372_106945931 | 3300012350 | Vadose Zone Soil | MKGNLTVLGVALVAWGLIFVYLWRLERRVKELERK* |
Ga0137386_108020553 | 3300012351 | Vadose Zone Soil | LKGSLVVLGVSLLLWGGLFFYLLRIERRIRDLEKS* |
Ga0137369_104256652 | 3300012355 | Vadose Zone Soil | MDRNWVVLGVSLLVWGLLFLWILRLERRVRDVERR* |
Ga0137371_113016932 | 3300012356 | Vadose Zone Soil | VSGNLVVLGVALLTWLLLFFYLMRLERRIKELEKR* |
Ga0137368_107765911 | 3300012358 | Vadose Zone Soil | MNGNLTVLGVALVAWGLIFVYLWRLERRIKELERK* |
Ga0157216_100997662 | 3300012668 | Glacier Forefield Soil | MELDANRVVLGVALLAWGLLFFYLVRLEKRIKDLEKR* |
Ga0137398_108551852 | 3300012683 | Vadose Zone Soil | MDRNWVVLGVSLLVWGLLFGWLLRVEKRVRELEKR* |
Ga0137397_101858733 | 3300012685 | Vadose Zone Soil | MGNTVVLGVSLLVWGLLFFYLIRLERRIQSLERK* |
Ga0137397_107013672 | 3300012685 | Vadose Zone Soil | MGLNGNLVVLGVALLVWGLLFVYLVRLEKRIRELEKR* |
Ga0137397_108056382 | 3300012685 | Vadose Zone Soil | VNADWVVLGVALLTWALVFGWLLRLERRIRDLEKR* |
Ga0157289_100325902 | 3300012903 | Soil | MDRNYVVLGVSLLVWGLLFAWIVRVERRVRELEKRG* |
Ga0137394_101265603 | 3300012922 | Vadose Zone Soil | MNGNVTVLAVSLLVWGLVFVYLWRLERRVKELERK* |
Ga0137394_103124213 | 3300012922 | Vadose Zone Soil | MNANMTVLGVSLLVWGLIFIYLWRLERRVKELERK* |
Ga0137394_115608592 | 3300012922 | Vadose Zone Soil | MSGNLVVLAVALLVWGLLFFYLLRLERRIKELEKR* |
Ga0137394_116137972 | 3300012922 | Vadose Zone Soil | MDRNWVVLGGSLLVWGLLFTWILRLERRVREVERR* |
Ga0137413_113226552 | 3300012924 | Vadose Zone Soil | MSANLTVLAVALLVWGLLFVYVWRLERRIKELERK* |
Ga0153915_134680892 | 3300012931 | Freshwater Wetlands | MLNGNVVVLGVALLVWGLLFLYLLRLERRIRDLERR* |
Ga0137410_103853752 | 3300012944 | Vadose Zone Soil | MSANLTVMAVALLVWGLVFVYLWRLERRIKELERK* |
Ga0137410_121305001 | 3300012944 | Vadose Zone Soil | PQGLAMDRNWVVLGVALLVWGLLFVWILRVERRLNEMEKR* |
Ga0126375_100315842 | 3300012948 | Tropical Forest Soil | VSGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKS* |
Ga0126375_102104973 | 3300012948 | Tropical Forest Soil | MKGDLVVMSVALLVWGLLFWYLIRLERRVAELEKR* |
Ga0154020_100757653 | 3300012956 | Active Sludge | MDRNWVVLGVSLLVWGLLFFWLLSVEKRVKELEKS* |
Ga0126369_106456902 | 3300012971 | Tropical Forest Soil | MDRNWVVLGVSLLVWGLLFFWILRVERMVREVEKR* |
Ga0126369_118031163 | 3300012971 | Tropical Forest Soil | MNANLTVLGVSLLVWGLLFIYVWRLERRVKELERK* |
Ga0157375_136420372 | 3300013308 | Miscanthus Rhizosphere | VNGNVVVAGVALLVWGMVFFYLARLERRVRELEKR* |
Ga0075351_10379802 | 3300014318 | Natural And Restored Wetlands | VSGNLVVLGVSLLAWAATFFYLLRLERRVKELEKS* |
Ga0075356_11931262 | 3300014323 | Natural And Restored Wetlands | VWTVNGNLVVLGVALLVWGLLFLYLLRLDRRVRDLEKR* |
Ga0157380_112833142 | 3300014326 | Switchgrass Rhizosphere | MDANWVVLGVALLAWGLLFGYLTRLERRIKELERR* |
Ga0182021_109084383 | 3300014502 | Fen | VWTLNGNLVVLGVALLAWGLLFLYLLRLERRIRDLEKR* |
Ga0137420_13839234 | 3300015054 | Vadose Zone Soil | MSANMTVLGVSLLVWGLIFIYLWRLERRVKELERK* |
Ga0137418_108704142 | 3300015241 | Vadose Zone Soil | MDRNWVVLGVALLVWGLLFVWILRVERRLNEMEKR* |
Ga0137409_108206212 | 3300015245 | Vadose Zone Soil | VNGDWVVLGVALLTWALVFGWLLRLERRIRDLEKR* |
Ga0180077_10868072 | 3300015255 | Soil | LSGNTVVLGVALLVWGMLFFYLVRLERRIRELERK* |
Ga0180077_10934072 | 3300015255 | Soil | MDRNWVVLSVSLLVWGLLFAWILRVEKRLNELERR* |
Ga0137403_112018232 | 3300015264 | Vadose Zone Soil | MNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKR* |
Ga0132258_109820074 | 3300015371 | Arabidopsis Rhizosphere | MDRNWVVLGVSLMLWGLLFFWILRVERRIREVEKR* |
Ga0132258_110726912 | 3300015371 | Arabidopsis Rhizosphere | MTQGDWVVAGVALIVWGLVFFYLTRLDRRIKELEKR* |
Ga0132258_117874693 | 3300015371 | Arabidopsis Rhizosphere | VNSNWVVLGVSLLVWGLLFVYLVRLERRIRELERR* |
Ga0132258_124751882 | 3300015371 | Arabidopsis Rhizosphere | MRGALVVMAVALLVWGLLFWYLVRLERRVADLEKR* |
Ga0132258_128415551 | 3300015371 | Arabidopsis Rhizosphere | MSGNLAVLGVALLVWGLLFFYLARLERRIKELEKR* |
Ga0132255_1026329213 | 3300015374 | Arabidopsis Rhizosphere | VNGNLVVMGVSLLTWAAMFFYLLRLERRIKDLEKP* |
Ga0187821_102970892 | 3300017936 | Freshwater Sediment | MDRNYVVLFVSLLAWGLLFAWLLRVDRRVRELEKK |
Ga0187776_114213522 | 3300017966 | Tropical Peatland | VNGNWVVMGVALLVWGLLFFYLLRLEKRIRDLEKS |
Ga0184616_101642273 | 3300018055 | Groundwater Sediment | VGGALNSKDLTVLFVALVVWGLLFGYLLRLERRVRDLERK |
Ga0184637_101467533 | 3300018063 | Groundwater Sediment | VNGNLVVLGVSLLTWAATFFYLLRLERRIKELEKS |
Ga0184637_102552042 | 3300018063 | Groundwater Sediment | VSGDLVVMIVAVLVWGLLFGYLWRLERRVADLEKK |
Ga0187773_105262013 | 3300018064 | Tropical Peatland | VNGNLVVMGVSLLTWAAMFFYLVRLERRIKDLEKS |
Ga0184633_100865513 | 3300018077 | Groundwater Sediment | VNGNLVVLGVALLVWGMLFGYLYRLERRIKDLEKR |
Ga0184633_101078243 | 3300018077 | Groundwater Sediment | VPRESQRECRVDRNWIVLGVALLVWGLVFFYLTRLERRIRELEKR |
Ga0184612_104109232 | 3300018078 | Groundwater Sediment | VNPNWVVLGVALLVWGLVFFYLMRLERRIRELEKR |
Ga0184639_101390123 | 3300018082 | Groundwater Sediment | VSGNLVVLGVSLLTWAATFFYLLRLERRIKELEKS |
Ga0184628_100095492 | 3300018083 | Groundwater Sediment | LNSKDLTVLFVALVVWGLLFGYLLRLERRVRDLERK |
Ga0184628_100258355 | 3300018083 | Groundwater Sediment | MNHNYVVLGVSLLVWGLLFAWILRVEARVRELEKR |
Ga0184628_105472612 | 3300018083 | Groundwater Sediment | MDRNWVVLSVSLLVWGLLFVWILRVEKRLNDMERR |
Ga0066667_102325953 | 3300018433 | Grasslands Soil | VSGNLVVLGVALLAWLLLFFYLMRLERRIKELEKR |
Ga0066667_111846522 | 3300018433 | Grasslands Soil | MDRNWVVLGVALLVWGLLFTWILRVERRLNEMEKR |
Ga0066669_109311491 | 3300018482 | Grasslands Soil | MDWNWVVLGVALLVWGLLFTWILRVARRLSEMEQR |
Ga0190273_106151832 | 3300018920 | Soil | VNGNLAVLGVALLLWGAVFFYLMRLERRVKDLEKR |
Ga0180112_10255412 | 3300019238 | Groundwater Sediment | MKGNVVVLLVALLAWGMLFFYLSRLERRIRDLEKR |
Ga0187792_12071882 | 3300019265 | Peatland | MDRNWVVLGVALLAWGLLFVWILRVERRLNEMEKR |
Ga0187892_100047387 | 3300019458 | Bio-Ooze | MDRNWVVLGVSLLVWGLLFAWILRVERRLHDMERR |
Ga0187892_101617623 | 3300019458 | Bio-Ooze | VIGNNVVLIVSLLAWGLLFFYLVRLERRITELERK |
Ga0187893_103124952 | 3300019487 | Microbial Mat On Rocks | MDRNWVVLGVSLLVWGLLFAWILRVERRLNDMERR |
Ga0187893_108803912 | 3300019487 | Microbial Mat On Rocks | MRGDVVVLAVALLAWGLLFFYLTRLERRIRDLEKH |
Ga0193712_10609382 | 3300019880 | Soil | MDRNWVVLGVALLVWGLLFVWILRVERRLKEMEKR |
Ga0193712_10718772 | 3300019880 | Soil | VNQNWVVLGVALLTWGLVFFYLTHLERRIRELEKR |
Ga0193712_11176742 | 3300019880 | Soil | MDRNWVVLGVALLVWGMLFVWIVRVEKRVTDLEKK |
Ga0193710_10268801 | 3300019998 | Soil | YLLSGNQVVLAVALLVWGLLFLYLLRLERRVKDLEKR |
Ga0193755_10393883 | 3300020004 | Soil | MNANVTVLGVSLLVWGLVFIYLWRLERRVKELERK |
Ga0163151_102583102 | 3300020057 | Freshwater Microbial Mat | MNSHDMTVLGVALLVWGLLFFWLIRVERRVKDLEKR |
Ga0210379_100153081 | 3300021081 | Groundwater Sediment | VSGNLVVMGVSLLTWAATFFYLLRLERRIKELEKS |
Ga0210380_105636682 | 3300021082 | Groundwater Sediment | LNSKDLTVLLVALVVWGLLFGYLLRLERRVRDLERK |
Ga0210362_12209172 | 3300021329 | Estuarine | MDRNFVVLGVSLLVWGLLFVWILRVERRLNDMEKR |
Ga0193719_103485542 | 3300021344 | Soil | VNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKR |
Ga0182009_105143123 | 3300021445 | Soil | VSPKGGRLDANWVVMGVALLAWGLLFAYLSRLERRIKELEKQ |
Ga0247677_10263632 | 3300024245 | Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRIRDVEKR |
Ga0247661_10507272 | 3300024254 | Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRVREVEKR |
Ga0247674_10227831 | 3300024275 | Soil | MDRNWVVLGVSLLVWGLLFVWLLRVEKRVRELEKR |
Ga0247666_10433332 | 3300024323 | Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRVRDVEKQ |
Ga0209640_107276401 | 3300025324 | Soil | MSGGNVVMGVALLTWGLLFYYLVRIERRMKELEKR |
Ga0207423_10230712 | 3300025535 | Natural And Restored Wetlands | MGANGVVLGVALLAWGLLFFYLVRLERRIRDLEKS |
Ga0207684_102091572 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRNWVVLAVSLMLWGLLFFWILRVERRVRDVEKR |
Ga0207684_113816342 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGTWTVLSVALVAWGLLFFYLVRLERRIKELERR |
Ga0207660_114852732 | 3300025917 | Corn Rhizosphere | MSGNLVVMAVALLVWGLLFWYLIRLERRVADLEKR |
Ga0207662_108511502 | 3300025918 | Switchgrass Rhizosphere | MRGDLVVMAVALLVWGLLFWYLVRLERRVADLEKR |
Ga0207646_103863603 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRNWVVLGVSLMLWGLLFVWILRVERRVRDVEKR |
Ga0207646_108728871 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTGNVVVLAVSLLVWGLLFFYLIRLERRIKELERR |
Ga0207650_100483602 | 3300025925 | Switchgrass Rhizosphere | VNPNWVVLGVALLVWGLVFVYLTRLERRIRELEKK |
Ga0207709_108615882 | 3300025935 | Miscanthus Rhizosphere | LNGNLVVLGVALLAWGLLFFYLARLERRIKDLEKQ |
Ga0207670_1000002113 | 3300025936 | Switchgrass Rhizosphere | MDRNWVVLGVSLMLWGLLFIWILRVERRVRDVEKR |
Ga0207711_100676703 | 3300025941 | Switchgrass Rhizosphere | VNPNWVVLGVALLVWGLVFFYLTRLERRIRELEKK |
Ga0207639_112830423 | 3300026041 | Corn Rhizosphere | MIGNAVVLGVALLVWGLVFFYLVRLERRIKELERK |
Ga0209647_11526911 | 3300026319 | Grasslands Soil | RSHTTRTDMDRNWVVLGVALLVWGLLFTWILRVERRLKEVEKR |
Ga0209058_11240153 | 3300026536 | Soil | VNGNLVVLGVALLVWGLLFLYLLRLERRIADLEKR |
Ga0209157_11042173 | 3300026537 | Soil | GEPVSGNLVVLGVALLAWLLLFFYLMRLERRIKELEKR |
Ga0208685_10234252 | 3300027513 | Soil | MGGNGTVLGVALITWGALFVYLLRLERRIKELERQ |
Ga0209073_105053322 | 3300027765 | Agricultural Soil | VNGNLVVMGVALLVWGLLFFYLLRIERRVRDLERK |
Ga0209811_101230672 | 3300027821 | Surface Soil | MRGNGVVLGVALFVWGLLFIYLVRLERRIRDLEKQ |
Ga0209811_104025642 | 3300027821 | Surface Soil | VRGEGDVSGNLVVMGVSLLTWAATFFYLLRLERRIKDLEKS |
Ga0209683_101683892 | 3300027840 | Wetland Sediment | MNGNMVVMGVALLTWGLVFFYLLRLDRRIRDLEKR |
Ga0209683_102599822 | 3300027840 | Wetland Sediment | MNGNWVVMGVALLVWGLLFVYILRVERRIKDLEKR |
Ga0209465_100120415 | 3300027874 | Tropical Forest Soil | MKGDLVVMAVALLVWGLLFWYLIRLERRVAELEKK |
Ga0209465_100403172 | 3300027874 | Tropical Forest Soil | MDRNWVVLGVSLLVWGLLFFWILRVERMVREVEKR |
Ga0209481_100055993 | 3300027880 | Populus Rhizosphere | MDRNWVVLGVSLLVWGLLFAWILRVEKRLNELERR |
Ga0208980_108695731 | 3300027887 | Wetland | DTVNGNLVVLGVALLVWGLLFLYLLRLERRVRDLERR |
Ga0209777_100647654 | 3300027896 | Freshwater Lake Sediment | VNGNLVVLGVALLAWGLLFLYLLRLERRIRDLEKR |
Ga0209253_106794822 | 3300027900 | Freshwater Lake Sediment | VWTLNGNLVVLVVALLGWGLLFLYLLRLERRIRDLEKR |
Ga0209048_102014033 | 3300027902 | Freshwater Lake Sediment | VWTLNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR |
Ga0207428_100668923 | 3300027907 | Populus Rhizosphere | LNAKDVTVLFVALVVWGLLFGYLLRLERRVRDLERK |
Ga0207428_101946362 | 3300027907 | Populus Rhizosphere | MDRNWVVLAVSVMLWGLLFLWILRVERRVRDVEKR |
Ga0209382_109043962 | 3300027909 | Populus Rhizosphere | MSGGNVVMGVALLTWGLLFYYLVRIERRVKELEKK |
Ga0209698_101098363 | 3300027911 | Watersheds | MDRNWVVLGVSLLVWGLLFSWILRVEKRVNELEKK |
Ga0268264_108438373 | 3300028381 | Switchgrass Rhizosphere | PQESPDMDRNWVVLGVSLMLWGLLFFWILRVERRVREVEKR |
Ga0268264_124836942 | 3300028381 | Switchgrass Rhizosphere | MRGDLVVMAVALLVWGLLFWYLIRLERRVADLEKR |
Ga0247828_102634782 | 3300028587 | Soil | MDANWVVLGVALLAWGLLFAYLSRLERRIKELERR |
Ga0272412_14227612 | 3300028647 | Activated Sludge | MDRNWVVLGVSLLVWGLLFSWLIRVERRVKELERK |
Ga0265336_100653312 | 3300028666 | Rhizosphere | MDRNWVVLGVALLVWGLLCAWLLRVEKRVRELEKR |
Ga0307498_100571253 | 3300031170 | Soil | MDRNWVVLGVSLLVWGLLFVWILRVEKRLNDMERR |
Ga0307498_101693152 | 3300031170 | Soil | MDRNWVVLGVALLVWGLLFFWILRVERRLNEMEKR |
(restricted) Ga0255310_102096922 | 3300031197 | Sandy Soil | LSGNVVVLGVALLVWGLLFFYIVRLERRIKELEKS |
Ga0307495_101369732 | 3300031199 | Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRVSEVEKR |
Ga0302323_1026215122 | 3300031232 | Fen | MDRNWVVLGVSLLVWGLLFSWLIRVEKRVKDLERK |
Ga0318516_100126864 | 3300031543 | Soil | MNANLTVLGVSLLVWGLLFIYVWRLERRVKELERK |
Ga0318516_100703343 | 3300031543 | Soil | MDRNWVVLGVSLLVWGLLFFWILRVERMVKDAEKR |
Ga0318516_103370602 | 3300031543 | Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRIRDVENR |
Ga0318534_106557671 | 3300031544 | Soil | NRLNANLVVLGVALLVWGLLFVYLLRLERRIRELEKR |
Ga0247727_100272356 | 3300031576 | Biofilm | MVGNAVVMGVSLLVWGLLFYYLVRLERRVSELEKK |
Ga0247727_100681113 | 3300031576 | Biofilm | MSGGNVVMGVALLTWGLLFYYLVRIERRVKELEKR |
Ga0247727_108465542 | 3300031576 | Biofilm | VSGNVVVLAVAVLVWGLLFLYLSRLEKRIKELEKR |
Ga0247727_110448742 | 3300031576 | Biofilm | LNGNLVVMGVALLTWGLLFLYLVRLERRLRELEKS |
Ga0315291_101406115 | 3300031707 | Sediment | VNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR |
Ga0315291_104685102 | 3300031707 | Sediment | VWALNGNLVVLGVALLVWGLLFLYLLRLERRVRDLEKR |
Ga0310813_103155202 | 3300031716 | Soil | VNPNWVVLGVALLVWGLVFVYLTRLDRRIRELEKK |
Ga0310813_119230552 | 3300031716 | Soil | VNANFVVAGVALLVWGMVFFYLARLERRVRELEKR |
Ga0307469_101889182 | 3300031720 | Hardwood Forest Soil | MNANMTVLGVSLLVWGLVFVYLWRLERRVKELERK |
Ga0307469_104522352 | 3300031720 | Hardwood Forest Soil | MSKEYVVLGVALLAWGLLFLYLWRIDKRLKDLERK |
Ga0307469_114039492 | 3300031720 | Hardwood Forest Soil | VNRNWIVLGVALLVWGLVFFYLTRLERRIRELEKR |
Ga0318493_101832853 | 3300031723 | Soil | GNRLNANLVVLGVALLVWGLLFVYLLRLERRIRELEKR |
Ga0307468_1007962772 | 3300031740 | Hardwood Forest Soil | VIGNAVVLGVALLVWGLIFFYLIRLDRRIKELERK |
Ga0307468_1018181212 | 3300031740 | Hardwood Forest Soil | MDRNWVVLGVSLMLWGLLFFWILRVERRVRDAEKR |
Ga0318529_102890303 | 3300031792 | Soil | LNANLVVLGVALLVWGLLFVYLLRLERRIRELEKR |
Ga0315290_100186953 | 3300031834 | Sediment | VQLDANGVVLGVALLVWGLLFFYLVRLERRIKDLEKR |
Ga0315290_101777672 | 3300031834 | Sediment | VIGNQVVLGVALLVWGLLFFYLVRLERRISGLEKK |
Ga0310907_100346263 | 3300031847 | Soil | MDRNWVVLGVSLLVWGLLFAWILRVEKRLNDMERR |
Ga0310904_107677243 | 3300031854 | Soil | EEYVLSGNQVVLAVALLVWGLLFFYLLRIERRVKDLEKR |
Ga0302322_1020844482 | 3300031902 | Fen | MDHIDKNWVVLGVSLLVWGMLFVWLLLVEKRVRELERK |
Ga0311367_114916142 | 3300031918 | Fen | MDRNWVVLGVSLLVWGLLFTWLLRVEKRVRELEKR |
Ga0315294_100286265 | 3300031952 | Sediment | VWNVNGNLVVLGVALLAWGLLFLYLLRLERRIRDLEKR |
Ga0318563_102009713 | 3300032009 | Soil | AGGNRLNANLVVLGVALLVWGLLFVYLLRLERRIRELEKR |
Ga0310902_108783812 | 3300032012 | Soil | VSGNLVVMGVSLLTWAATFFYLLRLERRIKELEKP |
Ga0318577_104272543 | 3300032091 | Soil | ISSGPDLDRNWVVLGVSLLVWGLLFFWILRVERMVKDAEKR |
Ga0315277_1001570210 | 3300032118 | Sediment | VWTLNGNLVVLGVALLVWGLLFLYLLRLERRVRDLEKR |
Ga0315912_1000202811 | 3300032157 | Soil | MDRNWVVLGVSLLVWGLLFGWILRVEKRLNDMERR |
Ga0315281_111740002 | 3300032163 | Sediment | MDRNWVVLGVSLLVWGLLFSWLIRVEKRVRELEKK |
Ga0315268_101293844 | 3300032173 | Sediment | MNGNLVVLGVALLVWGMLFLYLLRLERRIRELEKR |
Ga0315268_105523542 | 3300032173 | Sediment | LNANLTVLGVALLVWGLLFVYLLRLERRLRDLEKR |
Ga0315268_106228032 | 3300032173 | Sediment | VNGNLVVLGVALLVWGMLFLYLLRLERRIKELEKR |
Ga0315276_122653322 | 3300032177 | Sediment | VWNVNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR |
Ga0307471_1008711412 | 3300032180 | Hardwood Forest Soil | MDRNWVVLGVSLLVWGLLFTWILRLERRVREVERR |
Ga0307471_1035499022 | 3300032180 | Hardwood Forest Soil | MNGNLVVLGVALLAWGLLFFYLARLERRIRELEKR |
Ga0307471_1040960972 | 3300032180 | Hardwood Forest Soil | MRGDLVVMAVALLTWGLLFWYLVRVERRVADLEKR |
Ga0315286_100348663 | 3300032342 | Sediment | VSGNLVVMGVALLVWGLLFLFLVRLERRMKELEKR |
Ga0315287_111933192 | 3300032397 | Sediment | VWTVNGNLVVLGVALLVWGLLFLYLLRLERRIRDLEKR |
Ga0315273_114094072 | 3300032516 | Sediment | MDRNWVVLGVSLLVWGLLFIWILRVERRLNEMEKR |
Ga0335085_100238195 | 3300032770 | Soil | MDRNWIVLGVSLLVWGLLFLWLVRVEKRVKELERK |
Ga0335085_100293572 | 3300032770 | Soil | MKGNWVVMGVALLVWGLIFVYLVRLEKRIRNLEDR |
Ga0335085_108123532 | 3300032770 | Soil | VGRIDVNQNLVVLGVALLAWGLLFGYLLRLERRVKELEKQ |
Ga0335085_113392492 | 3300032770 | Soil | MKGNWVVMGVALLVWGLIFVYLVRLERRIRDLEDR |
Ga0335080_104384703 | 3300032828 | Soil | MDRNFVVLGVSLLVWGLIFLWLLRVDRRVRELERK |
Ga0335080_108402192 | 3300032828 | Soil | MDRNYVVLGVSLLVWGLLFAWLLRVERRVRDLERK |
Ga0335070_104612283 | 3300032829 | Soil | VSGNLVVLGVALLVWGLLFVYLVRLERRVRELEKR |
Ga0335070_116757572 | 3300032829 | Soil | VRIPLNPDDTAVLLVALLVWGLLFFYVLRLERRVKDLEKR |
Ga0335081_114360042 | 3300032892 | Soil | MDRNWVVLGVSLLIWGLLCAWLLRVESRVRELEKR |
Ga0335069_109697192 | 3300032893 | Soil | MDRNWVVLGVSLLVWGLLFIWLVRVERRVKELEKK |
Ga0335071_100202993 | 3300032897 | Soil | VWVLNGNLVVLGVALLVWGLLFLYLLRLERRIRDLERR |
Ga0335076_101616144 | 3300032955 | Soil | MQGNWVVLGVALLVWGMLFFYILRVERRLTDLEKR |
Ga0335084_108159112 | 3300033004 | Soil | MSGTMAVLLVALLAWGLVFVWLLRLERRVKEIEKS |
Ga0335084_117201062 | 3300033004 | Soil | VNQNLVVLGVALLAWGLLFGYLLRLERRVKELEKR |
Ga0335077_116847792 | 3300033158 | Soil | MDRNYVVLGVSLLVWGLIFLWVLRVDRRVRELEKK |
Ga0334722_103371623 | 3300033233 | Sediment | VWIVNGNLVVLGVSLLVWGLLFLFLLRLERRIRDLERR |
Ga0334722_108128852 | 3300033233 | Sediment | VDRNFVVLGVALLVWGLLFIYILRIERRVRELEKR |
Ga0334722_113087522 | 3300033233 | Sediment | MDRNWVVLGVSLLVWTLLFLWLVRVERRVKELEKR |
Ga0310810_1000219413 | 3300033412 | Soil | MNGNLVVLGVALLTWGLLFTYLVRLEKRIRDLEKP |
Ga0326729_10257831 | 3300033432 | Peat Soil | VWTLNGNLVVLGVALLVWGLLFVYLIRLERRIRDLEKR |
Ga0326726_104279963 | 3300033433 | Peat Soil | VNGNLVVLGVALLVWGLLFLYLLRLEHRIRDLEKR |
Ga0326726_118641842 | 3300033433 | Peat Soil | MDRNWVVLGVSLLVWGLLFFWLLRVERRLNEMEKR |
Ga0316627_1013376993 | 3300033482 | Soil | MDRNFVVLGVSLLVWGLLFLWLLRVEKRVRELEKR |
Ga0316624_100268503 | 3300033486 | Soil | LNGNLVVLGVALLVWGLLFLYLLRLERRIRELEKR |
Ga0316628_1042928331 | 3300033513 | Soil | VWTLNGNLVVLGVALLVWGLLFLYLLRLERRIRELERR |
Ga0364930_0161512_384_491 | 3300033814 | Sediment | MNANLTVLGVSLLVWGLIFVYLWRLERRIKELERK |
Ga0373902_073777_214_330 | 3300034099 | Sediment Slurry | VWILNGNLVVLSVALLVWGLLFLYLLRLERRVRDLEKR |
Ga0364925_0255242_385_492 | 3300034147 | Sediment | VNGNLVVLAVSLLTWAVTFFYLLRLERRIKDLEKS |
Ga0370498_032083_798_905 | 3300034155 | Untreated Peat Soil | MDRNFVVLGVSLLVWGLLFFWLLRVEKRVRELEKR |
Ga0314794_095192_153_260 | 3300034669 | Soil | MDRTWVVLGVSLLVWGLLFAWILRVEKRLNELERR |
Ga0373950_0166605_177_284 | 3300034818 | Rhizosphere Soil | MDRNWVVLGVALLVWGLLFGWVLRVERRVKELEKR |
⦗Top⦘ |