Basic Information | |
---|---|
Family ID | F008504 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 332 |
Average Sequence Length | 47 residues |
Representative Sequence | MVALRYASLGFVLLLFGCASMNPKPIEVDMPTAQKHFIVRADGDQLPR |
Number of Associated Samples | 204 |
Number of Associated Scaffolds | 332 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.80 % |
% of genes near scaffold ends (potentially truncated) | 28.61 % |
% of genes from short scaffolds (< 2000 bps) | 78.01 % |
Associated GOLD sequencing projects | 182 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.928 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.855 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.193 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.771 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 332 Family Scaffolds |
---|---|---|
PF03480 | DctP | 23.19 |
PF00903 | Glyoxalase | 20.18 |
PF00676 | E1_dh | 6.63 |
PF00270 | DEAD | 3.61 |
PF08240 | ADH_N | 2.71 |
PF03092 | BT1 | 2.41 |
PF07883 | Cupin_2 | 1.20 |
PF05977 | MFS_3 | 0.90 |
PF16124 | RecQ_Zn_bind | 0.90 |
PF00578 | AhpC-TSA | 0.90 |
PF04909 | Amidohydro_2 | 0.90 |
PF09382 | RQC | 0.60 |
PF00561 | Abhydrolase_1 | 0.60 |
PF01557 | FAA_hydrolase | 0.30 |
PF08544 | GHMP_kinases_C | 0.30 |
PF07045 | DUF1330 | 0.30 |
PF00271 | Helicase_C | 0.30 |
PF12848 | ABC_tran_Xtn | 0.30 |
PF03692 | CxxCxxCC | 0.30 |
PF00498 | FHA | 0.30 |
PF12697 | Abhydrolase_6 | 0.30 |
PF05960 | DUF885 | 0.30 |
PF13365 | Trypsin_2 | 0.30 |
COG ID | Name | Functional Category | % Frequency in 332 Family Scaffolds |
---|---|---|---|
COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 6.63 |
COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 6.63 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.90 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.30 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.30 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.93 % |
Unclassified | root | N/A | 18.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c0536293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 801 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c0600394 | Not Available | 920 | Open in IMG/M |
3300000443|F12B_10079240 | Not Available | 857 | Open in IMG/M |
3300000550|F24TB_10014701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1559 | Open in IMG/M |
3300000955|JGI1027J12803_107468262 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 728 | Open in IMG/M |
3300001431|F14TB_100436988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1051 | Open in IMG/M |
3300001661|JGI12053J15887_10591764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 528 | Open in IMG/M |
3300002558|JGI25385J37094_10016994 | Not Available | 2604 | Open in IMG/M |
3300002558|JGI25385J37094_10021972 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2274 | Open in IMG/M |
3300002558|JGI25385J37094_10175936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
3300002560|JGI25383J37093_10133114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
3300002561|JGI25384J37096_10047315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1645 | Open in IMG/M |
3300002562|JGI25382J37095_10034498 | Not Available | 1982 | Open in IMG/M |
3300002562|JGI25382J37095_10050341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1604 | Open in IMG/M |
3300002562|JGI25382J37095_10149987 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 762 | Open in IMG/M |
3300002908|JGI25382J43887_10011104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4578 | Open in IMG/M |
3300003324|soilH2_10395914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1133 | Open in IMG/M |
3300004268|Ga0066398_10012730 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1276 | Open in IMG/M |
3300004281|Ga0066397_10017447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1024 | Open in IMG/M |
3300004633|Ga0066395_10027438 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
3300004633|Ga0066395_10468849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 721 | Open in IMG/M |
3300004633|Ga0066395_10636044 | Not Available | 628 | Open in IMG/M |
3300005166|Ga0066674_10125356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1203 | Open in IMG/M |
3300005166|Ga0066674_10156631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1077 | Open in IMG/M |
3300005167|Ga0066672_10712549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
3300005171|Ga0066677_10008279 | All Organisms → cellular organisms → Bacteria | 4388 | Open in IMG/M |
3300005174|Ga0066680_10193314 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1284 | Open in IMG/M |
3300005174|Ga0066680_10865683 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 538 | Open in IMG/M |
3300005176|Ga0066679_10608061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 713 | Open in IMG/M |
3300005180|Ga0066685_10002416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8693 | Open in IMG/M |
3300005180|Ga0066685_10382397 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300005180|Ga0066685_10410083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 941 | Open in IMG/M |
3300005181|Ga0066678_10266235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1113 | Open in IMG/M |
3300005186|Ga0066676_10012583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4219 | Open in IMG/M |
3300005186|Ga0066676_10050573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2360 | Open in IMG/M |
3300005186|Ga0066676_10186029 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1327 | Open in IMG/M |
3300005294|Ga0065705_10590327 | Not Available | 694 | Open in IMG/M |
3300005332|Ga0066388_100026680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5284 | Open in IMG/M |
3300005332|Ga0066388_100031554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4992 | Open in IMG/M |
3300005332|Ga0066388_100290630 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
3300005332|Ga0066388_100323847 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2187 | Open in IMG/M |
3300005332|Ga0066388_100808999 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1529 | Open in IMG/M |
3300005332|Ga0066388_101345518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1235 | Open in IMG/M |
3300005332|Ga0066388_103954060 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 756 | Open in IMG/M |
3300005332|Ga0066388_103993005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 752 | Open in IMG/M |
3300005334|Ga0068869_100531005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 986 | Open in IMG/M |
3300005345|Ga0070692_11236735 | Not Available | 533 | Open in IMG/M |
3300005353|Ga0070669_101271573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 637 | Open in IMG/M |
3300005353|Ga0070669_101442726 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 598 | Open in IMG/M |
3300005367|Ga0070667_101462533 | Not Available | 641 | Open in IMG/M |
3300005406|Ga0070703_10195840 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 790 | Open in IMG/M |
3300005444|Ga0070694_100901227 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 730 | Open in IMG/M |
3300005445|Ga0070708_100518352 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1124 | Open in IMG/M |
3300005446|Ga0066686_10022910 | All Organisms → cellular organisms → Bacteria | 3535 | Open in IMG/M |
3300005446|Ga0066686_10280410 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1130 | Open in IMG/M |
3300005471|Ga0070698_100591862 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1049 | Open in IMG/M |
3300005536|Ga0070697_100907711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
3300005540|Ga0066697_10016458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3938 | Open in IMG/M |
3300005545|Ga0070695_101184234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 628 | Open in IMG/M |
3300005555|Ga0066692_10369411 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 909 | Open in IMG/M |
3300005556|Ga0066707_10046778 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2489 | Open in IMG/M |
3300005556|Ga0066707_10219798 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1232 | Open in IMG/M |
3300005558|Ga0066698_10092767 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300005558|Ga0066698_10381348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 971 | Open in IMG/M |
3300005558|Ga0066698_11039752 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
3300005561|Ga0066699_10006300 | All Organisms → cellular organisms → Bacteria | 5391 | Open in IMG/M |
3300005561|Ga0066699_10396166 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 988 | Open in IMG/M |
3300005713|Ga0066905_100189643 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1525 | Open in IMG/M |
3300005713|Ga0066905_101377876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 637 | Open in IMG/M |
3300005713|Ga0066905_101822994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
3300005719|Ga0068861_101021402 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 790 | Open in IMG/M |
3300005764|Ga0066903_100914197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1590 | Open in IMG/M |
3300005764|Ga0066903_101100640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1465 | Open in IMG/M |
3300005844|Ga0068862_100596454 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1060 | Open in IMG/M |
3300005983|Ga0081540_1042613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2339 | Open in IMG/M |
3300006031|Ga0066651_10252999 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 934 | Open in IMG/M |
3300006034|Ga0066656_10041678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2612 | Open in IMG/M |
3300006049|Ga0075417_10000257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10939 | Open in IMG/M |
3300006049|Ga0075417_10006343 | All Organisms → cellular organisms → Bacteria | 4108 | Open in IMG/M |
3300006049|Ga0075417_10174877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
3300006049|Ga0075417_10265910 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 825 | Open in IMG/M |
3300006194|Ga0075427_10014571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1207 | Open in IMG/M |
3300006796|Ga0066665_10884049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 694 | Open in IMG/M |
3300006844|Ga0075428_100863716 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 960 | Open in IMG/M |
3300006845|Ga0075421_101775930 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 664 | Open in IMG/M |
3300006845|Ga0075421_102254383 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
3300006847|Ga0075431_101576779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 614 | Open in IMG/M |
3300006852|Ga0075433_10048304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3700 | Open in IMG/M |
3300006852|Ga0075433_10113594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2403 | Open in IMG/M |
3300006854|Ga0075425_100813274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1070 | Open in IMG/M |
3300006854|Ga0075425_101032452 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 937 | Open in IMG/M |
3300006854|Ga0075425_101784857 | Not Available | 691 | Open in IMG/M |
3300006854|Ga0075425_102538017 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
3300006871|Ga0075434_100986506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 856 | Open in IMG/M |
3300006914|Ga0075436_100089186 | Not Available | 2143 | Open in IMG/M |
3300006914|Ga0075436_101025152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 620 | Open in IMG/M |
3300007076|Ga0075435_100006987 | All Organisms → cellular organisms → Bacteria | 8014 | Open in IMG/M |
3300007255|Ga0099791_10017451 | All Organisms → cellular organisms → Bacteria | 3058 | Open in IMG/M |
3300007255|Ga0099791_10417737 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 647 | Open in IMG/M |
3300009012|Ga0066710_100543822 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1756 | Open in IMG/M |
3300009012|Ga0066710_102944598 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300009012|Ga0066710_103113721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
3300009012|Ga0066710_103548554 | Not Available | 589 | Open in IMG/M |
3300009089|Ga0099828_10705311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 906 | Open in IMG/M |
3300009137|Ga0066709_101065806 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1186 | Open in IMG/M |
3300009147|Ga0114129_10767666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1233 | Open in IMG/M |
3300009147|Ga0114129_10986192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1062 | Open in IMG/M |
3300009147|Ga0114129_12041892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
3300009162|Ga0075423_11561615 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 709 | Open in IMG/M |
3300009162|Ga0075423_12313375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 585 | Open in IMG/M |
3300009162|Ga0075423_12317196 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
3300009177|Ga0105248_11458527 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 774 | Open in IMG/M |
3300009553|Ga0105249_13352014 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
3300009793|Ga0105077_102532 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300009799|Ga0105075_1013341 | Not Available | 786 | Open in IMG/M |
3300009803|Ga0105065_1045876 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300009803|Ga0105065_1056153 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300009808|Ga0105071_1016161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1032 | Open in IMG/M |
3300009810|Ga0105088_1048523 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp. | 714 | Open in IMG/M |
3300009811|Ga0105084_1091286 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300009813|Ga0105057_1050674 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 684 | Open in IMG/M |
3300009814|Ga0105082_1033956 | Not Available | 820 | Open in IMG/M |
3300009815|Ga0105070_1002765 | Not Available | 2542 | Open in IMG/M |
3300009816|Ga0105076_1017851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1220 | Open in IMG/M |
3300009816|Ga0105076_1036024 | Not Available | 879 | Open in IMG/M |
3300009816|Ga0105076_1132098 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300009817|Ga0105062_1066238 | Not Available | 680 | Open in IMG/M |
3300009817|Ga0105062_1133356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 510 | Open in IMG/M |
3300009837|Ga0105058_1033621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1115 | Open in IMG/M |
3300009837|Ga0105058_1057991 | Not Available | 874 | Open in IMG/M |
3300010043|Ga0126380_10201884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1332 | Open in IMG/M |
3300010043|Ga0126380_11988908 | Not Available | 531 | Open in IMG/M |
3300010046|Ga0126384_10686165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 906 | Open in IMG/M |
3300010047|Ga0126382_10581854 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 918 | Open in IMG/M |
3300010047|Ga0126382_10680701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 860 | Open in IMG/M |
3300010047|Ga0126382_12384557 | Not Available | 513 | Open in IMG/M |
3300010336|Ga0134071_10107762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1329 | Open in IMG/M |
3300010336|Ga0134071_10391381 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 707 | Open in IMG/M |
3300010336|Ga0134071_10415470 | Not Available | 687 | Open in IMG/M |
3300010358|Ga0126370_10464484 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1059 | Open in IMG/M |
3300010358|Ga0126370_12293589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
3300010359|Ga0126376_10032567 | All Organisms → cellular organisms → Bacteria | 3542 | Open in IMG/M |
3300010359|Ga0126376_10292721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1411 | Open in IMG/M |
3300010359|Ga0126376_11071466 | Not Available | 812 | Open in IMG/M |
3300010359|Ga0126376_12224898 | Not Available | 593 | Open in IMG/M |
3300010360|Ga0126372_10140432 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1909 | Open in IMG/M |
3300010360|Ga0126372_10150934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1857 | Open in IMG/M |
3300010360|Ga0126372_10295487 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1420 | Open in IMG/M |
3300010360|Ga0126372_12989144 | Not Available | 524 | Open in IMG/M |
3300010361|Ga0126378_13104816 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
3300010362|Ga0126377_10057887 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3402 | Open in IMG/M |
3300010362|Ga0126377_10067801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3165 | Open in IMG/M |
3300010362|Ga0126377_10711562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1058 | Open in IMG/M |
3300010362|Ga0126377_11066875 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 876 | Open in IMG/M |
3300010362|Ga0126377_11687358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 708 | Open in IMG/M |
3300010366|Ga0126379_10344132 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1518 | Open in IMG/M |
3300010398|Ga0126383_11522061 | Not Available | 759 | Open in IMG/M |
3300010400|Ga0134122_10386810 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1231 | Open in IMG/M |
3300012198|Ga0137364_10352585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1098 | Open in IMG/M |
3300012199|Ga0137383_10463264 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 929 | Open in IMG/M |
3300012199|Ga0137383_11017423 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
3300012202|Ga0137363_10257703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1419 | Open in IMG/M |
3300012203|Ga0137399_10075817 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
3300012203|Ga0137399_10294448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1340 | Open in IMG/M |
3300012203|Ga0137399_10637621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 896 | Open in IMG/M |
3300012204|Ga0137374_10259684 | Not Available | 1450 | Open in IMG/M |
3300012206|Ga0137380_10404902 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1211 | Open in IMG/M |
3300012206|Ga0137380_11144068 | Not Available | 662 | Open in IMG/M |
3300012208|Ga0137376_10230449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1605 | Open in IMG/M |
3300012285|Ga0137370_10497653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 746 | Open in IMG/M |
3300012355|Ga0137369_11047142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. BA-94 | 537 | Open in IMG/M |
3300012359|Ga0137385_10423372 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1133 | Open in IMG/M |
3300012362|Ga0137361_10391586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1276 | Open in IMG/M |
3300012362|Ga0137361_11263236 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 662 | Open in IMG/M |
3300012401|Ga0134055_1367879 | Not Available | 563 | Open in IMG/M |
3300012532|Ga0137373_10169048 | Not Available | 1828 | Open in IMG/M |
3300012685|Ga0137397_10161153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1664 | Open in IMG/M |
3300012918|Ga0137396_10692878 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 752 | Open in IMG/M |
3300012918|Ga0137396_11185574 | Not Available | 539 | Open in IMG/M |
3300012922|Ga0137394_10084180 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2665 | Open in IMG/M |
3300012922|Ga0137394_10700193 | Not Available | 853 | Open in IMG/M |
3300012922|Ga0137394_11005738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
3300012923|Ga0137359_11490672 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
3300012927|Ga0137416_11917846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
3300012929|Ga0137404_10158298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1890 | Open in IMG/M |
3300012929|Ga0137404_11416006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 642 | Open in IMG/M |
3300012944|Ga0137410_10165309 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1695 | Open in IMG/M |
3300012944|Ga0137410_10263104 | Not Available | 1355 | Open in IMG/M |
3300012948|Ga0126375_10226516 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1248 | Open in IMG/M |
3300012948|Ga0126375_10363813 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1031 | Open in IMG/M |
3300012971|Ga0126369_11813171 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 699 | Open in IMG/M |
3300012975|Ga0134110_10028617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2171 | Open in IMG/M |
3300012975|Ga0134110_10188093 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 863 | Open in IMG/M |
3300012976|Ga0134076_10046734 | Not Available | 1624 | Open in IMG/M |
3300012977|Ga0134087_10022885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2302 | Open in IMG/M |
3300014154|Ga0134075_10010016 | All Organisms → cellular organisms → Bacteria | 3646 | Open in IMG/M |
3300014154|Ga0134075_10274161 | Not Available | 732 | Open in IMG/M |
3300015054|Ga0137420_1164872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
3300015245|Ga0137409_10002300 | All Organisms → cellular organisms → Bacteria | 20578 | Open in IMG/M |
3300015245|Ga0137409_10094803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2774 | Open in IMG/M |
3300015245|Ga0137409_11141817 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 619 | Open in IMG/M |
3300015264|Ga0137403_10034452 | All Organisms → cellular organisms → Bacteria | 5330 | Open in IMG/M |
3300015371|Ga0132258_10387165 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3470 | Open in IMG/M |
3300015372|Ga0132256_100290998 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1715 | Open in IMG/M |
3300015372|Ga0132256_100313460 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1655 | Open in IMG/M |
3300015374|Ga0132255_101083446 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1204 | Open in IMG/M |
3300017656|Ga0134112_10086270 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1169 | Open in IMG/M |
3300017656|Ga0134112_10399677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 567 | Open in IMG/M |
3300017659|Ga0134083_10007586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3535 | Open in IMG/M |
3300017792|Ga0163161_10768884 | Not Available | 807 | Open in IMG/M |
3300017939|Ga0187775_10049838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1274 | Open in IMG/M |
3300017997|Ga0184610_1156019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 751 | Open in IMG/M |
3300017997|Ga0184610_1177949 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300018028|Ga0184608_10068230 | Not Available | 1437 | Open in IMG/M |
3300018029|Ga0187787_10027311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1572 | Open in IMG/M |
3300018052|Ga0184638_1044437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1614 | Open in IMG/M |
3300018052|Ga0184638_1280428 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300018053|Ga0184626_10328159 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp. | 630 | Open in IMG/M |
3300018058|Ga0187766_10396525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 912 | Open in IMG/M |
3300018063|Ga0184637_10338693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 906 | Open in IMG/M |
3300018075|Ga0184632_10009220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4132 | Open in IMG/M |
3300018431|Ga0066655_10120577 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1506 | Open in IMG/M |
3300018433|Ga0066667_10033157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2931 | Open in IMG/M |
3300018433|Ga0066667_10045420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2608 | Open in IMG/M |
3300018468|Ga0066662_11971965 | Not Available | 611 | Open in IMG/M |
3300019233|Ga0184645_1093278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
3300019789|Ga0137408_1079630 | All Organisms → cellular organisms → Bacteria | 4197 | Open in IMG/M |
3300019789|Ga0137408_1330276 | All Organisms → cellular organisms → Bacteria | 3446 | Open in IMG/M |
3300020170|Ga0179594_10212204 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
3300020170|Ga0179594_10281297 | Not Available | 629 | Open in IMG/M |
3300021073|Ga0210378_10037076 | Not Available | 1937 | Open in IMG/M |
3300021073|Ga0210378_10311620 | Not Available | 590 | Open in IMG/M |
3300021086|Ga0179596_10347974 | Not Available | 744 | Open in IMG/M |
3300024317|Ga0247660_1093057 | Not Available | 520 | Open in IMG/M |
3300025910|Ga0207684_10026205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4969 | Open in IMG/M |
3300025910|Ga0207684_10339212 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1294 | Open in IMG/M |
3300025923|Ga0207681_10887435 | Not Available | 746 | Open in IMG/M |
3300025961|Ga0207712_10539177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1002 | Open in IMG/M |
3300025972|Ga0207668_10395718 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1167 | Open in IMG/M |
3300026075|Ga0207708_10686967 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 874 | Open in IMG/M |
3300026285|Ga0209438_1017273 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2414 | Open in IMG/M |
3300026285|Ga0209438_1177978 | Not Available | 561 | Open in IMG/M |
3300026296|Ga0209235_1026542 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3036 | Open in IMG/M |
3300026296|Ga0209235_1041811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2276 | Open in IMG/M |
3300026296|Ga0209235_1143050 | Not Available | 966 | Open in IMG/M |
3300026296|Ga0209235_1167107 | Not Available | 839 | Open in IMG/M |
3300026297|Ga0209237_1005783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7457 | Open in IMG/M |
3300026297|Ga0209237_1028495 | All Organisms → cellular organisms → Bacteria | 3080 | Open in IMG/M |
3300026309|Ga0209055_1002940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10571 | Open in IMG/M |
3300026317|Ga0209154_1200251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 769 | Open in IMG/M |
3300026324|Ga0209470_1000004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 138028 | Open in IMG/M |
3300026324|Ga0209470_1255947 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 698 | Open in IMG/M |
3300026324|Ga0209470_1315298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 572 | Open in IMG/M |
3300026342|Ga0209057_1019737 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3831 | Open in IMG/M |
3300026360|Ga0257173_1022117 | Not Available | 804 | Open in IMG/M |
3300026537|Ga0209157_1024817 | All Organisms → cellular organisms → Bacteria | 3602 | Open in IMG/M |
3300026537|Ga0209157_1149730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
3300026537|Ga0209157_1354993 | Not Available | 528 | Open in IMG/M |
3300026540|Ga0209376_1290710 | Not Available | 655 | Open in IMG/M |
3300026542|Ga0209805_1010440 | All Organisms → cellular organisms → Bacteria | 5011 | Open in IMG/M |
3300027013|Ga0209884_1041235 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300027068|Ga0209898_1041236 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300027273|Ga0209886_1038911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 735 | Open in IMG/M |
3300027277|Ga0209846_1043554 | Not Available | 697 | Open in IMG/M |
3300027384|Ga0209854_1039904 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300027384|Ga0209854_1078084 | Not Available | 585 | Open in IMG/M |
3300027490|Ga0209899_1004721 | All Organisms → cellular organisms → Bacteria | 3131 | Open in IMG/M |
3300027527|Ga0209684_1010491 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1480 | Open in IMG/M |
3300027561|Ga0209887_1005638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3512 | Open in IMG/M |
3300027821|Ga0209811_10045849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1485 | Open in IMG/M |
3300027873|Ga0209814_10001546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8171 | Open in IMG/M |
3300027873|Ga0209814_10003962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5572 | Open in IMG/M |
3300027873|Ga0209814_10122507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1109 | Open in IMG/M |
3300027873|Ga0209814_10177703 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 917 | Open in IMG/M |
3300027874|Ga0209465_10004639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5971 | Open in IMG/M |
3300027880|Ga0209481_10020789 | All Organisms → cellular organisms → Bacteria | 2903 | Open in IMG/M |
3300027903|Ga0209488_10843545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 646 | Open in IMG/M |
3300027907|Ga0207428_10000049 | All Organisms → cellular organisms → Bacteria | 179267 | Open in IMG/M |
3300027907|Ga0207428_10441040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 950 | Open in IMG/M |
3300027909|Ga0209382_11576843 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
3300027954|Ga0209859_1007328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2262 | Open in IMG/M |
3300027961|Ga0209853_1074539 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 896 | Open in IMG/M |
3300028536|Ga0137415_10219996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1713 | Open in IMG/M |
3300028536|Ga0137415_10341403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1301 | Open in IMG/M |
3300028536|Ga0137415_11311224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
3300028792|Ga0307504_10414252 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 533 | Open in IMG/M |
3300028819|Ga0307296_10587565 | Not Available | 610 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1032208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1093 | Open in IMG/M |
3300031199|Ga0307495_10105342 | Not Available | 675 | Open in IMG/M |
3300031226|Ga0307497_10535363 | Not Available | 583 | Open in IMG/M |
3300031538|Ga0310888_10448585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
3300031543|Ga0318516_10008144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4939 | Open in IMG/M |
3300031720|Ga0307469_10006884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5214 | Open in IMG/M |
3300031720|Ga0307469_10013316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4159 | Open in IMG/M |
3300031720|Ga0307469_10158567 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1706 | Open in IMG/M |
3300031720|Ga0307469_10735376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 898 | Open in IMG/M |
3300031720|Ga0307469_11061368 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 759 | Open in IMG/M |
3300031720|Ga0307469_11328647 | Not Available | 683 | Open in IMG/M |
3300031720|Ga0307469_11501000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
3300031723|Ga0318493_10124608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1314 | Open in IMG/M |
3300031740|Ga0307468_100048819 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2192 | Open in IMG/M |
3300031740|Ga0307468_100051238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2157 | Open in IMG/M |
3300031740|Ga0307468_100062250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2022 | Open in IMG/M |
3300031740|Ga0307468_100420773 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1028 | Open in IMG/M |
3300031740|Ga0307468_101346405 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
3300031740|Ga0307468_101799666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
3300031740|Ga0307468_101850377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 573 | Open in IMG/M |
3300031779|Ga0318566_10538625 | Not Available | 571 | Open in IMG/M |
3300031797|Ga0318550_10372018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 692 | Open in IMG/M |
3300031820|Ga0307473_10121506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1434 | Open in IMG/M |
3300031820|Ga0307473_10375181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 923 | Open in IMG/M |
3300031835|Ga0318517_10501793 | Not Available | 547 | Open in IMG/M |
3300031845|Ga0318511_10383911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 642 | Open in IMG/M |
3300031946|Ga0310910_10664448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 825 | Open in IMG/M |
3300032017|Ga0310899_10193073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 897 | Open in IMG/M |
3300032180|Ga0307471_100178294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2092 | Open in IMG/M |
3300032180|Ga0307471_100276416 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1751 | Open in IMG/M |
3300032180|Ga0307471_100483626 | Not Available | 1383 | Open in IMG/M |
3300032180|Ga0307471_100627182 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1236 | Open in IMG/M |
3300032180|Ga0307471_100720547 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1163 | Open in IMG/M |
3300032180|Ga0307471_102690294 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 631 | Open in IMG/M |
3300032180|Ga0307471_103839502 | Not Available | 531 | Open in IMG/M |
3300032205|Ga0307472_100075388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2219 | Open in IMG/M |
3300032205|Ga0307472_100329232 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1243 | Open in IMG/M |
3300032205|Ga0307472_100666194 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 930 | Open in IMG/M |
3300032770|Ga0335085_10073980 | All Organisms → cellular organisms → Bacteria | 4497 | Open in IMG/M |
3300033550|Ga0247829_11240434 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 618 | Open in IMG/M |
3300033811|Ga0364924_059010 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 829 | Open in IMG/M |
3300033812|Ga0364926_111102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. BA-94 | 570 | Open in IMG/M |
3300033813|Ga0364928_0135760 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300034090|Ga0326723_0535886 | Not Available | 539 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.35% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.13% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 8.13% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.83% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.02% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.20% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.51% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.90% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.90% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.90% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.60% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.60% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.30% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.30% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.30% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.30% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.30% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.30% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.30% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.30% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.30% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009793 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 | Environmental | Open in IMG/M |
3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_05362932 | 3300000033 | Soil | MAALRYASLALVLLLFGCASLDPKPIXVXMPAAQKHFIVRADGXALPR* |
ICChiseqgaiiDRAFT_06003942 | 3300000033 | Soil | MVMFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR* |
F12B_100792402 | 3300000443 | Soil | MVMFRYASLGVVLLLFGCASMNHKPIEVDMPTAQKHFIVKADVPALR* |
F24TB_100147012 | 3300000550 | Soil | MVVFRYASLGVVLLLFGCASMNHKPIEVDMPTAQKHFIVKADVPALR* |
JGI1027J12803_1074682621 | 3300000955 | Soil | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPA |
F14TB_1004369883 | 3300001431 | Soil | RQEAVMVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR* |
JGI12053J15887_105917641 | 3300001661 | Forest Soil | MAALRYASLGFVLLLFGCASINPKPIEVEMPTAQKHFIVRAAGD |
JGI25385J37094_100169941 | 3300002558 | Grasslands Soil | MAVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHAFR* |
JGI25385J37094_100219722 | 3300002558 | Grasslands Soil | MAALRFATLGVVLLLFGCTALYPKPIEVDMPAANKHFIVRAXGDSTLF* |
JGI25385J37094_101759361 | 3300002558 | Grasslands Soil | AALRYASLALVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKS* |
JGI25383J37093_101331141 | 3300002560 | Grasslands Soil | MAALRFATLGVVLLLFGCTALYPKPIEVDMPAANKHFIVRANGDSTLF* |
JGI25384J37096_100473152 | 3300002561 | Grasslands Soil | MAVLRYASLMVVLLLFGCASLDPKPIEVDMPTVQKHFIVKGPDNHAFR* |
JGI25382J37095_100344981 | 3300002562 | Grasslands Soil | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPD |
JGI25382J37095_100503411 | 3300002562 | Grasslands Soil | MAALRFATLGVVLLLFGCTALYPKPIEVDMPAANKHFIVRADGDSTLF* |
JGI25382J37095_101499871 | 3300002562 | Grasslands Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKS* |
JGI25382J43887_100111042 | 3300002908 | Grasslands Soil | MAVLRYASLGVVLLLFGCTSINQKPIEVDMPTAQKHFIVKAPDDHTFR* |
soilH2_103959141 | 3300003324 | Sugarcane Root And Bulk Soil | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGDALPR* |
Ga0066398_100127304 | 3300004268 | Tropical Forest Soil | MVAFRYASLGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRADGDQLPR* |
Ga0066397_100174472 | 3300004281 | Tropical Forest Soil | MVVVRYASLGLVLLLFGCASIDPKPVEVDMPTANRHFIVQAGGNQLPR* |
Ga0066395_100274384 | 3300004633 | Tropical Forest Soil | MVVLRYASLGLVLLLFGCASIDPKPVEVDMPTAKRHFIVQADGHELPR* |
Ga0066395_104688491 | 3300004633 | Tropical Forest Soil | MVALRYASLGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRAGGDQLPR* |
Ga0066395_106360441 | 3300004633 | Tropical Forest Soil | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR* |
Ga0066674_101253562 | 3300005166 | Soil | MAVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPALR* |
Ga0066674_101566312 | 3300005166 | Soil | MAALRYIGLAAFLLLVGCASINPKPIEVEMPAAQKHFIVQGPSDSALR* |
Ga0066672_107125492 | 3300005167 | Soil | MAALRYASLALVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKC* |
Ga0066677_100082793 | 3300005171 | Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDQKSQASTAR* |
Ga0066680_101933142 | 3300005174 | Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDHKSQASTAR* |
Ga0066680_108656831 | 3300005174 | Soil | MAALRYASLGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKS* |
Ga0066679_106080611 | 3300005176 | Soil | MAALRYASLGFVLLLFGCASINPKPIEVEMPAAQKHFIVRAAGDHSL* |
Ga0066685_100024163 | 3300005180 | Soil | MVVAFRYASLGLVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGDRR* |
Ga0066685_103823973 | 3300005180 | Soil | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0066685_104100832 | 3300005180 | Soil | MAVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKTDVPALR* |
Ga0066678_102662352 | 3300005181 | Soil | MVVLRYASLGVVLLLFGCTSINQKPIEVDVPTAQKHFIVQAPDDHTFR* |
Ga0066676_100125831 | 3300005186 | Soil | MAALRYIGLAAVLLLVGCASINPKPIEVEMPAAQKHFIVQGPSDSALR* |
Ga0066676_100505732 | 3300005186 | Soil | MVVFRYASLGFVLLLVGCASINPKPIEVDMPAAQKHFIVRADGDQLPR* |
Ga0066676_101860291 | 3300005186 | Soil | MVALRYASLGLVLLLVGCASLNPKPIDVEMPAAQKHFIVRADGVR* |
Ga0065705_105903272 | 3300005294 | Switchgrass Rhizosphere | MVVLRYASLGVVLLLCGCASMNQKPIEVDMPTAQKHFIVKADDPTLR* |
Ga0066388_1000266806 | 3300005332 | Tropical Forest Soil | MRVLRYASLGVVLLLFGCASMNPKPIDVDMPTAQKHFIVKADVPALR* |
Ga0066388_1000315545 | 3300005332 | Tropical Forest Soil | MVVLRYASLGLVLLLFGCASIDPKPVEVDMPTAKRHFIVQADGHQLPR* |
Ga0066388_1002906303 | 3300005332 | Tropical Forest Soil | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPAVR* |
Ga0066388_1003238473 | 3300005332 | Tropical Forest Soil | MVAFRCASFGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRAGGDQLPR* |
Ga0066388_1008089993 | 3300005332 | Tropical Forest Soil | MAALRFAFLGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRAGGVR* |
Ga0066388_1013455182 | 3300005332 | Tropical Forest Soil | MVVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR* |
Ga0066388_1039540602 | 3300005332 | Tropical Forest Soil | MVALRFVALGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADG |
Ga0066388_1039930052 | 3300005332 | Tropical Forest Soil | MAALRYASLGFVLLLFGCASMNPKPIEVDMPTAQKHFIVRADVDQLPR* |
Ga0068869_1005310052 | 3300005334 | Miscanthus Rhizosphere | MVALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADG |
Ga0070692_112367351 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADGVR* |
Ga0070669_1012715731 | 3300005353 | Switchgrass Rhizosphere | MVRFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADD |
Ga0070669_1014427261 | 3300005353 | Switchgrass Rhizosphere | MVALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADGVR* |
Ga0070667_1014625331 | 3300005367 | Switchgrass Rhizosphere | MVRFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR* |
Ga0070703_101958402 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQ |
Ga0070694_1009012272 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | YASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADGVR* |
Ga0070708_1005183523 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALRYASLAFVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKS* |
Ga0066686_100229105 | 3300005446 | Soil | MAALRYASLALVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKS* |
Ga0066686_102804102 | 3300005446 | Soil | MVVVRYASLGVVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGDQPTL* |
Ga0070698_1005918622 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GQEEHMAALRYASLALVLLLFGCASLNPKPIDVDMPSAQKHFIVQADGDHKS* |
Ga0070697_1009077112 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MMVLRYASLGVVLLLFVGCTSVYQKPIEVDMPTAQKHFIVKGPDDHTFR* |
Ga0066697_100164585 | 3300005540 | Soil | MAALRYIGLAAVLLLVGCASIDPKPIEVEMPAAQKHFIVQGPSDSALR* |
Ga0070695_1011842341 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMVRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDR* |
Ga0066692_103694112 | 3300005555 | Soil | MVVFRYASLGFVLLLFGCGSINPKPIEVDMPTAQKHFIVRADGDTIR* |
Ga0066707_100467783 | 3300005556 | Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKC* |
Ga0066707_102197983 | 3300005556 | Soil | AALRYIGLAAFLLLVGCASINPKPIEVEMPAAQKHFIVQGPSDSALR* |
Ga0066698_100927673 | 3300005558 | Soil | MAALRYIALGALLLLVGCASINPKPIEVEMPTAQKHFIVRGPSDSALR* |
Ga0066698_103813483 | 3300005558 | Soil | GVVLLLFGCTSINQKPIEVDVPTAQKHFIVQAPDDHTFR* |
Ga0066698_110397522 | 3300005558 | Soil | DNMAALRFATLGVVLLLFGCTALYPKPIEVDMPAANKHFIVRANGDSTLF* |
Ga0066699_100063001 | 3300005561 | Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKH |
Ga0066699_103961661 | 3300005561 | Soil | MAALRYASLALVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDQKSQASTAR* |
Ga0066905_1001896433 | 3300005713 | Tropical Forest Soil | MRVLRYASLGVVLLLFGCASINPKPIDVDMPTAQKHFIVKADEPALR* |
Ga0066905_1013778762 | 3300005713 | Tropical Forest Soil | MVALRYASLGFVLLLFGCASMNPKPIEVDMPTAQKHFIVRADGDQLPR* |
Ga0066905_1018229942 | 3300005713 | Tropical Forest Soil | MVVLRYASLGFVLLLFGCASIDPKPVEVDMPTAKRHFIVQADGNQLPR* |
Ga0068861_1010214022 | 3300005719 | Switchgrass Rhizosphere | MVMVRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR* |
Ga0066903_1009141971 | 3300005764 | Tropical Forest Soil | GVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPAVR* |
Ga0066903_1011006403 | 3300005764 | Tropical Forest Soil | MRVLRYASLGVVLLLFGCASMSPKPIDVDMPTAQKHFIVKADVPALR* |
Ga0068862_1005964543 | 3300005844 | Switchgrass Rhizosphere | MVALRYASLGLVLLLVGCASINPKPIDVEMPAAQK |
Ga0081540_10426132 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MAALRYASLGLVLLLFGCASLNPKPIDVEMPAAQKHFIVRADGDQSPTHFAR* |
Ga0066651_102529992 | 3300006031 | Soil | MAALRYIGLAAFLLLVGCASIDPKPIEVEMPAAQKHFIVQGPSDSALR* |
Ga0066656_100416783 | 3300006034 | Soil | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKGPDDHTFR* |
Ga0075417_100002573 | 3300006049 | Populus Rhizosphere | MAALRYASLGLVLLLFGCASLNPKPIDVEMPTAQKHFIVRADGDQSPTHLAR* |
Ga0075417_100063434 | 3300006049 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGHTLPR* |
Ga0075417_101748771 | 3300006049 | Populus Rhizosphere | VMVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR* |
Ga0075417_102659101 | 3300006049 | Populus Rhizosphere | MAALRYPSLALVLLLFGCASLDPKPIDVEMPAAQKHFIVRADGDQ |
Ga0075427_100145712 | 3300006194 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGHSLPR* |
Ga0066665_108840492 | 3300006796 | Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHF |
Ga0075428_1008637162 | 3300006844 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQK |
Ga0075421_1017759302 | 3300006845 | Populus Rhizosphere | ASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGDALPR* |
Ga0075421_1022543831 | 3300006845 | Populus Rhizosphere | LRYASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGDTLPR* |
Ga0075431_1015767791 | 3300006847 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQKHF |
Ga0075433_100483041 | 3300006852 | Populus Rhizosphere | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKAD |
Ga0075433_101135943 | 3300006852 | Populus Rhizosphere | MVALRFVALGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGAR* |
Ga0075425_1008132741 | 3300006854 | Populus Rhizosphere | MVALRFVALGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRA |
Ga0075425_1010324521 | 3300006854 | Populus Rhizosphere | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHF |
Ga0075425_1017848571 | 3300006854 | Populus Rhizosphere | YASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR* |
Ga0075425_1025380172 | 3300006854 | Populus Rhizosphere | MVVFRYAALGLVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGDRLPR* |
Ga0075434_1009865062 | 3300006871 | Populus Rhizosphere | MVALRFVALGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGVR* |
Ga0075436_1000891862 | 3300006914 | Populus Rhizosphere | MVVLRYASFGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADIPAVR* |
Ga0075436_1010251522 | 3300006914 | Populus Rhizosphere | MAALRYASLGLVLLLVGCASINPKPIEVDMPAAQKHFIVRADG |
Ga0075435_1000069876 | 3300007076 | Populus Rhizosphere | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADIPAVR* |
Ga0099791_100174512 | 3300007255 | Vadose Zone Soil | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHAFR* |
Ga0099791_104177371 | 3300007255 | Vadose Zone Soil | MVVFRYASLGFVLLLVGCGSINPKPIEVDMPAAQKHFIVRADGDPLPR* |
Ga0066710_1005438223 | 3300009012 | Grasslands Soil | MAALRYIALGALLLLVGCASINAKPIEVEMPTAQKHFIVRGPSDSALR |
Ga0066710_1029445981 | 3300009012 | Grasslands Soil | MAALRYASLGVVLLLFGCASINQKPIEVDMPMAQKHFIVRADGDHLPR |
Ga0066710_1031137212 | 3300009012 | Grasslands Soil | GGHMAALRYIALGALLLLVGCASINPKPIEVEMPSAQKHFIVRGPSDSALR |
Ga0066710_1035485541 | 3300009012 | Grasslands Soil | MATLRYIALGALLLLVGCASINPKPIEVEMPTAQKHFIVRGPSDSALR |
Ga0099828_107053112 | 3300009089 | Vadose Zone Soil | MAALRYASLGVVLLLFGCASINPKPIEVDMPAAQKHFIVRADGDHNL* |
Ga0066709_1010658062 | 3300009137 | Grasslands Soil | MAVLRYASLMVVLLLFGCASLDQKPIEVDMPTVQKHFIVKGPDNHAFR* |
Ga0114129_107676663 | 3300009147 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLYPKPIDVEMPAAQK |
Ga0114129_109861923 | 3300009147 | Populus Rhizosphere | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTL |
Ga0114129_120418922 | 3300009147 | Populus Rhizosphere | MAALRYPSLALVLLLFGCASLDPKPIDVEMPAAQKHFIVRADGHQLPSR* |
Ga0111538_138736611 | 3300009156 | Populus Rhizosphere | SLTWQEEAMAALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADGVR* |
Ga0075423_115616152 | 3300009162 | Populus Rhizosphere | MAALRYASLAFVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDHKSQASTAR* |
Ga0075423_123133751 | 3300009162 | Populus Rhizosphere | MVVVRYASLGFVLLLVGCASINPKPIEVDMPAAQKHFIVRADGNPLPR* |
Ga0075423_123171962 | 3300009162 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLYPKPIDVEMPAAQKHFIVRADGHQLPSR* |
Ga0105248_114585272 | 3300009177 | Switchgrass Rhizosphere | MVALRFVALGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGIR* |
Ga0105249_133520142 | 3300009553 | Switchgrass Rhizosphere | LALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGHTLPR* |
Ga0105077_1025321 | 3300009793 | Groundwater Sand | MMVLRYASVVIVALLLVGCASLNPKPIEVDVPAAQKHFIVTGPGDSTLL* |
Ga0105075_10133411 | 3300009799 | Groundwater Sand | MVVLRYASLGLVLLLVGCASIDPKPIEVDMPAAQKHFIVKGPVDHAFR* |
Ga0105065_10458761 | 3300009803 | Groundwater Sand | MVVLRYASLGVVLLLLGCASVNQKPIEVDMPTAQKHFIV |
Ga0105065_10561531 | 3300009803 | Groundwater Sand | MVALRYASLAIVLLLVGCASITPKPIEVDVPAAQKHFIVTGPGDSTLL* |
Ga0105071_10161612 | 3300009808 | Groundwater Sand | MMVLRYASVVIVALLLVGCASLNPKPIEVDVPAAQKHFIVTGPSDPARL* |
Ga0105088_10485232 | 3300009810 | Groundwater Sand | MVVLRYASLGVVLLLLGCASVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0105084_10912862 | 3300009811 | Groundwater Sand | GNMVALRYASLAIVLLLVGCASITPKPIEVDVPAAQKHFIVTGPGDSTLL* |
Ga0105057_10506742 | 3300009813 | Groundwater Sand | MVALRYASLAIVLLLVGCASITPKPIEVDVPAAQKHFIVTGPDDSTLL* |
Ga0105082_10339562 | 3300009814 | Groundwater Sand | MVVLRYASLGVILLLLGCASVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0105070_10027653 | 3300009815 | Groundwater Sand | MVVLRYALLGIVLLLFSCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0105076_10178513 | 3300009816 | Groundwater Sand | RFARREETMVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVQGPDDHTFR* |
Ga0105076_10360241 | 3300009816 | Groundwater Sand | MVVLRYASLGVVLLLLGCASVNQKPIEVDMPTAQKHFIVKTPDDHTFR* |
Ga0105076_11320981 | 3300009816 | Groundwater Sand | MAALRYASLAIVLLLVGCASITPKPIEVDVPAAQKHFIVTGPGDSTLL* |
Ga0105062_10662382 | 3300009817 | Groundwater Sand | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVQGPDDHTFR* |
Ga0105062_11333561 | 3300009817 | Groundwater Sand | MAALRYASLSVVVLLLVGCASLNPKPIEVDVPAAQKHFIVTGPVDPTLL* |
Ga0105058_10336211 | 3300009837 | Groundwater Sand | MVVLRYASLVLVALLLVGCASLNPKPIEVDVPAAQKHFIVTGPVDPTLL* |
Ga0105058_10579911 | 3300009837 | Groundwater Sand | MVVVRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0126380_102018842 | 3300010043 | Tropical Forest Soil | MVVLRYALLGFVLLLFGCASIDPKPVEVDMPTAKRHFIVQADGNRLPR* |
Ga0126380_119889081 | 3300010043 | Tropical Forest Soil | MAALRYASLGLVLLLFGCASLDPKPIEVDMPTAQKHFIVRADGDALPR* |
Ga0126384_106861651 | 3300010046 | Tropical Forest Soil | MVALRLASLGFVLLLFGCASLNPKPIEVDMPAAQKHFIVRADGDHLPR* |
Ga0126382_105818542 | 3300010047 | Tropical Forest Soil | MVVLRFASLGFVLLLFGCASLNPKPIEVDMPAAQKHFIVRADGDQLPR* |
Ga0126382_106807011 | 3300010047 | Tropical Forest Soil | MVVLRYASLGFVLLLFGCASIDPKPVEVDMPTAKR |
Ga0126382_123845572 | 3300010047 | Tropical Forest Soil | MRVLRYASLGVVFLLFVCASINPKPIVVDMPTAQKHFIVKADEPALR* |
Ga0134071_101077623 | 3300010336 | Grasslands Soil | MAVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVP |
Ga0134071_103913812 | 3300010336 | Grasslands Soil | MAALRYIGLAAFLLLVGCASINPKPIEVEMPAAQKHFIVQGPSDSA |
Ga0134071_104154702 | 3300010336 | Grasslands Soil | MMVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKGPDDHTFR* |
Ga0126370_104644841 | 3300010358 | Tropical Forest Soil | HMVALRYASLGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRADVDQLPR* |
Ga0126370_122935892 | 3300010358 | Tropical Forest Soil | VRRANGLLGLLGVVLLLFGCASMSPKPIDVDMPTAQKHFIVKADVPALR* |
Ga0126376_100325673 | 3300010359 | Tropical Forest Soil | MVAFRYASLGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRAGGDQLPR* |
Ga0126376_102927213 | 3300010359 | Tropical Forest Soil | MVALRFVTLGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGVR* |
Ga0126376_110714662 | 3300010359 | Tropical Forest Soil | MVVFRYASLGVVLLLFGCASMNPKPSEVDMPTAQKHFIVKADDPTLR* |
Ga0126376_122248981 | 3300010359 | Tropical Forest Soil | MVALRYASLGFVLLLFGCASMNPKPIEVDMPAAQKHFIVRAGGDQLPR* |
Ga0126372_101404322 | 3300010360 | Tropical Forest Soil | MVVLRYASLGLVLLLFGCASIDPKPVEVDMPTAKRHFIVQADGNQLPR* |
Ga0126372_101509342 | 3300010360 | Tropical Forest Soil | MRVLRYASLGVVLLLFGCASINPKPIDVDMPTAQKHFIVKADEPALH* |
Ga0126372_102954871 | 3300010360 | Tropical Forest Soil | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKA |
Ga0126372_129891442 | 3300010360 | Tropical Forest Soil | MVALRYASLGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRADVDQLPR* |
Ga0126378_131048161 | 3300010361 | Tropical Forest Soil | MVAFRCASFGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRAGG |
Ga0126377_100578872 | 3300010362 | Tropical Forest Soil | MVVLRYASLGLVLLLSGCASIDPKPVEVDMPTAKRHFIVQADGHQLPR* |
Ga0126377_100678013 | 3300010362 | Tropical Forest Soil | MVAFRYAALGLVLLLFGCASIDPKPIEVDMPTAQNHFIVRADGDQPPR* |
Ga0126377_107115621 | 3300010362 | Tropical Forest Soil | MVVLRFASLGVVLLLFGCASLNPKPIEVDMPAAQKHFIVRADGDQLPR* |
Ga0126377_110668752 | 3300010362 | Tropical Forest Soil | MVALRYASLGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGDQLPR* |
Ga0126377_116873581 | 3300010362 | Tropical Forest Soil | MVALRYASLGFVLLLFGCASMNPKPIEVDMPTAQKH |
Ga0126379_103441321 | 3300010366 | Tropical Forest Soil | MGALRYASLGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRADVDQLPR* |
Ga0126383_115220611 | 3300010398 | Tropical Forest Soil | MVVVRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPAVR* |
Ga0134122_103868103 | 3300010400 | Terrestrial Soil | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVRADDPTLR* |
Ga0137364_103525852 | 3300012198 | Vadose Zone Soil | MAALRYIGLAALLLLVGCASINPKPIEVEMPAAQKHFIVQAPSDSALR* |
Ga0137383_104632643 | 3300012199 | Vadose Zone Soil | MVVFRILGLGALLLLAGCASINPKPIEVEMPVAQKHFIVQGPSDSALR* |
Ga0137383_110174231 | 3300012199 | Vadose Zone Soil | MAALRYASLGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGEHKS* |
Ga0137363_102577031 | 3300012202 | Vadose Zone Soil | MAALRYASLGFVLLLFGCASINPKPIEVDMPAAQKHFIVRADGNSS* |
Ga0137399_100758173 | 3300012203 | Vadose Zone Soil | MAALRYASLGFVLLLFGCASINPKPIEVEMPTAQKHFIVRAAGDHSL* |
Ga0137399_102944483 | 3300012203 | Vadose Zone Soil | MAVLRYASLIVVLLLFGCASLDQKPIEVDMPTVQKHFIVKGPDDHAFR* |
Ga0137399_106376212 | 3300012203 | Vadose Zone Soil | MVALRFFGLAAVLLLVGCASINPKPIEVEMPSAQKHFIVQGPSDSALR* |
Ga0137374_102596842 | 3300012204 | Vadose Zone Soil | MVVLRYASLGVVLLLLGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0137380_104049022 | 3300012206 | Vadose Zone Soil | AGGTMAALRYIGLAAFLLLVGCASINPKPIEVEMPAAQKHFIVQGPSDSALR* |
Ga0137380_111440681 | 3300012206 | Vadose Zone Soil | SRARFALQEEYMAVLRYASLMVVLLLFGCASLDQKPIEVDMPTVQKHFIVKGPDNHAFR* |
Ga0137376_102304493 | 3300012208 | Vadose Zone Soil | MAALRYIGLAAFLLLVGCASINPKPIEVEMPAAQKHFIVQAPSDSALR* |
Ga0137370_104976531 | 3300012285 | Vadose Zone Soil | MAVFRILGLGALLLLVGCASIDPKPIEVEMPAAQKHFIVQGPTVS |
Ga0137369_110471421 | 3300012355 | Vadose Zone Soil | MVVFRYASLGVVLLLLGCTSVNQKPIEVDMPTAQKHFIVKASDDHTFR* |
Ga0137385_104233721 | 3300012359 | Vadose Zone Soil | MVALRYAFLGLVLLLVGCASLNPKPTDVEMPAAQKHFIVRADGVR* |
Ga0137361_103915863 | 3300012362 | Vadose Zone Soil | MAALRYIALGALLLLVGCASINPKPIEVEMPSAQKHFIVCGPSDSALR* |
Ga0137361_112632362 | 3300012362 | Vadose Zone Soil | MVVFRILGLGALLLLVGCASINPKPIEVEMPVAQKHFIVQGPSDSALR* |
Ga0134055_13678792 | 3300012401 | Grasslands Soil | VLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFL* |
Ga0137373_101690483 | 3300012532 | Vadose Zone Soil | MVVLRYASLGVVLLLFCCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0137397_101611532 | 3300012685 | Vadose Zone Soil | MVVFRYASLGFVLLLVGCASINPKPIEVDMPAAQKHFIVRADGNQLPR* |
Ga0137396_106928782 | 3300012918 | Vadose Zone Soil | MVALRYIALAALLLLVGCASIDRKPIEVEMPSAQKHFIVQGPSDSALR* |
Ga0137396_111855741 | 3300012918 | Vadose Zone Soil | PAVHLSRQEEVMAVFRYASLGVVLLLFGCASMDPKPIEVDMPTAQKHFIVKADVPALR* |
Ga0137394_100841803 | 3300012922 | Vadose Zone Soil | MVVFRILGVGALLLLVGCASINPKPIEVEMPVAQKHFIVQGPSDSALR* |
Ga0137394_107001932 | 3300012922 | Vadose Zone Soil | MAVFRYASLGVVLLLFGCASMDPKPIEVDMPTAQKHFIVKADVPALR* |
Ga0137394_110057382 | 3300012922 | Vadose Zone Soil | EEHMVVFRYASLGFVLLLVGCASINPKPIEVDMPAAQKHFIVRADGDPLPR* |
Ga0137359_114906721 | 3300012923 | Vadose Zone Soil | ASLGFVLLLFGCASINPKPIEVDMPAAQKHFIVRAAGDHSL* |
Ga0137416_119178462 | 3300012927 | Vadose Zone Soil | MAVLRYASLIVVLLLFGCAALDQKPIEVDMPTVQKHFIVKGPDDHAFR* |
Ga0137404_101582983 | 3300012929 | Vadose Zone Soil | MAALRYASLGFVLLLFGCASINPKPIEVDMPAAQKHFIVRADGNNS* |
Ga0137404_114160062 | 3300012929 | Vadose Zone Soil | QEEAMVALRYASLGLVLLLVGCASLNPKPIDVEMPAAQKHFIVRADGVR* |
Ga0137410_101653092 | 3300012944 | Vadose Zone Soil | MVVFRYASLGFVLLLVGCASINPKPIEVDMPAAQKHFIVRADGDPLPR* |
Ga0137410_102631043 | 3300012944 | Vadose Zone Soil | VLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0126375_102265162 | 3300012948 | Tropical Forest Soil | MVVLRYASLGLILLLFGCASIDPKPVEVDMPTAERHFIVQADGHQPPR* |
Ga0126375_103638132 | 3300012948 | Tropical Forest Soil | MVALRLASLGFVLLLFGCASLNPKPIEVDMPAAQKHFIVRADGDQLPR* |
Ga0126369_118131712 | 3300012971 | Tropical Forest Soil | MVVLRYASLGLILLLFGCASTGPKPVEVDVPTAKRHFIVQADGHQL |
Ga0134110_100286173 | 3300012975 | Grasslands Soil | ALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDQKSQASTAR* |
Ga0134110_101880932 | 3300012975 | Grasslands Soil | MAALRYASLAFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGDQPTL* |
Ga0134076_100467343 | 3300012976 | Grasslands Soil | MVVLRYASLGVVLLLFGCTSINQKPIEVDVPTAQKHFIVKAPDDHTFR* |
Ga0134087_100228851 | 3300012977 | Grasslands Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQV |
Ga0134075_100100165 | 3300014154 | Grasslands Soil | LRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKGPDDHTFR* |
Ga0134075_102741612 | 3300014154 | Grasslands Soil | MMVLRYASLGVVLLLFGCASLDPKPIEVDMPTVQKHFIVKGPDNHAFR* |
Ga0137420_11648722 | 3300015054 | Vadose Zone Soil | MAALRYASLSVVLLLVGCASINPKPIEVDMPAAQKHFIVRADGDHLPR* |
Ga0137409_100023005 | 3300015245 | Vadose Zone Soil | MVVFRYASLGFVLLLVGCASINPKPIEVDMPAAQKHFIVRADGNPLPR* |
Ga0137409_100948033 | 3300015245 | Vadose Zone Soil | MVAFRLVGLAALLLLVGCASINPKPIEVEMPSAQKHFIVQGPSDSALR* |
Ga0137409_111418171 | 3300015245 | Vadose Zone Soil | ARFARREETMAVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR* |
Ga0137403_100344523 | 3300015264 | Vadose Zone Soil | MAALRYASLSVVLLLVGCASIDPKPIEVDMPAAQKHFIVRADGDHLPR* |
Ga0132258_103871653 | 3300015371 | Arabidopsis Rhizosphere | MVALRFMALGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGVR* |
Ga0132256_1002909982 | 3300015372 | Arabidopsis Rhizosphere | MVALRFMALGFVLLLFGCASIDPKPIEVDVPTAQKHFIVRADGVR* |
Ga0132256_1003134603 | 3300015372 | Arabidopsis Rhizosphere | MVVLRYASLGVVLLLFGCASMNTKPIEVDMPTAQKHFIVKADDPTLR* |
Ga0132255_1010834463 | 3300015374 | Arabidopsis Rhizosphere | MVALRYASLGLVLLLVGCASINPKPIDVEMPTAQKHFIVRADGVR* |
Ga0134112_100862703 | 3300017656 | Grasslands Soil | MAALRYIGLAAFLLLVGCASINPKPIEVEMPAAQKH |
Ga0134112_103996772 | 3300017656 | Grasslands Soil | MAALRYIALGALLLLFGCASINPKPIEVEMPTAQKHFIVRGPSDSALR |
Ga0134083_100075861 | 3300017659 | Grasslands Soil | MMVLRYASLGVVLLLFVGCTSVYQKPIEIDMPTAQKHFIVKGPDDHTFR |
Ga0163161_107688841 | 3300017792 | Switchgrass Rhizosphere | RYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR |
Ga0187775_100498381 | 3300017939 | Tropical Peatland | MVALRYTLLALVLLLVGCAAIDPKPVEVDMPTAQKHFIVRADTAR |
Ga0184610_11560192 | 3300017997 | Groundwater Sediment | MVVVRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR |
Ga0184610_11779492 | 3300017997 | Groundwater Sediment | MVVLRYASLGVVLLLFGCTSVNQRPIEVDMPTAQKHFIVKAPDDHTFR |
Ga0184608_100682302 | 3300018028 | Groundwater Sediment | MVVLRYASLGVVLLLFGCASVNQKPIEVDMPTAQKHFIVKAPDDHTFR |
Ga0187787_100273113 | 3300018029 | Tropical Peatland | MVALLYTLLSLVLLLVGCAAIDPKPVEVDMPTAQKHFIVRADTAR |
Ga0184638_10444372 | 3300018052 | Groundwater Sediment | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR |
Ga0184638_12804281 | 3300018052 | Groundwater Sediment | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHF |
Ga0184626_103281592 | 3300018053 | Groundwater Sediment | MLVLRYASLGVVLLLFGCASVNQKPIEVDMPTAQKHFIVKASDDNTFR |
Ga0187766_103965252 | 3300018058 | Tropical Peatland | MAVFRFAALGFVLLLFGCASIDPKPVEVDMPTAQKHFIVRADGVR |
Ga0184637_103386932 | 3300018063 | Groundwater Sediment | MVVVRYASLGVVLLLFGCTSVNQKPIEVDMPTALKHFIVKAPDDHTFR |
Ga0184632_100092204 | 3300018075 | Groundwater Sediment | MVVLRYASLGVVLLLFGCTSVNQKAIEVDMPTAQKHFIVQGPDDHTFR |
Ga0066655_101205772 | 3300018431 | Grasslands Soil | MAALRYIGLAAVLLLVGCASIDPKPIEVEMPAAQKHFIVQGPSDSALR |
Ga0066667_100331573 | 3300018433 | Grasslands Soil | MAALRYIGLAAFLLLVGCASINPKPIEVEMPAAQKHFIVQGPSDSALR |
Ga0066667_100454203 | 3300018433 | Grasslands Soil | MVVVRYASLGVVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGDQPTL |
Ga0066662_119719652 | 3300018468 | Grasslands Soil | MAALRYASLALVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKS |
Ga0184645_10932783 | 3300019233 | Groundwater Sediment | ETMVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR |
Ga0137408_10796305 | 3300019789 | Vadose Zone Soil | MAVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPALR |
Ga0137408_13302762 | 3300019789 | Vadose Zone Soil | MAALRYASLGFVLLLFGCASINPKPIEVDMPAAQKHFIVRADGNSS |
Ga0179594_102122042 | 3300020170 | Vadose Zone Soil | MAALRYASLSVVLLLVGCASIDPKPIEVDMPAAQKHFIVRADGDHLPR |
Ga0179594_102812972 | 3300020170 | Vadose Zone Soil | LSRQEEVMAVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPALR |
Ga0210378_100370762 | 3300021073 | Groundwater Sediment | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVQGPDDHTFR |
Ga0210378_103116201 | 3300021073 | Groundwater Sediment | LGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR |
Ga0179596_103479742 | 3300021086 | Vadose Zone Soil | MAVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHAFR |
Ga0247660_10930572 | 3300024317 | Soil | VWQEEAMVALRFVALGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGIR |
Ga0207684_100262055 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDHKSQASTAR |
Ga0207684_103392122 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAALRYASLAFVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKS |
Ga0207681_108874351 | 3300025923 | Switchgrass Rhizosphere | MVALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADGVR |
Ga0207712_105391772 | 3300025961 | Switchgrass Rhizosphere | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR |
Ga0207668_103957181 | 3300025972 | Switchgrass Rhizosphere | MAALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADGVR |
Ga0207708_106869672 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | QEEAMVALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADGVR |
Ga0209438_10172732 | 3300026285 | Grasslands Soil | MVALRYASLGLVLLLVGCASLNPKPIDVEMPAAQKHFIVRADGVR |
Ga0209438_11779781 | 3300026285 | Grasslands Soil | MVVFRYASLGFVLLLFGCGSINPKPIEVDMPTAQKHFIVRADGDTIR |
Ga0209235_10265423 | 3300026296 | Grasslands Soil | MAALRFATLGVVLLLFGCTALYPKPIEVDMPAANKHFIVRANGDSTLF |
Ga0209235_10418113 | 3300026296 | Grasslands Soil | MAVLRYASLMVVLLLFGCASLDPKPIEVDMPTVQKHFIVKGPDNHAFR |
Ga0209235_11430503 | 3300026296 | Grasslands Soil | MVVLRYASLGVVLLLFGCTSINQKPIEVDVPTAQKHFIVKAPDDHTFR |
Ga0209235_11671071 | 3300026296 | Grasslands Soil | MVVLRYASLGVVLLLFGCTSINQKPIEVDVPTAQKHFI |
Ga0209237_10057836 | 3300026297 | Grasslands Soil | MAALRFATLGVVLLLFGCTALYPKPIEVDMPAANKHFIVRADGDSTLF |
Ga0209237_10284951 | 3300026297 | Grasslands Soil | MAVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFI |
Ga0209055_10029405 | 3300026309 | Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDQKSQASTAR |
Ga0209154_12002511 | 3300026317 | Soil | MAALRYASLALVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKC |
Ga0209470_100000493 | 3300026324 | Soil | MVVAFRYASLGLVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGDRR |
Ga0209470_12559471 | 3300026324 | Soil | MAALRYIGLAAVLLLVGCASINPKPIEVEMPAAQKHFIVQGPSDSALR |
Ga0209470_13152982 | 3300026324 | Soil | MAALRYASLGLVLLLFGCASLNPKPIEVDMPSAQKHF |
Ga0209057_10197372 | 3300026342 | Soil | MAALRYASLGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDQKSQASTAR |
Ga0257173_10221171 | 3300026360 | Soil | LRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHAFR |
Ga0209157_10248175 | 3300026537 | Soil | MAALRYIGLLAAFLLLVGCASINPKPIEVEMPAAQKHFIVQGPSDSALR |
Ga0209157_11497302 | 3300026537 | Soil | MVVLRYASLGVVLLLFGCTSINQKPIEVDVPTAQKHFIVQAPDDHTFR |
Ga0209157_13549931 | 3300026537 | Soil | MAALRYASLALVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHK |
Ga0209376_12907102 | 3300026540 | Soil | MAVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKTDVPALR |
Ga0209805_10104404 | 3300026542 | Soil | MAALRYASLALVLLLFGCASLNPKPIEVDMPSAQKHFIVQVDGDQKSQASTAR |
Ga0209884_10412351 | 3300027013 | Groundwater Sand | MVALRYASLAIVLLLVGCASITPKPIEVDVPAAQKHFIVTGPGDSTLL |
Ga0209898_10412362 | 3300027068 | Groundwater Sand | MMVLRYASVVIVALLLVGCASLNPKPIEVDVPAAQKHFIVTGPSDPARL |
Ga0209886_10389112 | 3300027273 | Groundwater Sand | MATLRYASLGVVVLLLVGCASLNPKPIEVDVPAAQKHFIVTGPVDPTLL |
Ga0209846_10435541 | 3300027277 | Groundwater Sand | FSRARFARQEETMVVLRYASLGVVLLLLGCASVNQKPIEVDMPTAQKHFIVKTPDDHTFR |
Ga0209854_10399041 | 3300027384 | Groundwater Sand | MVLRYASVVIVALLLVGCASLNPKPIEVDVPAAQKHFIVTGPSDPARL |
Ga0209854_10780841 | 3300027384 | Groundwater Sand | MAALRYASLGVVVLLLVGCASLNPKPIEVDVPAAQKHFIVTGPVDPTLL |
Ga0209899_10047213 | 3300027490 | Groundwater Sand | MVVLRYASLGVVLLLLGCASVNQKPIEVDMPTAQKHFIVKTPDDHTFR |
Ga0209684_10104913 | 3300027527 | Tropical Forest Soil | MVAFRCASFGFVLLLFGCASLNPKPIEVDMPTAQKHFIVRAGGDQLPR |
Ga0209887_10056383 | 3300027561 | Groundwater Sand | MVVLRYASLGVVLLLLGCASVNQKPIEVDMPTAQKHFIVKAPDDHTFR |
Ga0209811_100458492 | 3300027821 | Surface Soil | MVALRYASLGLVLLLVGCASINPKPIDVEMPTAQKHFIVRADGVR |
Ga0209814_100015469 | 3300027873 | Populus Rhizosphere | MAALRYASLGLVLLLFGCASLNPKPIDVEMPTAQKHFIVRADGDQSPTHLAR |
Ga0209814_100039625 | 3300027873 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGHTLPR |
Ga0209814_101225071 | 3300027873 | Populus Rhizosphere | MVRFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR |
Ga0209814_101777031 | 3300027873 | Populus Rhizosphere | MAALRYPSLALVLLLFGCASLDPKPIDVEMPAAQKHFIVRADGHQLPAR |
Ga0209465_100046395 | 3300027874 | Tropical Forest Soil | MVVLRYASLGLVLLLFGCASIDPKPVEVDMPTAKRHFIVQADGHELPR |
Ga0209481_100207891 | 3300027880 | Populus Rhizosphere | MVMVRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR |
Ga0209488_108435451 | 3300027903 | Vadose Zone Soil | MAALRYASLGVVLLLFGCASINPKPIEVDMPAAQKHFIVRADGDHNL |
Ga0207428_1000004950 | 3300027907 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGDALPR |
Ga0207428_104410401 | 3300027907 | Populus Rhizosphere | MVVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVK |
Ga0209382_115768431 | 3300027909 | Populus Rhizosphere | MAALRYASLALVLLLFGCASLYPKPIDVEMPAAQKHFIVRADGDQLPPR |
Ga0209859_10073283 | 3300027954 | Groundwater Sand | MVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIV |
Ga0209853_10745391 | 3300027961 | Groundwater Sand | MVVLRYASLGLVLLLVGCASIDPKPIEVDMPAAQKHFIVKGPVDHAFR |
Ga0137415_102199963 | 3300028536 | Vadose Zone Soil | MAALRYASLGFVLLLFGCASINPKPIEVEMPTAQKHFIVRAAGDHSL |
Ga0137415_103414032 | 3300028536 | Vadose Zone Soil | MVALRYIALAALLLLVGCASIDRKPIEVEMPSAQKHFIVQGPSDSALR |
Ga0137415_113112241 | 3300028536 | Vadose Zone Soil | MAVLRYASLIVVLLLFGCAALDQKPIEVDMPTVQKHFIVKGPDDHAFR |
Ga0307504_104142521 | 3300028792 | Soil | MVALRYASLGFVLLLFGCASINPKLIEVDMPTAQKHFIVR |
Ga0307296_105875651 | 3300028819 | Soil | FSRARFARQEETMVVLRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR |
(restricted) Ga0255311_10322081 | 3300031150 | Sandy Soil | MAAFRVASLGVVLLLFGCASINPKPIEVDMPTAQKHFIVRADGDHNL |
Ga0307495_101053422 | 3300031199 | Soil | MVTLRYASLGLVLLLVGCASLNPKPIDVEMPAAQKHFIVRADGVR |
Ga0307497_105353631 | 3300031226 | Soil | MVALRYASLGLVLLLVGCASINPKPIDVEMPTAQQHFIVRADGVR |
Ga0310888_104485851 | 3300031538 | Soil | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGDTLPR |
Ga0318516_100081444 | 3300031543 | Soil | MVALRYASLGFVLLLFGCASMNPKPIEVDMPTAQKHFIVRADGDQLPR |
Ga0307469_100068843 | 3300031720 | Hardwood Forest Soil | MVVLRYASLGVVLLLCGCASMNQKPIEVDMPTAQKHFIVKADDPTLR |
Ga0307469_100133164 | 3300031720 | Hardwood Forest Soil | MVVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADTPALR |
Ga0307469_101585671 | 3300031720 | Hardwood Forest Soil | MVVFRYASLGLVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPALL |
Ga0307469_107353762 | 3300031720 | Hardwood Forest Soil | MVALRYASLGLVLLLVGCASIYPKPIDVEMPAAQKHFIVRADGAR |
Ga0307469_110613682 | 3300031720 | Hardwood Forest Soil | MVVVRYASLGFVLLLFGCASINPKPIEVDMPTAQKHFIVRADGDTIR |
Ga0307469_113286471 | 3300031720 | Hardwood Forest Soil | SPFARQEEVMAVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVRADDPTLR |
Ga0307469_115010002 | 3300031720 | Hardwood Forest Soil | MVVFRYAALGLVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGDRLPR |
Ga0318493_101246083 | 3300031723 | Soil | MVALRYASLGFVLLLFGCASMNPKPIEVDMPTAQKHF |
Ga0307468_1000488193 | 3300031740 | Hardwood Forest Soil | MVVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKAD |
Ga0307468_1000512383 | 3300031740 | Hardwood Forest Soil | VVFRYASLGFVLLLVGCASIDPKPIEVDMPSAQKHFIVRADGNPLPR |
Ga0307468_1000622502 | 3300031740 | Hardwood Forest Soil | MVALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADDVR |
Ga0307468_1004207732 | 3300031740 | Hardwood Forest Soil | MAALRYASLALVLLLFGCASLDPKPIEVDMPAAQKHFIVRADGHALPR |
Ga0307468_1013464052 | 3300031740 | Hardwood Forest Soil | HMVVVRYASLGFVLLLFGCASINPKPIEVDMPTAQKHFIVRADGDTTR |
Ga0307468_1017996662 | 3300031740 | Hardwood Forest Soil | MVVFRYASLGFVLLLVGCASINPKPIEVDMPAAQKHFIVRADGNQLPR |
Ga0307468_1018503772 | 3300031740 | Hardwood Forest Soil | MAVLRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVRADDPTLR |
Ga0318566_105386251 | 3300031779 | Soil | MVVFRFVALGFVLLLFGCASIYPKPVEVDMPTAHKHFIVRADGVR |
Ga0318550_103720182 | 3300031797 | Soil | MVALRYASLGFVLLLFGCASMNPKPIEVDMPTAQKHFI |
Ga0307473_101215062 | 3300031820 | Hardwood Forest Soil | MVVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADDPTLR |
Ga0307473_103751812 | 3300031820 | Hardwood Forest Soil | MVVVRYASLGFVLLLFGCASINPKPIEVDMPTAQKHFIVRADGDTTR |
Ga0318517_105017931 | 3300031835 | Soil | RFAALGLVLLLFGCASIDPKPVEVDMPTAQKHFIVRADGVR |
Ga0318511_103839111 | 3300031845 | Soil | MVALRYASLGFVLLLFGCASMNPKPIEVDMPTAQK |
Ga0310910_106644481 | 3300031946 | Soil | MAVFRFAALGLVLLLFGCASIDPKPVEVDMPTAQKHFIVRADGVR |
Ga0310899_101930732 | 3300032017 | Soil | EEAMVALRYASLGLVLLLVGCASINPKPIDVEMPTAQKHFIVRADGHTLPR |
Ga0307471_1001782943 | 3300032180 | Hardwood Forest Soil | MVVFRYASLGFVLLLFGCASINPKPIEVDMPTAQKHFIVRADGDQLPR |
Ga0307471_1002764163 | 3300032180 | Hardwood Forest Soil | MVVFRYASLGVVLLLFGCASMNPKPIEVDMPTAQKHFIVRADVPALP |
Ga0307471_1004836262 | 3300032180 | Hardwood Forest Soil | MMVFRYASLGVVLLLFGCTSVNQKPIEIDMPTAQKHFIVKGPDDHTFR |
Ga0307471_1006271822 | 3300032180 | Hardwood Forest Soil | MAALRYASFGLVLLLFGCASLNPKPIEVDMPSAQKHFIVQADGDHKS |
Ga0307471_1007205472 | 3300032180 | Hardwood Forest Soil | MVALRYASLGVVLLLFGCASINPKPIEVDMPAAQKHFIVRADGAR |
Ga0307471_1026902942 | 3300032180 | Hardwood Forest Soil | MVALRLVGLAALLLLVGCASIYPKPIEVEMPAAQKHFIVRGPSDSALR |
Ga0307471_1038395021 | 3300032180 | Hardwood Forest Soil | MAVFRYASFGVVLLLFGCASMNPKPIEVDMPTAQKHFIVKADVPALR |
Ga0307472_1000753884 | 3300032205 | Hardwood Forest Soil | FVRQEAVMVVLRYASLGVVLLLCGCASMNQKPIEVDMPTAQKHFIVKADDPTLR |
Ga0307472_1003292322 | 3300032205 | Hardwood Forest Soil | MAALRYASLGLVLLLVGCASINPKPIDVEMPAAQKHFIVRADDVR |
Ga0307472_1006661942 | 3300032205 | Hardwood Forest Soil | MVVFRYASLGFVLLLVGCASINPKPIEVDMPAAQKHFIVRAD |
Ga0335085_100739803 | 3300032770 | Soil | MVALRFVALGFVLLLFGCASIDPKPIEVDMPTAQKHFIVRADGVR |
Ga0247829_112404341 | 3300033550 | Soil | MVVLRYASLGVVLLLCGCASMNQKPIEVDMPTAQKHFIVKADDPT |
Ga0364924_059010_1_135 | 3300033811 | Sediment | MATLRYASLGVVVLLLVGCASLNPKPIEVDVPAAQKHFIVTGPVD |
Ga0364926_111102_356_502 | 3300033812 | Sediment | MAVVRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHFIVKAPDDHTFR |
Ga0364928_0135760_2_112 | 3300033813 | Sediment | MVVVRYASLGVVLLLFGCTSVNQKPIEVDMPTAQKHF |
Ga0326723_0535886_221_358 | 3300034090 | Peat Soil | MAALRYASLGLILLLVGCASINPKPIDVEMPVAQKHFIVRADGVR |
⦗Top⦘ |