Basic Information | |
---|---|
Family ID | F008618 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 330 |
Average Sequence Length | 41 residues |
Representative Sequence | MVTAVDAVTALVLTVKVALVAPAATVTLEGTLAAAVLLLE |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 328 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 75.59 % |
% of genes near scaffold ends (potentially truncated) | 65.45 % |
% of genes from short scaffolds (< 2000 bps) | 72.42 % |
Associated GOLD sequencing projects | 147 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (68.182 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (57.879 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (60.909 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 2.94% Coil/Unstructured: 64.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 328 Family Scaffolds |
---|---|---|
PF00877 | NLPC_P60 | 7.32 |
PF01479 | S4 | 2.74 |
PF01406 | tRNA-synt_1e | 1.83 |
PF01370 | Epimerase | 1.22 |
PF03462 | PCRF | 0.91 |
PF03069 | FmdA_AmdA | 0.91 |
PF04255 | DUF433 | 0.61 |
PF13477 | Glyco_trans_4_2 | 0.61 |
PF12158 | DUF3592 | 0.61 |
PF13570 | PQQ_3 | 0.61 |
PF07238 | PilZ | 0.61 |
PF02585 | PIG-L | 0.30 |
PF13030 | DUF3891 | 0.30 |
PF03174 | CHB_HEX_C | 0.30 |
PF13519 | VWA_2 | 0.30 |
PF09190 | DALR_2 | 0.30 |
PF16472 | DUF5050 | 0.30 |
PF10041 | DUF2277 | 0.30 |
PF04542 | Sigma70_r2 | 0.30 |
PF16576 | HlyD_D23 | 0.30 |
PF01522 | Polysacc_deac_1 | 0.30 |
PF03824 | NicO | 0.30 |
PF14067 | LssY_C | 0.30 |
PF15780 | ASH | 0.30 |
PF00848 | Ring_hydroxyl_A | 0.30 |
PF13377 | Peripla_BP_3 | 0.30 |
PF02661 | Fic | 0.30 |
PF01011 | PQQ | 0.30 |
PF13460 | NAD_binding_10 | 0.30 |
PF01894 | UPF0047 | 0.30 |
PF13533 | Biotin_lipoyl_2 | 0.30 |
PF01022 | HTH_5 | 0.30 |
PF09286 | Pro-kuma_activ | 0.30 |
PF02687 | FtsX | 0.30 |
PF00551 | Formyl_trans_N | 0.30 |
PF01977 | UbiD | 0.30 |
PF13473 | Cupredoxin_1 | 0.30 |
PF00291 | PALP | 0.30 |
PF04014 | MazE_antitoxin | 0.30 |
PF07732 | Cu-oxidase_3 | 0.30 |
PF13419 | HAD_2 | 0.30 |
PF07519 | Tannase | 0.30 |
PF05746 | DALR_1 | 0.30 |
PF07586 | HXXSHH | 0.30 |
COG ID | Name | Functional Category | % Frequency in 328 Family Scaffolds |
---|---|---|---|
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 7.32 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.13 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.13 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.83 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.91 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.91 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.91 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.61 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 0.61 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.30 |
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.30 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.30 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.30 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.30 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.30 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.30 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.30 |
COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.30 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.30 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.30 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 68.18 % |
Unclassified | root | N/A | 31.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001213|JGIcombinedJ13530_107306552 | Not Available | 539 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100655211 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300002562|JGI25382J37095_10054493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 1530 | Open in IMG/M |
3300002914|JGI25617J43924_10021125 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
3300002914|JGI25617J43924_10274984 | Not Available | 575 | Open in IMG/M |
3300005167|Ga0066672_10054641 | All Organisms → cellular organisms → Bacteria | 2304 | Open in IMG/M |
3300005172|Ga0066683_10002475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 8057 | Open in IMG/M |
3300005178|Ga0066688_10426180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 859 | Open in IMG/M |
3300005180|Ga0066685_10424602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 923 | Open in IMG/M |
3300005181|Ga0066678_10664907 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300005187|Ga0066675_10675139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 776 | Open in IMG/M |
3300005435|Ga0070714_100630111 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300005446|Ga0066686_10753084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 652 | Open in IMG/M |
3300005447|Ga0066689_10463658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300005451|Ga0066681_10003638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6795 | Open in IMG/M |
3300005554|Ga0066661_10224705 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300005554|Ga0066661_10264173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 1064 | Open in IMG/M |
3300005554|Ga0066661_10600532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 653 | Open in IMG/M |
3300005555|Ga0066692_10015466 | All Organisms → cellular organisms → Bacteria | 3745 | Open in IMG/M |
3300005555|Ga0066692_10169434 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300005556|Ga0066707_10639770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 674 | Open in IMG/M |
3300005559|Ga0066700_10056253 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
3300005568|Ga0066703_10003362 | All Organisms → cellular organisms → Bacteria | 6776 | Open in IMG/M |
3300005586|Ga0066691_10367213 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300005587|Ga0066654_10755863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 549 | Open in IMG/M |
3300006031|Ga0066651_10697699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300006604|Ga0074060_10593309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 636 | Open in IMG/M |
3300006794|Ga0066658_10135885 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300006794|Ga0066658_10296403 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300006797|Ga0066659_10584931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
3300006800|Ga0066660_10605496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 915 | Open in IMG/M |
3300006806|Ga0079220_10166006 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300006903|Ga0075426_10022058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 4552 | Open in IMG/M |
3300007255|Ga0099791_10512899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300007258|Ga0099793_10005253 | All Organisms → cellular organisms → Bacteria | 4668 | Open in IMG/M |
3300007258|Ga0099793_10059814 | Not Available | 1700 | Open in IMG/M |
3300007258|Ga0099793_10270807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
3300007265|Ga0099794_10009436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4102 | Open in IMG/M |
3300007265|Ga0099794_10009436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 4102 | Open in IMG/M |
3300007265|Ga0099794_10225159 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300007265|Ga0099794_10247714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
3300007265|Ga0099794_10317874 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300007265|Ga0099794_10461731 | Not Available | 666 | Open in IMG/M |
3300007265|Ga0099794_10690561 | Not Available | 543 | Open in IMG/M |
3300007265|Ga0099794_10761260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300009038|Ga0099829_10147463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1875 | Open in IMG/M |
3300009038|Ga0099829_10387488 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300009038|Ga0099829_10390904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
3300009038|Ga0099829_10412424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
3300009038|Ga0099829_10509498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
3300009038|Ga0099829_10898935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300009088|Ga0099830_10137265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1868 | Open in IMG/M |
3300009088|Ga0099830_10332329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
3300009088|Ga0099830_10347453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
3300009088|Ga0099830_10750855 | Not Available | 804 | Open in IMG/M |
3300009088|Ga0099830_10861393 | Not Available | 748 | Open in IMG/M |
3300009088|Ga0099830_11207193 | Not Available | 628 | Open in IMG/M |
3300009089|Ga0099828_10431379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1188 | Open in IMG/M |
3300009090|Ga0099827_10610937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300009090|Ga0099827_10944710 | Not Available | 747 | Open in IMG/M |
3300009143|Ga0099792_10228532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
3300009143|Ga0099792_10641056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 681 | Open in IMG/M |
3300009162|Ga0075423_12960217 | Not Available | 520 | Open in IMG/M |
3300009500|Ga0116229_11587264 | Not Available | 515 | Open in IMG/M |
3300010303|Ga0134082_10350936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300010303|Ga0134082_10518195 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010323|Ga0134086_10348187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300010325|Ga0134064_10015969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2078 | Open in IMG/M |
3300010337|Ga0134062_10242635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
3300010361|Ga0126378_10891644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
3300010364|Ga0134066_10004814 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
3300010398|Ga0126383_10034758 | All Organisms → cellular organisms → Bacteria | 4046 | Open in IMG/M |
3300010398|Ga0126383_10834653 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300011270|Ga0137391_10036014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4176 | Open in IMG/M |
3300011270|Ga0137391_10239540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
3300011270|Ga0137391_10767537 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300011271|Ga0137393_10838155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
3300011271|Ga0137393_11119018 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300011271|Ga0137393_11772510 | Not Available | 506 | Open in IMG/M |
3300012189|Ga0137388_10357083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1348 | Open in IMG/M |
3300012198|Ga0137364_10102844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2014 | Open in IMG/M |
3300012199|Ga0137383_10270957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1244 | Open in IMG/M |
3300012200|Ga0137382_10757650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300012202|Ga0137363_10005838 | All Organisms → cellular organisms → Bacteria | 7614 | Open in IMG/M |
3300012202|Ga0137363_10033978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3547 | Open in IMG/M |
3300012202|Ga0137363_10294118 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300012202|Ga0137363_10502930 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300012202|Ga0137363_11184361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300012202|Ga0137363_11197455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300012202|Ga0137363_11384732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300012202|Ga0137363_11384732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300012203|Ga0137399_10084427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2419 | Open in IMG/M |
3300012203|Ga0137399_10276815 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300012203|Ga0137399_10650685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 887 | Open in IMG/M |
3300012203|Ga0137399_10675529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300012203|Ga0137399_11081414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
3300012203|Ga0137399_11567548 | Not Available | 546 | Open in IMG/M |
3300012204|Ga0137374_10679864 | Not Available | 775 | Open in IMG/M |
3300012205|Ga0137362_10146307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2018 | Open in IMG/M |
3300012205|Ga0137362_10182372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1804 | Open in IMG/M |
3300012205|Ga0137362_10296429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
3300012205|Ga0137362_10368728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1244 | Open in IMG/M |
3300012205|Ga0137362_10576806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 971 | Open in IMG/M |
3300012205|Ga0137362_10593164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
3300012205|Ga0137362_10999593 | Not Available | 712 | Open in IMG/M |
3300012205|Ga0137362_11193822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 645 | Open in IMG/M |
3300012207|Ga0137381_10141408 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300012207|Ga0137381_10295699 | Not Available | 1410 | Open in IMG/M |
3300012208|Ga0137376_10222421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1636 | Open in IMG/M |
3300012211|Ga0137377_10832165 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300012285|Ga0137370_10047234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2299 | Open in IMG/M |
3300012285|Ga0137370_10633229 | Not Available | 663 | Open in IMG/M |
3300012349|Ga0137387_10203681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1421 | Open in IMG/M |
3300012351|Ga0137386_10059954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter acidisoli | 2641 | Open in IMG/M |
3300012351|Ga0137386_10144380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7 | 1700 | Open in IMG/M |
3300012357|Ga0137384_10529839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
3300012361|Ga0137360_10195105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1636 | Open in IMG/M |
3300012361|Ga0137360_10401596 | Not Available | 1155 | Open in IMG/M |
3300012361|Ga0137360_10462207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1077 | Open in IMG/M |
3300012361|Ga0137360_10653492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
3300012361|Ga0137360_10680996 | Not Available | 883 | Open in IMG/M |
3300012361|Ga0137360_10724339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300012361|Ga0137360_10933686 | Not Available | 748 | Open in IMG/M |
3300012361|Ga0137360_11713163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300012362|Ga0137361_10298207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
3300012362|Ga0137361_11034203 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300012363|Ga0137390_10601595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
3300012363|Ga0137390_10607791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
3300012582|Ga0137358_10083554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2151 | Open in IMG/M |
3300012582|Ga0137358_10867036 | Not Available | 594 | Open in IMG/M |
3300012582|Ga0137358_11009250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300012683|Ga0137398_10071089 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
3300012683|Ga0137398_11065723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300012685|Ga0137397_10125712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1891 | Open in IMG/M |
3300012685|Ga0137397_10456602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
3300012691|Ga0157569_1061669 | Not Available | 503 | Open in IMG/M |
3300012917|Ga0137395_11088420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300012917|Ga0137395_11125541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300012918|Ga0137396_10344360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1103 | Open in IMG/M |
3300012918|Ga0137396_10490773 | Not Available | 910 | Open in IMG/M |
3300012918|Ga0137396_10527080 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300012918|Ga0137396_10559816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
3300012918|Ga0137396_10914461 | Not Available | 642 | Open in IMG/M |
3300012918|Ga0137396_10987859 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300012922|Ga0137394_10050444 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3435 | Open in IMG/M |
3300012922|Ga0137394_10124850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2180 | Open in IMG/M |
3300012922|Ga0137394_11447166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300012923|Ga0137359_10030040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4659 | Open in IMG/M |
3300012923|Ga0137359_10557781 | Not Available | 1007 | Open in IMG/M |
3300012923|Ga0137359_10571621 | Not Available | 993 | Open in IMG/M |
3300012924|Ga0137413_10042205 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
3300012924|Ga0137413_10091469 | Not Available | 1875 | Open in IMG/M |
3300012924|Ga0137413_10476491 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
3300012924|Ga0137413_10711252 | Not Available | 763 | Open in IMG/M |
3300012924|Ga0137413_10813162 | Not Available | 719 | Open in IMG/M |
3300012924|Ga0137413_10869287 | Not Available | 698 | Open in IMG/M |
3300012925|Ga0137419_10374839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
3300012925|Ga0137419_10506335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
3300012925|Ga0137419_10544081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 927 | Open in IMG/M |
3300012925|Ga0137419_10704142 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300012925|Ga0137419_10780857 | Not Available | 780 | Open in IMG/M |
3300012925|Ga0137419_11087592 | Not Available | 666 | Open in IMG/M |
3300012925|Ga0137419_11549840 | Not Available | 562 | Open in IMG/M |
3300012927|Ga0137416_10651873 | Not Available | 921 | Open in IMG/M |
3300012927|Ga0137416_11049353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300012927|Ga0137416_11198226 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300012927|Ga0137416_11225196 | Not Available | 676 | Open in IMG/M |
3300012927|Ga0137416_11270871 | Not Available | 664 | Open in IMG/M |
3300012927|Ga0137416_11399472 | Not Available | 633 | Open in IMG/M |
3300012927|Ga0137416_11557851 | Not Available | 601 | Open in IMG/M |
3300012929|Ga0137404_10231884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1578 | Open in IMG/M |
3300012929|Ga0137404_10314715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. PSR-1 | 1361 | Open in IMG/M |
3300012944|Ga0137410_10022591 | All Organisms → cellular organisms → Bacteria | 4345 | Open in IMG/M |
3300012944|Ga0137410_10269665 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300012944|Ga0137410_10593343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 915 | Open in IMG/M |
3300012944|Ga0137410_11028275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. | 702 | Open in IMG/M |
3300012944|Ga0137410_11029673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300012944|Ga0137410_11087643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300012960|Ga0164301_11117164 | Not Available | 628 | Open in IMG/M |
3300012971|Ga0126369_10979339 | Not Available | 933 | Open in IMG/M |
3300012972|Ga0134077_10078351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
3300014150|Ga0134081_10030006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1571 | Open in IMG/M |
3300014658|Ga0181519_10277774 | Not Available | 1043 | Open in IMG/M |
3300015052|Ga0137411_1006114 | Not Available | 1813 | Open in IMG/M |
3300015052|Ga0137411_1105921 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300015052|Ga0137411_1211016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1112 | Open in IMG/M |
3300015053|Ga0137405_1007412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6485 | Open in IMG/M |
3300015054|Ga0137420_1226200 | Not Available | 2523 | Open in IMG/M |
3300015054|Ga0137420_1347065 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300015054|Ga0137420_1359670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6738 | Open in IMG/M |
3300015054|Ga0137420_1394426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2058 | Open in IMG/M |
3300015054|Ga0137420_1395746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1954 | Open in IMG/M |
3300015054|Ga0137420_1449718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5340 | Open in IMG/M |
3300015054|Ga0137420_1469832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4464 | Open in IMG/M |
3300015241|Ga0137418_10144568 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
3300015241|Ga0137418_10329333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1267 | Open in IMG/M |
3300015241|Ga0137418_11113564 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300015242|Ga0137412_10034315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4145 | Open in IMG/M |
3300015245|Ga0137409_10057496 | All Organisms → cellular organisms → Bacteria | 3671 | Open in IMG/M |
3300015264|Ga0137403_10078229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3344 | Open in IMG/M |
3300015264|Ga0137403_10216388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1841 | Open in IMG/M |
3300015264|Ga0137403_10360573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1339 | Open in IMG/M |
3300015373|Ga0132257_102773004 | Not Available | 638 | Open in IMG/M |
3300018429|Ga0190272_10830033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
3300018433|Ga0066667_10000219 | All Organisms → cellular organisms → Bacteria | 17893 | Open in IMG/M |
3300018482|Ga0066669_10082398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2170 | Open in IMG/M |
3300018482|Ga0066669_10570352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
3300019377|Ga0190264_11092133 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300019789|Ga0137408_1324403 | Not Available | 654 | Open in IMG/M |
3300020170|Ga0179594_10005646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3208 | Open in IMG/M |
3300020170|Ga0179594_10230244 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300020199|Ga0179592_10212260 | Not Available | 875 | Open in IMG/M |
3300020199|Ga0179592_10405109 | Not Available | 595 | Open in IMG/M |
3300020580|Ga0210403_10259033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
3300020581|Ga0210399_10897684 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300021086|Ga0179596_10627454 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300021151|Ga0179584_1199003 | Not Available | 539 | Open in IMG/M |
3300021170|Ga0210400_10405102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1125 | Open in IMG/M |
3300021170|Ga0210400_10646567 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300021420|Ga0210394_10205964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1716 | Open in IMG/M |
3300021559|Ga0210409_11650141 | Not Available | 517 | Open in IMG/M |
3300024288|Ga0179589_10028654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1931 | Open in IMG/M |
3300024330|Ga0137417_1072075 | Not Available | 693 | Open in IMG/M |
3300024330|Ga0137417_1232608 | Not Available | 689 | Open in IMG/M |
3300024330|Ga0137417_1337961 | All Organisms → cellular organisms → Bacteria | 6667 | Open in IMG/M |
3300024330|Ga0137417_1497067 | All Organisms → cellular organisms → Bacteria | 8518 | Open in IMG/M |
3300024572|Ga0255268_1014583 | Not Available | 1881 | Open in IMG/M |
3300025928|Ga0207700_11820236 | Not Available | 535 | Open in IMG/M |
3300025939|Ga0207665_10844694 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300026298|Ga0209236_1283006 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300026300|Ga0209027_1286210 | Not Available | 530 | Open in IMG/M |
3300026304|Ga0209240_1246819 | Not Available | 545 | Open in IMG/M |
3300026309|Ga0209055_1138573 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300026310|Ga0209239_1029318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2633 | Open in IMG/M |
3300026316|Ga0209155_1193999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300026317|Ga0209154_1264316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300026319|Ga0209647_1098284 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300026325|Ga0209152_10393637 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300026328|Ga0209802_1010438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5522 | Open in IMG/M |
3300026331|Ga0209267_1243533 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300026334|Ga0209377_1098449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
3300026334|Ga0209377_1328336 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300026361|Ga0257176_1001371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2121 | Open in IMG/M |
3300026361|Ga0257176_1086934 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300026374|Ga0257146_1022926 | Not Available | 1015 | Open in IMG/M |
3300026374|Ga0257146_1082533 | Not Available | 525 | Open in IMG/M |
3300026530|Ga0209807_1168932 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300026537|Ga0209157_1040622 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
3300026540|Ga0209376_1129539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1239 | Open in IMG/M |
3300026542|Ga0209805_1297472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300026551|Ga0209648_10079665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2737 | Open in IMG/M |
3300026551|Ga0209648_10180335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1635 | Open in IMG/M |
3300026551|Ga0209648_10809588 | Not Available | 512 | Open in IMG/M |
3300026552|Ga0209577_10216876 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300026555|Ga0179593_1134261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4352 | Open in IMG/M |
3300026555|Ga0179593_1204515 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
3300026557|Ga0179587_10695859 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300026557|Ga0179587_10810795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300027643|Ga0209076_1015457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2020 | Open in IMG/M |
3300027643|Ga0209076_1151072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300027655|Ga0209388_1194427 | Not Available | 563 | Open in IMG/M |
3300027663|Ga0208990_1099546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
3300027663|Ga0208990_1153195 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300027727|Ga0209328_10226580 | Not Available | 561 | Open in IMG/M |
3300027738|Ga0208989_10244008 | Not Available | 587 | Open in IMG/M |
3300027875|Ga0209283_10047224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2732 | Open in IMG/M |
3300027882|Ga0209590_10107560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1677 | Open in IMG/M |
3300028536|Ga0137415_10796799 | Not Available | 755 | Open in IMG/M |
3300028536|Ga0137415_10806217 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300028536|Ga0137415_11259700 | Not Available | 556 | Open in IMG/M |
3300028536|Ga0137415_11399622 | Not Available | 521 | Open in IMG/M |
3300028884|Ga0307308_10062937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1749 | Open in IMG/M |
3300030730|Ga0307482_1176726 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300030991|Ga0073994_10059118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300031128|Ga0170823_15743104 | Not Available | 616 | Open in IMG/M |
3300031720|Ga0307469_10019735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3629 | Open in IMG/M |
3300031720|Ga0307469_12388500 | Not Available | 516 | Open in IMG/M |
3300031754|Ga0307475_10137225 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
3300031754|Ga0307475_10332976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1219 | Open in IMG/M |
3300031754|Ga0307475_10740801 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300031754|Ga0307475_11085452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300031820|Ga0307473_11470975 | Not Available | 515 | Open in IMG/M |
3300031897|Ga0318520_10679456 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300031962|Ga0307479_10949518 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300031962|Ga0307479_11381421 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300031962|Ga0307479_12045641 | Not Available | 521 | Open in IMG/M |
3300031997|Ga0315278_11964704 | Not Available | 547 | Open in IMG/M |
3300032174|Ga0307470_10734860 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300032180|Ga0307471_100723769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
3300032180|Ga0307471_102809714 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300032180|Ga0307471_103871796 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300032829|Ga0335070_10089788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3244 | Open in IMG/M |
3300032897|Ga0335071_11829096 | Not Available | 551 | Open in IMG/M |
3300034001|Ga0334919_005237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2495 | Open in IMG/M |
3300034965|Ga0370497_0133704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 57.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.52% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.21% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.21% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.30% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.30% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.30% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.30% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.30% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.30% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.30% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.30% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.30% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.30% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.30% |
Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.30% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.30% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.30% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012691 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES070 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030508 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2 | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300034001 | Biocrust microbial communities from Mojave Desert, California, United States - 15HMC | Environmental | Open in IMG/M |
3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1073065521 | 3300001213 | Wetland | VLLVTALVVIVKVALLLPLGTITLAGTVAAEELSLS |
JGIcombinedJ26739_1006552111 | 3300002245 | Forest Soil | MVTLVDVVTALVLIANVAPVAPAAIVTLEGALATD |
JGI25382J37095_100544934 | 3300002562 | Grasslands Soil | MVAEVDAVTALVVTVNVTLVAPTGTVTLAGTVAAVLSLDSV |
JGI25617J43924_100211254 | 3300002914 | Grasslands Soil | MLTVVDAGTALVLTVNVALVAPAATVTLEGTLATAVLLLESVTTAP |
JGI25617J43924_102749842 | 3300002914 | Grasslands Soil | MVTAVDAVTALVLTVKVALVAPAATVTLEGTLAAAVLLLE |
Ga0066672_100546411 | 3300005167 | Soil | MLTVVDAVTALVLTVNVALVAPAATVTLDGTVATDVSLLESATCAPPDG |
Ga0066683_100024758 | 3300005172 | Soil | VTGVEAVTELVLTENVALVAPAATVTLDATVAEPLLLERFTM |
Ga0066688_104261802 | 3300005178 | Soil | MVTGVDVATAVVLIVKVAVVLAAGTVTLEGTLAAALLLESATCAPP |
Ga0066685_104246021 | 3300005180 | Soil | VVDAATALVLTVNVALVAPAATVTLDGTLAAVVLLLESVT |
Ga0066678_106649071 | 3300005181 | Soil | MVTAVDAVTTLVLTVKVALAAPAGTVTLEGTVAAAVLLLESATCAPPA |
Ga0066675_106751391 | 3300005187 | Soil | VVDAETALVLTVNVALVAPAATVTMEGTVATDVSLLESATCAPPDG |
Ga0066675_111052621 | 3300005187 | Soil | MVTGVDAVTALVLTVNVALLAPAAIVTLAGALAAPLLLESSTCAPPVSAGPL |
Ga0070714_1006301111 | 3300005435 | Agricultural Soil | MTFRLKKVTVLVVTVNVALVPPAGMVTLEGTVATLVLLLLSVTRAPPLG |
Ga0066686_107530841 | 3300005446 | Soil | MVTELDAVTGLVLTVKVALVAPAGTITLEGTVATPVLLLESRTWAPPAGA |
Ga0066689_104636582 | 3300005447 | Soil | VTEADAVTVLVLTGRVALVAPAATVTLAGPVAADALLER* |
Ga0066681_100036381 | 3300005451 | Soil | MVTAVDAVTALVLTVKVALVAPAGTVTLEGTVAAAVLLLESVTCAP |
Ga0068853_1006665902 | 3300005539 | Corn Rhizosphere | MVTLLVVRTALVVTVKVAVVAPGATVTLGGTAATFDLLLES* |
Ga0066661_102247053 | 3300005554 | Soil | MLTVVDAVTALVLTVNVALVAPAATVTLDGTVATDVSLLE |
Ga0066661_102641732 | 3300005554 | Soil | MVTVVDAVTALVLTVNVALVAPAVTFTLEGTVATDVSLLESAT* |
Ga0066661_106005321 | 3300005554 | Soil | MVTAVDAVTALVLTLNVALVAPAATVTLEGTLAAVVLLLESVTCAPP |
Ga0066692_100154661 | 3300005555 | Soil | MVTVVDAVTALVLTVNVALVAPAVTVTLEGTVATDVSLLESAT* |
Ga0066692_101694341 | 3300005555 | Soil | MVTELDAVTGLVLTVKVALVAPAGTITLEGTVATP |
Ga0066707_106397701 | 3300005556 | Soil | MVTAVDAVTTLVLTVKVALAAPAGTVTLEGTVAAAVLLL |
Ga0066700_100562535 | 3300005559 | Soil | MVTVVDAVTALVFTGNVALVAPAGTATLEATLAAPLLLESATCAPPD |
Ga0066703_100033626 | 3300005568 | Soil | VTGVDVVTALVLTVNVALLAPAATVTLAGTVAVDVL |
Ga0066694_105527043 | 3300005574 | Soil | MVDAETVLVLTVNVALVAPAATVTLEGTVATNVSLLESATCAPPDGA |
Ga0066691_103672133 | 3300005586 | Soil | MLTVVDAATALVLIVNVALVAPAALVTLDGVLAAV |
Ga0066654_107558631 | 3300005587 | Soil | VDAATAVVLIVKVAVVLAAGTVTLEGTLAAALLLES |
Ga0066706_109256163 | 3300005598 | Soil | VTTVDVATALVLIVKVAVVLPAGTVTLAGTLADALLLER |
Ga0066651_106976991 | 3300006031 | Soil | MVTVVDAETALVLTVNVALVAPAATVTLDGTVATDVSLLESAT |
Ga0074060_105933092 | 3300006604 | Soil | MVTVVDAVTALVLTVNVALVAPAVTVTLEGTLAAAVLPLESATCAPPG* |
Ga0066658_101358851 | 3300006794 | Soil | MVTVADAVTALVRTVNVALVAPAATVTLEGTVATNVSLLESATCAPPD |
Ga0066658_102964031 | 3300006794 | Soil | MVTGVDVATAVVLIVKVAVVLAAGTVTLEGTLAAALLLESATCAPPA |
Ga0066658_109332781 | 3300006794 | Soil | VTRVDAATALVLTVKFALLLPAGTVTLEETLAAPLLL |
Ga0066659_105849311 | 3300006797 | Soil | MVTEVDVDTGFVLTVKLALVAPAATVTLDGTLATLVLLLD |
Ga0066660_106054963 | 3300006800 | Soil | VTTVDPATAPVLIVKVAVVLPAATVTLAGTLAEVLSLKRVTCAPPA |
Ga0066660_110944892 | 3300006800 | Soil | MVTVADAVTALVRTVNVALVAPAATVTLEGTVATNVSLLESATCAPPDG |
Ga0079220_101660063 | 3300006806 | Agricultural Soil | VTEVDTSTALVLTVKVAVVPPAETITLEGTCAAAALLLASMT* |
Ga0075428_1018050703 | 3300006844 | Populus Rhizosphere | VATVDAATGLTLIVKVVLSLPAGMVTLAGTLAAALLLESVTCAPAA |
Ga0075426_100220586 | 3300006903 | Populus Rhizosphere | MVTVVDAVTALVETLNVALVAPAATVTLDGTVATEVSLLESA |
Ga0099791_104341282 | 3300007255 | Vadose Zone Soil | VTSVDALTAVVVAVKVALVAPAGTVTLAGTLAAPGILLES* |
Ga0099791_105128992 | 3300007255 | Vadose Zone Soil | VVEITTALVLTVKDAVVAPAATVTLEGTVATDVLLLESAT* |
Ga0099793_100052531 | 3300007258 | Vadose Zone Soil | MVTVVDATTALVLTLNDALVAPAATVTLEGTLAAVVLLLESVTC |
Ga0099793_100598141 | 3300007258 | Vadose Zone Soil | MVTVVEAETALVLTVNVALVAPAATVTLAGTRATVVLLLESATC |
Ga0099793_102708073 | 3300007258 | Vadose Zone Soil | MVTDVEAVTLLVFTVNIALLAPAATVTLAGTVAAAVLSLERETAA |
Ga0099794_100094366 | 3300007265 | Vadose Zone Soil | VAGVEVVTAVVFTVNVALVAPAATVTLAGTVAADALLVR* |
Ga0099794_100094367 | 3300007265 | Vadose Zone Soil | VAGVEVVTAVVFTVNIALVAPAATVTLAGTVAADALLVR* |
Ga0099794_102251593 | 3300007265 | Vadose Zone Soil | MLTVVDASTTLVLTVNVALVAPAAIVTLDGVLATFVLL |
Ga0099794_102477141 | 3300007265 | Vadose Zone Soil | MVTGVELVTALVLTVKFALLAPPATVMLAGTLAAPLSLESCTC |
Ga0099794_103178741 | 3300007265 | Vadose Zone Soil | MVTVVDEATVVVFTGNVAVVAPAGTVTLGGALAAPL |
Ga0099794_104617312 | 3300007265 | Vadose Zone Soil | VIVTGVLAVTALVLTVKFALLAPAATVTLAGTVAALALLVR |
Ga0099794_106905611 | 3300007265 | Vadose Zone Soil | MVTVVAASTALVLTVNVALVAPAATVTLDGTLAAAVLL |
Ga0099794_107612601 | 3300007265 | Vadose Zone Soil | MVTGVDVVTALVLTVNVALLAPAATVTLAGTLAAPLLLVSSI* |
Ga0099829_101474632 | 3300009038 | Vadose Zone Soil | VIVTGVLAVTALVFTVKFALLAPAATGTLEGTVAAEALLERATAAP* |
Ga0099829_103874881 | 3300009038 | Vadose Zone Soil | MVTVPKAVTALVLTVNVALVAPAATVTLEGTLASVPWSI* |
Ga0099829_103909042 | 3300009038 | Vadose Zone Soil | VTEVDAVTLLVLTVKVALVAPVATLTLAGTVAADALLER* |
Ga0099829_104124241 | 3300009038 | Vadose Zone Soil | VIVAGVLAVTELVFTVKVALLAPPATDTLAGTVAAVALLERFTVTP* |
Ga0099829_105094984 | 3300009038 | Vadose Zone Soil | MLIVIDAATALVLTVNVALLAPAATVTLAGTLAAVVLL |
Ga0099829_108989351 | 3300009038 | Vadose Zone Soil | MVTGVEAVTAVVFTVNVALGAPAATVTLAGTVAADALLAR* |
Ga0099830_101372651 | 3300009088 | Vadose Zone Soil | VTDVDAVTLLVLTVKVALVAPAATVTLAGTVAADALLER* |
Ga0099830_103323291 | 3300009088 | Vadose Zone Soil | VIVTGVEALTALVLTVKFALLPPAATVTLAGTVAAGALLERFTVLP* |
Ga0099830_103474532 | 3300009088 | Vadose Zone Soil | VIVAGVLAVTELVFTVKVALLAPPATDTLAGTVAADALLERFTVPP* |
Ga0099830_107508551 | 3300009088 | Vadose Zone Soil | MVIGVDAVTALVFTVNVALVAAAGTPMVFGTVAADALLER* |
Ga0099830_108613931 | 3300009088 | Vadose Zone Soil | METVVDAATALVLTVKDALVAPAATVTLERTLATVVSLLESV |
Ga0099830_112071931 | 3300009088 | Vadose Zone Soil | VTDVDAVTLLVLTVKVALVAPVATLTLAGTVAADALLER* |
Ga0099828_104313793 | 3300009089 | Vadose Zone Soil | VTVTDVDAVTLLVLTVKVALVAPVATLTLAGTVAADALLER* |
Ga0099827_106109372 | 3300009090 | Vadose Zone Soil | VTVTEVDAVTLLVLTVKVALVAPAATVTLAGTVAADALLER* |
Ga0099827_109447101 | 3300009090 | Vadose Zone Soil | VIVAGVLAVTELVFTVKVALLAPLATVTLAGTVAAVALLERFTVTP* |
Ga0099792_102285323 | 3300009143 | Vadose Zone Soil | MTGVLAVTALVFTVKFALLAPPATVTLAGTVAADALLERSTGTP* |
Ga0099792_106410563 | 3300009143 | Vadose Zone Soil | MVTEVDAVTALVFTGKVALVAPAGTATLEGTLAAPLLLESATCAP |
Ga0075423_129602171 | 3300009162 | Populus Rhizosphere | VATVDAATGLVLIVKVVLALPAGMVTLAGTLAAALLLESVTW |
Ga0116229_115872641 | 3300009500 | Host-Associated | VLVETAAVETVKVALVAPYATVTELGTVAEPLLLARETE* |
Ga0126313_101906844 | 3300009840 | Serpentine Soil | MVTDVEVLSDAVLTVNVALKAPAGTVTLAGTVAALVLLLDSVTTAP |
Ga0127445_10074614 | 3300010085 | Grasslands Soil | MVTKVDVPTGLVLNVKVAVLAPLRTVTLDGTLATLGLLLERDT |
Ga0134082_103509361 | 3300010303 | Grasslands Soil | VTGVDVVTALVLTVNVALLAPAATVTLAGTVAVDVLLLV |
Ga0134082_105181951 | 3300010303 | Grasslands Soil | MVTGVDEVTTLVVTVNVALVALGGTVTLLGTVAAALL |
Ga0134086_103481871 | 3300010323 | Grasslands Soil | MVTGVDAVTALVLTVNVALLAPAAIVTLAGALAAPLLLES |
Ga0134064_100159691 | 3300010325 | Grasslands Soil | MVTGVDAVTALVLTVNVALLAPAAIVTLAGTLAAP |
Ga0134062_102426353 | 3300010337 | Grasslands Soil | MVTGVDAVTVLVLTVNVALLAPETTVTLAGTVAVDVLLERETGMPPL |
Ga0126378_108916441 | 3300010361 | Tropical Forest Soil | VTAVEAPTALVLTVKVALVAPAATVTLEGTRATAVLL |
Ga0134066_100048143 | 3300010364 | Grasslands Soil | MVTGVDVVTALVVTVNVALLAPAATVTLAGTVAVDVL |
Ga0126383_100347585 | 3300010398 | Tropical Forest Soil | MLAGVDEATAVVLIVKVALLLPDGTVTLEGTLAAALLLESTT* |
Ga0126383_108346531 | 3300010398 | Tropical Forest Soil | VDAVTAVVLIEKFAPSAPARTVTLAGTVATVVLLLDNVTMAPPIG |
Ga0137391_100360141 | 3300011270 | Vadose Zone Soil | MLTVVDAATALVLTVNVALVAPAATVTLDGTLAAAVLLLD |
Ga0137391_102395402 | 3300011270 | Vadose Zone Soil | VTEVDAVTLLVLTVKVALVAPAATVTLAGTVAADALLER* |
Ga0137391_107675371 | 3300011270 | Vadose Zone Soil | VLAVTELVFTVKVALLAPLATDTLAGTVAADALLERFTVTP* |
Ga0137393_108381551 | 3300011271 | Vadose Zone Soil | VIVTGVLAVTALVPTVKFALLAPAATVTLAGTVAAEAL |
Ga0137393_111190181 | 3300011271 | Vadose Zone Soil | MVTVVDAVTALMFTGNVALVAPAGTATLEGTLAAPL |
Ga0137393_117725101 | 3300011271 | Vadose Zone Soil | VIVTGVLAATELVLTVKVALLTPSATATLTGTVAADAL |
Ga0137388_103570831 | 3300012189 | Vadose Zone Soil | VTDVLVVTALVFTVKFALVAPAARGTVEGTLAAPLSL |
Ga0137364_101028441 | 3300012198 | Vadose Zone Soil | VDAVTALVLTVNVALLAPAAIVTLAGTLAAPLLLESSTCAPPVSAG |
Ga0137383_102709573 | 3300012199 | Vadose Zone Soil | MVTVVDEATALVLTVNVALVAPASIVTLRDTLAGPLLLESATCAPPVG |
Ga0137383_108532152 | 3300012199 | Vadose Zone Soil | VAEIVTAVEIATGLLVMVKVAVLAPAATRTLAGTVAAA |
Ga0137382_107576501 | 3300012200 | Vadose Zone Soil | VTAVDLVTALVPTVNVALVAPAGTGTLVSILATAVLLLESGAPPAGAG |
Ga0137363_100058382 | 3300012202 | Vadose Zone Soil | VIVTGVLAVTAPVLTVKFALLAPAATVTLAGTVAALALLVRFTMTAL* |
Ga0137363_100339781 | 3300012202 | Vadose Zone Soil | VAPPKDAEMVTVVDEATALVLAVNVALVAPATTVTLDGVLAAV |
Ga0137363_102941181 | 3300012202 | Vadose Zone Soil | VIVTGVLAVTELVFTVKVALLAPLATDTLAGTVAADALLERFTVTP* |
Ga0137363_105029302 | 3300012202 | Vadose Zone Soil | MVTGVEVVTALVLTVKFALVAPAATVTLAGTVAAEALLER |
Ga0137363_111843611 | 3300012202 | Vadose Zone Soil | VTGVELVTALVLTVKVALVAPAATVTLAGIVAAVALLER* |
Ga0137363_111974551 | 3300012202 | Vadose Zone Soil | MITGVETVTALVLTVNVALLAPAATVTLAGTLAAPLLL |
Ga0137363_113847321 | 3300012202 | Vadose Zone Soil | VIVTGVEAPTALVLTVKLALLAPPATVTLAGTVAADALLER |
Ga0137363_113847322 | 3300012202 | Vadose Zone Soil | MLTGVDVVTALVVTVKFALLAPAATVTLAGTLAAALSLESNT* |
Ga0137399_100844272 | 3300012203 | Vadose Zone Soil | MVTGVDAVTALVFTVNVALVAPAATATLLGTVVADALLER* |
Ga0137399_102768151 | 3300012203 | Vadose Zone Soil | MLTVVDASTVLVLTVNVALVAPAAIVTLDGVLATFVLLLESVTT |
Ga0137399_106506853 | 3300012203 | Vadose Zone Soil | MVTEVDAATALVLTVNVALVAPAATVTLEGTLAAVVLLLERVTCAP |
Ga0137399_106755294 | 3300012203 | Vadose Zone Soil | MVTVVDEATALVLTTNVALVAPAATITLEGTLAGVVLLLESTTC |
Ga0137399_110814141 | 3300012203 | Vadose Zone Soil | MVTGVEAVTLLVLTVNVALLAPAVTVTLAGTVAAVALLER* |
Ga0137399_115675481 | 3300012203 | Vadose Zone Soil | MVTGVELATALVVTLKVALVAPAATVTLPGTVAAAL |
Ga0137374_106798641 | 3300012204 | Vadose Zone Soil | MVTEVALLTLTVLTVKVAVVLPAGTVTLAGTAATLLLLLLRLTLTP |
Ga0137362_101463074 | 3300012205 | Vadose Zone Soil | MVTVVDAATALELTVNVALVAPAATVTLEGTLATAVLLLERVT* |
Ga0137362_101823723 | 3300012205 | Vadose Zone Soil | VEVVTALVVTVNVALVAPAGMVKLEGTLAAPLSLVSSTCA |
Ga0137362_102964291 | 3300012205 | Vadose Zone Soil | MVTAVDAVTALVLTVKVALVAPAATVTLEGTLAAAVLLLESAT |
Ga0137362_103687282 | 3300012205 | Vadose Zone Soil | VTVTEVDAVTVLVLTVKVALVAPVATLTLAGTVAADPLLER* |
Ga0137362_105768061 | 3300012205 | Vadose Zone Soil | MMTGVDVVTAVVFTMNVALLAPAAIVTLAGTLAAPLLLESSTCAPPVS |
Ga0137362_105931641 | 3300012205 | Vadose Zone Soil | VTVVDAATALVLTVNVAVVAPAATVTPDGTVAAAVL |
Ga0137362_109995931 | 3300012205 | Vadose Zone Soil | MVIGVEAVTALVFTVDVALVGAAGTPTVLGTVAADALLER* |
Ga0137362_111938221 | 3300012205 | Vadose Zone Soil | MVTAVDAVTALVLTVKVALAAPAATVTLDGTLAAAVLLLESVT* |
Ga0137381_101414082 | 3300012207 | Vadose Zone Soil | VTLVEFDTLLVLTVNVALAEPAATVTVDGTDATDELLLERF |
Ga0137381_102956991 | 3300012207 | Vadose Zone Soil | MLTVVDVATALVLTVNVALVAPAATVTLGGTLATAVLLLERVT* |
Ga0137376_102224211 | 3300012208 | Vadose Zone Soil | MVTGVDAVTALVLTVNVALLAPETTVTLAGTVAVDVLLERET |
Ga0137377_106942491 | 3300012211 | Vadose Zone Soil | MVTAVDAVTALVLTVNVALVTPAATVTLEGTRAAPLLLESATVAPPAGAA |
Ga0137377_108321653 | 3300012211 | Vadose Zone Soil | MVTGVDAATAVVLIVKVAVVLAAGTVTLEGTLAAALLLESATC |
Ga0137370_100472341 | 3300012285 | Vadose Zone Soil | MVTGVDAATALVLIVKVAVVLAAGTVTLEGTLAAALLLES |
Ga0137370_106332291 | 3300012285 | Vadose Zone Soil | MVTGVDAVTALVLAVNVALLAPAATVTLAGTVAAAVL |
Ga0137387_102036812 | 3300012349 | Vadose Zone Soil | VTVTEVDAVTVLVLTVKVALVAPTATVTLAGTVAADALLER* |
Ga0137386_100599541 | 3300012351 | Vadose Zone Soil | MAAAVVSFTTLVLTVKVVLVAPAGTGTLEGTVASAVF |
Ga0137386_101443801 | 3300012351 | Vadose Zone Soil | MVTEVDEPTALVLTVKLALVAPAATVTLAGTVATPVLLLDRL |
Ga0137384_105298391 | 3300012357 | Vadose Zone Soil | VTDVDAVTLLVLAVKVALVAPVATLTLSGTVAADALLER* |
Ga0137360_101951051 | 3300012361 | Vadose Zone Soil | MVIGVEAVTALVFTVNVALVAAAGTPTVLGTVAADALLER* |
Ga0137360_104015961 | 3300012361 | Vadose Zone Soil | MVTVVDATTGLVLTVNVTLLAPAAIVTLEGTRATNVLLLES |
Ga0137360_104622074 | 3300012361 | Vadose Zone Soil | MVTVVDEATVVVFTGNVAVVAPAGTVTLGGALAAPLLLES |
Ga0137360_106534921 | 3300012361 | Vadose Zone Soil | VTVTEVDAVTVLVLTVKVALVAPVATLTLAGTVAADALLER* |
Ga0137360_106809962 | 3300012361 | Vadose Zone Soil | VIVTGVLAVTALVFTVKFALLAPAATGTLEGTVAAEALLERSTVAP* |
Ga0137360_107243391 | 3300012361 | Vadose Zone Soil | MMTGVDVVTAVVFTMNVALLAPAAIVTLAGTLAAPLLLESSTCA |
Ga0137360_109336861 | 3300012361 | Vadose Zone Soil | MVTGVEMVTALVLTVKAALLAPARTVTLEGTLAATL |
Ga0137360_117131631 | 3300012361 | Vadose Zone Soil | MVTGVDVVTALVLTVNVALLAPAATVTLAGTVAVDVLLLERETAA |
Ga0137361_102982071 | 3300012362 | Vadose Zone Soil | VIVTGVEVLTALVLTVKFALLAPLAIVTLAGTVAAEALLERFTLAP* |
Ga0137361_110342031 | 3300012362 | Vadose Zone Soil | MVTEVDAVTGLVFAVNVALVAPAGTATLEGTLAAPLLLERATC |
Ga0137390_106015951 | 3300012363 | Vadose Zone Soil | VTVTEVDAVTLLVLTVKVALVAPAATVTLAGTVAVDALLER* |
Ga0137390_106077912 | 3300012363 | Vadose Zone Soil | VTEVDAVTLLVLTVKVAVVAPAATVTLAGTVAADALLER* |
Ga0137390_119761181 | 3300012363 | Vadose Zone Soil | MAPYVPEIVTAPEAQAVVDTVKFALAAPAVCVTLAGTVAIAVLLLESATVAPPVG |
Ga0137358_100835541 | 3300012582 | Vadose Zone Soil | MVTVVEAATALVLTVNVALVAPAATVTLGGVLATVVLL |
Ga0137358_104218921 | 3300012582 | Vadose Zone Soil | VEIATVVDAVTALVLTVRDALVAPAATVTLEGTVAAAVLPLESVTVAPPAG |
Ga0137358_108670363 | 3300012582 | Vadose Zone Soil | MVTGVDAVTALVLTVNVALLAPETTVTLAGTVAVDVLL |
Ga0137358_110092501 | 3300012582 | Vadose Zone Soil | MVTVVDEATALVLTTNVALVAPAAIVTLGGMLAAPLL |
Ga0137398_100710891 | 3300012683 | Vadose Zone Soil | VIVTGVLAVTALVLTVKFALLAPAATVTLAGTVAAEA |
Ga0137398_110657233 | 3300012683 | Vadose Zone Soil | MVTVVDEATVVVFTGNVAVVAPAGTVTLGGALAAPLLLESA |
Ga0137397_101257121 | 3300012685 | Vadose Zone Soil | VIVTGVPAVTALVLTVKFALLAPAATVTLAGTVAAEALLVRFTMTAL* |
Ga0137397_104566021 | 3300012685 | Vadose Zone Soil | VTGVELVTALVLTVNVALLAPAATVTLAGTVAAVALLER* |
Ga0137397_113422491 | 3300012685 | Vadose Zone Soil | VVDEATALVVTANVALVAPAAIVTPGGTLAAPLLLESATCAPPVGA |
Ga0157569_10616692 | 3300012691 | Freshwater | VPVIVAVVFVETGRVLTVNVALVAPATTTTLAGTV |
Ga0137395_110884201 | 3300012917 | Vadose Zone Soil | MVTVVDEATALVLTTNVALVAPAAIVTLGGMLAAPLLLESATCAPPV |
Ga0137395_111255411 | 3300012917 | Vadose Zone Soil | MVDEATALVLTTNVALVAPAAIVTLGGMLAAPLLLESATC |
Ga0137396_103443601 | 3300012918 | Vadose Zone Soil | MVTVVDAVTAIVFTGNVALVAPAGTATLEGTLAAPLLL |
Ga0137396_104907732 | 3300012918 | Vadose Zone Soil | VIVTGVLAVTALVLTVKFALLAPAATVTLAGTVAAEALLVRFTMTAL* |
Ga0137396_105270802 | 3300012918 | Vadose Zone Soil | VTGVEVVTAPVCTVKFALVAPAGTATLEGTLAAPLLL |
Ga0137396_105598161 | 3300012918 | Vadose Zone Soil | MVTGVETVTALVVTVNVALLAPAAIVTLAGTLAATLSLLSSTCAP |
Ga0137396_109144613 | 3300012918 | Vadose Zone Soil | MVTMVDAVTALVFTGNVALVAPAGTTTLEGTLAAPLLLES |
Ga0137396_109878592 | 3300012918 | Vadose Zone Soil | VTVLDAMTALVLTVKVVLVAPAGTITLEGTLAAPGLLLESAT |
Ga0137394_100504446 | 3300012922 | Vadose Zone Soil | MVAGVDVVTALVLTVNVALLAPAATVTLAGTAAVDALLES* |
Ga0137394_101248501 | 3300012922 | Vadose Zone Soil | VVDAATALVLTVNVAVVAPAAAVTLDGTVAAAVLLLESATV |
Ga0137394_114471662 | 3300012922 | Vadose Zone Soil | MVTGVEVVTALVLTVKFVLVAPAATVTLAGSVAAEALLERE |
Ga0137359_1003004012 | 3300012923 | Vadose Zone Soil | MMTGVDAATALVLTVKVVLVAPAATVTLDGTLATVVLLLESVT |
Ga0137359_105577811 | 3300012923 | Vadose Zone Soil | MVTGVDAVTALVLTVNVALLAPAATVTLAGIVAAVALLER* |
Ga0137359_105716211 | 3300012923 | Vadose Zone Soil | MVTVVEAETALVLTVNVALVAPAATVTLAGTRATVVLLL |
Ga0137359_110689573 | 3300012923 | Vadose Zone Soil | MVTDVEAATTLVVIVNVALVAPAGTVTLPDTVAAELLLD |
Ga0137413_100422051 | 3300012924 | Vadose Zone Soil | MLTVVDASTALVLTVNVALVAPAATVTLEGVLATLVLLLESVTTAPPAG |
Ga0137413_100914694 | 3300012924 | Vadose Zone Soil | VTVVEPETALVLTVNVALVAPAATVTLAGTRATVVLLLES |
Ga0137413_104764911 | 3300012924 | Vadose Zone Soil | MVTEVDAITALVATVNVALVAPAATVTLAGVLATVV |
Ga0137413_107112521 | 3300012924 | Vadose Zone Soil | VTGVLAVTVLVVTVKFALLAPAATVTLAGTVAAEALLVRFTVAAV* |
Ga0137413_108131621 | 3300012924 | Vadose Zone Soil | VIVTGVLAVTAMVLTVKFALLAPAATVTLAGTVAAEALLVRLTMVAL* |
Ga0137413_108692872 | 3300012924 | Vadose Zone Soil | VIVTGVLAVTALVLTVKFALLAPAGTVTLAGTVAAEALLVRLTMVAL* |
Ga0137419_103748391 | 3300012925 | Vadose Zone Soil | VTGVELVTALVLTVKVALLAPAVTVTLAGTVAAVALLER* |
Ga0137419_105063353 | 3300012925 | Vadose Zone Soil | MVTVVDAVTALVFTGKVALVAPAGTATLEGTLAAPLLLESATCAP |
Ga0137419_105440811 | 3300012925 | Vadose Zone Soil | MVTGVDAVTALVFTVNVALVAPAATATLLGTVVADALLER |
Ga0137419_107041421 | 3300012925 | Vadose Zone Soil | MVTGVDAATALVLIMKFALLLPAGTVTLEGERRVCR* |
Ga0137419_107808571 | 3300012925 | Vadose Zone Soil | VDAVTTLVLAVNVAVVAPAATVTLAGTRATLVLLLE |
Ga0137419_110875921 | 3300012925 | Vadose Zone Soil | MVTMVDAVTALVFTGNVALVAPAGTATLEGTLAAPLLL |
Ga0137419_115498402 | 3300012925 | Vadose Zone Soil | AEIVAGVEVVTALVFTVKVALVAPAATVTLAGTVAADALLAR* |
Ga0137416_100052562 | 3300012927 | Vadose Zone Soil | MVTVVDVLTALVLTGKVALVAPAGTVTLDGTLAAPLLLESVA* |
Ga0137416_106518732 | 3300012927 | Vadose Zone Soil | VVDAVTALVLTVKVALVAPAATVTLAGTVAADALLVR* |
Ga0137416_110493531 | 3300012927 | Vadose Zone Soil | MVTEVDAVTGLVFAVNVALVAPAGTVTLEGTLAVPLL |
Ga0137416_111982261 | 3300012927 | Vadose Zone Soil | MVTVVDAATALVLTVNVALVAPAATVTLGGTVAAAVLLLE |
Ga0137416_112251963 | 3300012927 | Vadose Zone Soil | MVTMVDAVTALVFTGNVALVAPAGTATLEGTLAAPLLLE |
Ga0137416_112708711 | 3300012927 | Vadose Zone Soil | MVTVVDAVTALVFTGNVALVAPAGTATLEGTLAAPLLLES |
Ga0137416_113994723 | 3300012927 | Vadose Zone Soil | VAVVDVATALVFTGKVAVVAPAGTVTLAETVAATLLLESVTCANRAGAGRC |
Ga0137416_115578511 | 3300012927 | Vadose Zone Soil | MVTGVDAVTALVLTVNVALLAPAAIVTLAGTVAVDVLLLERE |
Ga0137404_102318842 | 3300012929 | Vadose Zone Soil | VIVTGVLAVTALVLTVKFALLAPAATVTLAGTVAGEALLVRLTMVAL* |
Ga0137404_103147151 | 3300012929 | Vadose Zone Soil | VVDAATALVLTVKVALVAPAGTVTLEGTLAAPLLLE |
Ga0137404_108282553 | 3300012929 | Vadose Zone Soil | MVDEATALVLTTNVALVAPAAIVTLGGMLAAPLLLESATCAPPVGA |
Ga0137410_100225911 | 3300012944 | Vadose Zone Soil | MVTGVEVVTALVLTVKFALVAPAATVTLAGTVAAEALLE |
Ga0137410_102696651 | 3300012944 | Vadose Zone Soil | VTGVELVTALVLTVKVASLAPAVTVTLAGTVAAVALLER* |
Ga0137410_105933431 | 3300012944 | Vadose Zone Soil | MVAGVDVVTALVLTVNVALLAPAATVTLAGTAAVDALLER* |
Ga0137410_110282751 | 3300012944 | Vadose Zone Soil | VVDAVTGLVLTVKVAVVAPAGTATLEGTLAAPLLLES |
Ga0137410_110296731 | 3300012944 | Vadose Zone Soil | MVTVVDEATALVLTTNVALVAPAAIVTLGSTLAAPLLLESAT |
Ga0137410_110876433 | 3300012944 | Vadose Zone Soil | MVTAVNAATALVLTVNVALVAPATTVTLEGTVAAAVLLLESATCA |
Ga0164301_111171642 | 3300012960 | Soil | MVTGVEEETALVLTVKFAVAAPEATLTLAGTVAAEALLVR* |
Ga0126369_109793393 | 3300012971 | Tropical Forest Soil | MVTAVEVDTVLVLTVKVALVLPAATVTLAGTLAAPLLLDSATCA |
Ga0126369_110150212 | 3300012971 | Tropical Forest Soil | MPLIVTEVSLETALVVMVKGAVVAPAATVTLAGT* |
Ga0134077_100783512 | 3300012972 | Grasslands Soil | VTEADAVTVLVLTVKVALVAPAATVTLAGTVAADALLER* |
Ga0134081_100300062 | 3300014150 | Grasslands Soil | MVTVVDAVTALVLTVNVALVAPAVTFTLEGTVATDVSLL* |
Ga0181519_102777743 | 3300014658 | Bog | MVTGVAVATLDVWIVKVALVAPAATETAPGTVAQGLLDA |
Ga0137411_10061145 | 3300015052 | Vadose Zone Soil | MVIGVETATAKVVTGNVALVAPGGMVTLEGTLAAPLLLESRTCAPL |
Ga0137411_11059211 | 3300015052 | Vadose Zone Soil | MVTGVEVVTALVLTVKFALVAPAATVTLAGTVAVPQKHC |
Ga0137411_12110163 | 3300015052 | Vadose Zone Soil | MVTVVDEATALVLTTNVALVAPAAIVTLGGMLAAPLLLE |
Ga0137405_10074128 | 3300015053 | Vadose Zone Soil | MVTVVDAATALELTMNVALVAPAATVTLEGTLATAVLLLERVT* |
Ga0137420_12262004 | 3300015054 | Vadose Zone Soil | MVTVVDATTGLVLTVNVALLAPAVIVTLEGTRATSVLLLESATC |
Ga0137420_13470651 | 3300015054 | Vadose Zone Soil | MVTEVVAGTEVVLTVKVALLAPAAMPTLAGTVAADVLLLERVTTTA |
Ga0137420_13596701 | 3300015054 | Vadose Zone Soil | MVTGVDVVTALVLTVNVALLAPAATVTLAGTVAVAVLLLESERLRRQ* |
Ga0137420_13944264 | 3300015054 | Vadose Zone Soil | MVTVVDAATALVFTGNVALVAPAGTVTLEGTLAAHCY* |
Ga0137420_13957461 | 3300015054 | Vadose Zone Soil | VDAATALVLIVKVAVVLAAGTVTVEGTLAAALLLESELARHC |
Ga0137420_14497182 | 3300015054 | Vadose Zone Soil | MVTEVDAVTGLVFAVNVALVAPAGTATLEGTLAAPLL* |
Ga0137420_14698322 | 3300015054 | Vadose Zone Soil | VVDAVTGLVLTVKVAVVAPAGTATLEGTLVARCY* |
Ga0137418_100506771 | 3300015241 | Vadose Zone Soil | VIVTGVDAPTALVVTLKLALAAPAATVTLAGTVATGPLLES |
Ga0137418_101344051 | 3300015241 | Vadose Zone Soil | MVTGVDAVTALVLTVNVALLAPAAIVTLAGTLAAPLLLESSTCAPPVSAGPL |
Ga0137418_101445681 | 3300015241 | Vadose Zone Soil | MVTVVDAVTALVFTGNVALVAPAGTATLEGTLAAPLLLESA |
Ga0137418_103293332 | 3300015241 | Vadose Zone Soil | VIVTLVDTSTKPVLTVNVALVAPAGTVTLEGTEAADGLLLERATT |
Ga0137418_111135641 | 3300015241 | Vadose Zone Soil | MATVVDEATILVLTTNVALVAPPPIVTLDGTLAAVVLLLESAICAP |
Ga0137412_100343155 | 3300015242 | Vadose Zone Soil | MLTVVDASTALVLTVNVALVAPATTVTLDGVLATFV |
Ga0137409_100574961 | 3300015245 | Vadose Zone Soil | MVTVVDAVTALVFTGNVALVAPAGTATLEGTLAAP |
Ga0137403_100782291 | 3300015264 | Vadose Zone Soil | MVTGVEVVTALVLTVKFALVAPAATVTLAGTVAAE |
Ga0137403_102163882 | 3300015264 | Vadose Zone Soil | VIVTGVLAVTALVLTVKFALLAPAATVTLAGTVAAEALLVRPTMVAL* |
Ga0137403_103605733 | 3300015264 | Vadose Zone Soil | MVTGAEAVTVLVLTVKVELLAPAATVTLAGTVAAAVLSL |
Ga0132257_1027730043 | 3300015373 | Arabidopsis Rhizosphere | VTIGVTTATTGVVVTVNVFEVIPAGMVTLAGTVAAEALL |
Ga0190272_108300333 | 3300018429 | Soil | VLDVTALVATAKVALVAPAATVTPAGTETDVLLLE |
Ga0066655_106713402 | 3300018431 | Grasslands Soil | MVTEVVVDTGLVLTVKVALVALPGTVTLAGTVATLVLLLERATKTGRAS |
Ga0066667_1000021917 | 3300018433 | Grasslands Soil | MVTVVDAVTALVLTVNVALVAPAVTFTLEGTVATDVSLLESAT |
Ga0066669_100823981 | 3300018482 | Grasslands Soil | MVTGVDAVTALVLTVNVALLAPAAIVTLAGALAAP |
Ga0066669_105703523 | 3300018482 | Grasslands Soil | MVTGVDAVTALVLTVNVALLAPAAIVTLAGTLAAPLLLE |
Ga0187798_178266915 | 3300019275 | Peatland | AVAEIVDVVPLDTELVVTVNVAVVAPAATVTLAGT |
Ga0190264_110921331 | 3300019377 | Soil | LLATALVPMLKLALVAPAGTVTVEGIEVAPLLSES |
Ga0137408_13244031 | 3300019789 | Vadose Zone Soil | MVAEVDAVTALVVTVNVTLVAPTGTVTLAGTVAAELLLDS |
Ga0137408_14856758 | 3300019789 | Vadose Zone Soil | VVDAATALVLTVNVALVAPAATSHSRHLAALVLLLESATCAPPEGPAR |
Ga0179594_100056461 | 3300020170 | Vadose Zone Soil | VVDEATALVVTANVALMAPAAIVTLGDTLAAPLLLESAT |
Ga0179594_102302443 | 3300020170 | Vadose Zone Soil | MVTALDAVTTLVLTVKVALVAAAGTVTLEGTVAAAVLLLES |
Ga0179592_102122601 | 3300020199 | Vadose Zone Soil | MVTVVEAETALVLTVNVALVAPAATVTLAGTRATVVL |
Ga0179592_104051091 | 3300020199 | Vadose Zone Soil | VTGVLAVTALVLTVKFALLAPAATVTLAGTVAAVAL |
Ga0210403_102590331 | 3300020580 | Soil | VTGVATVTELEVTVNVAEVAPAATVTLAGTVAADALLERTTT |
Ga0210399_108976841 | 3300020581 | Soil | VVDAATALVLTVNDALVAPAATVTLEGTLATVVLLLERATCA |
Ga0179596_106274543 | 3300021086 | Vadose Zone Soil | MTTLVEEATALVLTANVVLVAPAATVTLAGTLAAVVLLLESATC |
Ga0179584_11990031 | 3300021151 | Vadose Zone Soil | MLTVVDASTTLVLTVNVALVAPAATVTLEGVLATLVLLLESV |
Ga0210400_104051023 | 3300021170 | Soil | VTDVEAGTLVVLTVKVALLAPAATVTLAGTVAAAALLER |
Ga0210400_106465671 | 3300021170 | Soil | VVDAATALVLTVNVAVVAPAATVTLEGTLATVVLLLVSAT |
Ga0210394_102059641 | 3300021420 | Soil | VLTVLVLTMNDVLVAPAATVTLEGTLAAAVLLLESVT |
Ga0210409_111233591 | 3300021559 | Soil | MVADVATVASAVLTVKVALVAPAATVTLAGTVARAVLLLVSVTTAPPE |
Ga0210409_116501412 | 3300021559 | Soil | VTGVATVTELEVTVNVAEVAPAATVTLAGTVAADALLE |
Ga0179589_100286541 | 3300024288 | Vadose Zone Soil | MVTGVDAVTALVLTVNVALLAPAATVTLAGTVAVDVLLL |
Ga0137417_10720752 | 3300024330 | Vadose Zone Soil | MVTGVEMVTALVLTVKVALLAPARTVTLEGTLAATLLLESITCAPPVG |
Ga0137417_12326082 | 3300024330 | Vadose Zone Soil | MLTVVDASTALVLTVNVALVAPAAIVTLDGVLATFVLLL |
Ga0137417_13379614 | 3300024330 | Vadose Zone Soil | MVTEVVAATELVLTVKVALLAPAGMFTLAGMVAATVLLLERVTTAR |
Ga0137417_14970672 | 3300024330 | Vadose Zone Soil | VTVVETVTLLVLTVNVALLDPAKTVTLAGTLAARCHW |
Ga0255268_10145834 | 3300024572 | Freshwater | MVAVVAALTEAVVTVNVAVDAPAATVTLAGTTADALLLDKLT |
Ga0209751_109945861 | 3300025327 | Soil | MVAEVKAPTAMVLTGKLAVVAPAATVTLAGTVAAAL |
Ga0207700_118202361 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IIAVVEVVTALVETVNVALVAPPATLTLAGTLAAAG |
Ga0207665_108446941 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTGVDVVTALVVTVNVALLAPAATVTLESTFAPALLLESNTCAPPAS |
Ga0209236_12830061 | 3300026298 | Grasslands Soil | MATEVDDDTGLVLTVKVALVTPAGTVTPEGTLAAAGLLLESRIW |
Ga0209027_12862101 | 3300026300 | Grasslands Soil | VVDVITALVLTVKLAVVAPAATVTLAGPRAAPVLLLES |
Ga0209240_12468191 | 3300026304 | Grasslands Soil | VTGVLAVTAVVFTVKVALVAPLATVTLAGTVAAEALLERDTTAP |
Ga0209055_11385733 | 3300026309 | Soil | MVTGVDVATAVVLIVKVAVVLAAGTVTLEGTLAAALLLESATCAPPAGA |
Ga0209239_10293184 | 3300026310 | Grasslands Soil | MVTGVDVVTALVVTVNVALLAPAATVTLESTLAATL |
Ga0209155_11939993 | 3300026316 | Soil | MVTGVDAVTALVLTVNVALLAPAAIVTLAGALAAPLLLE |
Ga0209154_12643161 | 3300026317 | Soil | VTGVEAVTELVLTENVALVAPAATVTLDATVAEPLLLERFT |
Ga0209647_10982841 | 3300026319 | Grasslands Soil | VTVVDVITALVLTVKLAVVAPAATVTLAGTRAAPV |
Ga0209152_103936372 | 3300026325 | Soil | MVTAVDAVTALVLIVNVALVAPAATVTLEGTVAAA |
Ga0209802_10104386 | 3300026328 | Soil | MVTVVDAVTALVLTVNVALVAPAVTVTLEGTVATDVSLLESATC |
Ga0209267_12435333 | 3300026331 | Soil | MVTGVDVVTALVLTVNVALLAPAATVTLAGTVAVDVLL |
Ga0209377_10984493 | 3300026334 | Soil | MLTVVDAVTALVLTVNVALVAPAATVTLEGTLATTVLLLERVT |
Ga0209377_13283361 | 3300026334 | Soil | MVTVVDAVTALVLTVKVALVAPAATVTLGGTLAAVVL |
Ga0257176_10013711 | 3300026361 | Soil | MVTMVDAVTALVFTGKVALVAPAGTATLEGTLAAPLLLESAT |
Ga0257176_10869342 | 3300026361 | Soil | VTGVDAVTVLVLTVNVALLAPAATVTLAGTVAAAVLSLIRET |
Ga0257146_10229261 | 3300026374 | Soil | VDAVTTLVLAVNVALVAPAATLTLAGTRATLVLLLESAI |
Ga0257146_10825332 | 3300026374 | Soil | MVTDEEAVTLLVLTVNVALLAPAATVTFAGTVAAAV |
Ga0209807_11689321 | 3300026530 | Soil | MVTGVDVATAVVLIVKVAVVLAAGTVTLEGTLAAALLLE |
Ga0209157_10406221 | 3300026537 | Soil | MVTEVVVDTGLVLTVKVALVALPGTVTLAGTVATLVLL |
Ga0209376_11295394 | 3300026540 | Soil | MVTGVDAATAVVLIVKVAVVLAAGTVTLEGTLAAALLLES |
Ga0209805_12974722 | 3300026542 | Soil | MVTVVDAVTALVLTVNVALVAPAVTVTLEGTVATDVSLL |
Ga0209648_100796651 | 3300026551 | Grasslands Soil | VTGVEALTALALTVKFALLAPLATVTLLGTVAADALLERSTVT |
Ga0209648_101803351 | 3300026551 | Grasslands Soil | MVTVVDEATALVLTTNVALVAPAATVTLESTLAAVVLLL |
Ga0209648_108095881 | 3300026551 | Grasslands Soil | MVTGVELATALVLTVNVALLLPAATVTLAGTAAADALLVR |
Ga0209577_102168761 | 3300026552 | Soil | MVATVDAATGLVLTVKVVLVLPAGTVTLAGTPAAALLLESVTSAPAVGAGPL |
Ga0179593_11342616 | 3300026555 | Vadose Zone Soil | MVTDEEAVTLLVLTVNVALLAPAATVTFAGTVAAAVLPLERETVAPPLGAGR |
Ga0179593_12045151 | 3300026555 | Vadose Zone Soil | VVDAVTALVLTVNDALVAPAATVTLEGTLAAAVLLLV |
Ga0179587_106958591 | 3300026557 | Vadose Zone Soil | VTAVDAETALVATVNAALVAPAAIVTLAGTLATVVL |
Ga0179587_108107953 | 3300026557 | Vadose Zone Soil | MVTAVDAVTALVLTVNVALVAPATTVTLEGTLAAVLL |
Ga0209076_10154571 | 3300027643 | Vadose Zone Soil | MLTVVDAATALVPTVNVALVAPAATATLDGTLAAAVL |
Ga0209076_11510721 | 3300027643 | Vadose Zone Soil | MVTDVEAVTLLVFTVNIALLAPAATVTLAGTVAAAVLSLERE |
Ga0209076_12213531 | 3300027643 | Vadose Zone Soil | MVTVVDATTGLVLTVNVTLLAPAVIVTLEGTRATNVLLLESATCAPPA |
Ga0209388_11944272 | 3300027655 | Vadose Zone Soil | MVTDVDAATALLVTLNVALAAPAATVTLAGTDAAGLL |
Ga0208990_10995462 | 3300027663 | Forest Soil | MVTGVELVTALVLTVKVALLAPAATVTLVGTLAAPLS |
Ga0208990_11531952 | 3300027663 | Forest Soil | MVTVVDAVTALVFTGNVALVAPAGTATLEGTLAAPLLLESATC |
Ga0209328_102265802 | 3300027727 | Forest Soil | VTDAETVTALVLTAKFAALVPAATVTLAGTDAAEALLVRFTMTAL |
Ga0208989_102440081 | 3300027738 | Forest Soil | MVTVVDAVTTLVLTVKVAVVAPAGTATLEGTLAAPLLLESATC |
Ga0209180_103315913 | 3300027846 | Vadose Zone Soil | MVTVVEAETALVLTVKDALVAPAATVTLEGTVAAVVLLLESATCAPPVG |
Ga0209283_100472242 | 3300027875 | Vadose Zone Soil | VPKAVTALVLTVNVALVAPAATVTLEGTLASVPWSI |
Ga0209590_101075603 | 3300027882 | Vadose Zone Soil | MATEVDDDTGLVLTVKVALVTPPATVTPEGTLAAAGLLLES |
Ga0137415_107967991 | 3300028536 | Vadose Zone Soil | VTEVDAATALVLTVKEALVAPAATVTLEGPLVTAILLLERVIGAPPAG |
Ga0137415_108062171 | 3300028536 | Vadose Zone Soil | VIVTGVEALTALVLTVKFALLPPAATVTLAGTVAAGALLERFTVLP |
Ga0137415_112597003 | 3300028536 | Vadose Zone Soil | VAAVAVPTGFVVTLKLALAAPAGIVTLEGTDAAPLLLESA |
Ga0137415_113996221 | 3300028536 | Vadose Zone Soil | MVIGVEAVTALVLTANVALVVPAATVTLAGTDATAGLLLDR |
Ga0302201_102148262 | 3300028785 | Bog | MVAVVWAETAEVVTVNVAVVDPAGIVTLDGTVADVTLL |
Ga0302199_12328552 | 3300028860 | Bog | MVAVVWAETAEVVTVNVAVVDPAGIVTLDGTVADVTL |
Ga0307308_100629371 | 3300028884 | Soil | MVTAADAVTTLVLTVKVALVAPAGTVTLEGTVAAAV |
Ga0222749_104149851 | 3300029636 | Soil | VVDAATTLVLTVNDALVAPAATVTLEGTLAAVVLPLDRVTCAPPAGA |
Ga0222749_106122051 | 3300029636 | Soil | MVTEVDVVTALVFTANVALVAPAATVTLAGTLAAPLLLESSTCAPPVSA |
Ga0302185_101977912 | 3300030508 | Bog | MVAVVWAETAEVVTVNVAVVDPAGIVTLDGTVADVTLLDKATEVPPVPA |
Ga0307482_11767261 | 3300030730 | Hardwood Forest Soil | VVELTALVLTVNEAVVAPAATVTVEGTRATAELLLESETW |
Ga0073994_100591182 | 3300030991 | Soil | MVTGVDVVTALVLTVNVVLLAPAAIVTVAGALAAPLLLESSTCA |
Ga0170823_157431042 | 3300031128 | Forest Soil | MVTVVEAATALVLTVNVALVAPAATVTLEGTLAAAVLL |
Ga0302140_100600451 | 3300031261 | Bog | MVAVVWAETAEVVTVNVAVVDPAGIVTLDGTVADVTLLDKATEVP |
Ga0307469_100197354 | 3300031720 | Hardwood Forest Soil | MLTVVDAATALVLTGNDALVAPAATVTLEGTLAAAVLLLESIT |
Ga0307469_123885001 | 3300031720 | Hardwood Forest Soil | MLTVVDASTALVLTVNVALVAPAATVTLEGVLATLVLLLESVTTA |
Ga0307475_101372251 | 3300031754 | Hardwood Forest Soil | MVTGVEAVTALVFTVNVALVDPAATVTLDGTVAELLLLERFTVT |
Ga0307475_103329763 | 3300031754 | Hardwood Forest Soil | VTGVEAVTALLLTVKVALLAPAGTVTLEDTLAAALSLES |
Ga0307475_107408013 | 3300031754 | Hardwood Forest Soil | VVDAATALVLTVNVALVAPAGTITLEDTLAAPLLLESATCAPPDG |
Ga0307475_110854521 | 3300031754 | Hardwood Forest Soil | VTGVDVVTALVLTVNVALLAPAAIVTLAGTLAAPLLLESSTCA |
Ga0307473_114709751 | 3300031820 | Hardwood Forest Soil | MVTVVDAATALVLTVNVALVAPAATVTLDGTVAAAVLLLESVTV |
Ga0318520_106794561 | 3300031897 | Soil | VATVGAATGLVLTVNVALLLPAGTVTLEGTLAAALLLESITCA |
Ga0307479_109495181 | 3300031962 | Hardwood Forest Soil | MVDVPTALVLTVNVALVAPAAIVTLEGTLAAVVLPLERATCAPP |
Ga0307479_113814212 | 3300031962 | Hardwood Forest Soil | VTGVEALTMLVFTVKVAVLAPVATVTLAGTVAAGELLERFTETL |
Ga0307479_120456413 | 3300031962 | Hardwood Forest Soil | MVTAVELVTALELTVNVALLAPAATVTLAGTVAAAVLSLERET |
Ga0315278_119647041 | 3300031997 | Sediment | VEPDTGLVVTGNVALVAPAATVTLDGTVAANVLSL |
Ga0307470_107348601 | 3300032174 | Hardwood Forest Soil | MVTAVDATTGLVLTVNVALLAPAVIVTLEGTRATSVL |
Ga0307471_1007237693 | 3300032180 | Hardwood Forest Soil | MVTVVDALTTLVLAVNVALEAPAATVTLAGTGAAVVL |
Ga0307471_1028097141 | 3300032180 | Hardwood Forest Soil | VLDAMTALVLTVNVALVAPAATVTLEGTLAAPGLLLESA |
Ga0307471_1038717962 | 3300032180 | Hardwood Forest Soil | MVAWVDADTGLVLIVKVAVLLPAGTVTLEGTLAAVLLLESAT |
Ga0335085_117578362 | 3300032770 | Soil | MVALTVLGTATVLTVKVALVAPAATFTLAGTVAAG |
Ga0335070_100897881 | 3300032829 | Soil | MVTGVEMLTVLVVTAKVAEVLPASTVTLAGTVAAEVVSLC |
Ga0335071_118290961 | 3300032897 | Soil | MVVVADVETARVVTVNVALALPAGTVTEAGTVAADALLLVSATT |
Ga0334919_005237_2355_2495 | 3300034001 | Hypolithic Biocrust | MVTVVDEVTDLDVTVKLALVAPAATVTLAGTGATVALLLVSVTTAPP |
Ga0370497_0133704_2_115 | 3300034965 | Untreated Peat Soil | VALVDAVVVTLKVALVAPAGTVTLAGTLALDAFDTESW |
⦗Top⦘ |