Basic Information | |
---|---|
Family ID | F008793 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 328 |
Average Sequence Length | 42 residues |
Representative Sequence | MRFQNPNSHLPACWLHSLVCPRRYRAVLPSRLRPNLFGSD |
Number of Associated Samples | 226 |
Number of Associated Scaffolds | 328 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 38.72 % |
% of genes near scaffold ends (potentially truncated) | 37.20 % |
% of genes from short scaffolds (< 2000 bps) | 60.67 % |
Associated GOLD sequencing projects | 206 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.049 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (7.927 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.902 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.012 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 0.00% Coil/Unstructured: 85.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 328 Family Scaffolds |
---|---|---|
PF00202 | Aminotran_3 | 39.94 |
PF00892 | EamA | 20.43 |
PF00069 | Pkinase | 3.96 |
PF07244 | POTRA | 1.83 |
PF00072 | Response_reg | 1.22 |
PF02744 | GalP_UDP_tr_C | 1.22 |
PF01694 | Rhomboid | 0.91 |
PF01590 | GAF | 0.91 |
PF00753 | Lactamase_B | 0.91 |
PF00106 | adh_short | 0.61 |
PF01966 | HD | 0.61 |
PF00486 | Trans_reg_C | 0.61 |
PF00230 | MIP | 0.61 |
PF00012 | HSP70 | 0.61 |
PF08681 | DUF1778 | 0.61 |
PF07676 | PD40 | 0.61 |
PF01016 | Ribosomal_L27 | 0.61 |
PF04384 | Fe-S_assembly | 0.61 |
PF01925 | TauE | 0.30 |
PF03174 | CHB_HEX_C | 0.30 |
PF03652 | RuvX | 0.30 |
PF11752 | DUF3309 | 0.30 |
PF00682 | HMGL-like | 0.30 |
PF04055 | Radical_SAM | 0.30 |
PF11918 | Peptidase_S41_N | 0.30 |
PF03099 | BPL_LplA_LipB | 0.30 |
PF02578 | Cu-oxidase_4 | 0.30 |
PF13186 | SPASM | 0.30 |
PF00535 | Glycos_transf_2 | 0.30 |
PF07992 | Pyr_redox_2 | 0.30 |
PF14067 | LssY_C | 0.30 |
PF14384 | BrnA_antitoxin | 0.30 |
PF14559 | TPR_19 | 0.30 |
PF01740 | STAS | 0.30 |
PF02780 | Transketolase_C | 0.30 |
PF01850 | PIN | 0.30 |
PF03916 | NrfD | 0.30 |
PF00248 | Aldo_ket_red | 0.30 |
PF13414 | TPR_11 | 0.30 |
PF13742 | tRNA_anti_2 | 0.30 |
PF09720 | Unstab_antitox | 0.30 |
PF06379 | RhaT | 0.30 |
PF01087 | GalP_UDP_transf | 0.30 |
PF03422 | CBM_6 | 0.30 |
PF01872 | RibD_C | 0.30 |
PF12850 | Metallophos_2 | 0.30 |
PF13374 | TPR_10 | 0.30 |
PF13404 | HTH_AsnC-type | 0.30 |
PF11946 | DUF3463 | 0.30 |
PF12697 | Abhydrolase_6 | 0.30 |
PF04362 | Iron_traffic | 0.30 |
PF07883 | Cupin_2 | 0.30 |
PF13807 | GNVR | 0.30 |
PF13442 | Cytochrome_CBB3 | 0.30 |
PF04014 | MazE_antitoxin | 0.30 |
PF00814 | TsaD | 0.30 |
PF02874 | ATP-synt_ab_N | 0.30 |
PF02769 | AIRS_C | 0.30 |
PF02021 | UPF0102 | 0.30 |
PF03793 | PASTA | 0.30 |
COG ID | Name | Functional Category | % Frequency in 328 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 15.85 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
COG0211 | Ribosomal protein L27 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.61 |
COG2924 | Fe-S cluster biosynthesis and repair protein YggX | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
COG2975 | Fe-S-cluster formation regulator IscX/YfhJ | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.61 |
COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.30 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.30 |
COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.30 |
COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.30 |
COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.30 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.30 |
COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.30 |
COG0816 | YqgF/RuvX protein, pre-16S rRNA maturation RNase/Holliday junction resolvase/anti-termination factor | Translation, ribosomal structure and biogenesis [J] | 0.30 |
COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.30 |
COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 0.30 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.30 |
COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.30 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.05 % |
Unclassified | root | N/A | 21.95 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101432049 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101594977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2169 | Open in IMG/M |
3300000567|JGI12270J11330_10004107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10349 | Open in IMG/M |
3300000567|JGI12270J11330_10012582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5546 | Open in IMG/M |
3300000567|JGI12270J11330_10031195 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
3300001084|JGI12648J13191_1001477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2803 | Open in IMG/M |
3300001166|JGI12694J13545_1003636 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
3300001356|JGI12269J14319_10014421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6041 | Open in IMG/M |
3300001356|JGI12269J14319_10062145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2120 | Open in IMG/M |
3300001356|JGI12269J14319_10128879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1144 | Open in IMG/M |
3300001471|JGI12712J15308_10000601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10792 | Open in IMG/M |
3300001546|JGI12659J15293_10010858 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
3300001593|JGI12635J15846_10019495 | All Organisms → cellular organisms → Bacteria | 5591 | Open in IMG/M |
3300001867|JGI12627J18819_10019458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2761 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100163466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2105 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100233642 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100672575 | Not Available | 913 | Open in IMG/M |
3300002558|JGI25385J37094_10084728 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300002568|C688J35102_119013077 | Not Available | 626 | Open in IMG/M |
3300002917|JGI25616J43925_10027227 | All Organisms → cellular organisms → Bacteria | 2533 | Open in IMG/M |
3300002917|JGI25616J43925_10167528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 868 | Open in IMG/M |
3300003368|JGI26340J50214_10068963 | Not Available | 942 | Open in IMG/M |
3300004080|Ga0062385_10394623 | Not Available | 825 | Open in IMG/M |
3300004082|Ga0062384_100007387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4001 | Open in IMG/M |
3300004082|Ga0062384_100207987 | Not Available | 1159 | Open in IMG/M |
3300004091|Ga0062387_100594894 | Not Available | 792 | Open in IMG/M |
3300004091|Ga0062387_100844306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 687 | Open in IMG/M |
3300004091|Ga0062387_101727633 | Not Available | 509 | Open in IMG/M |
3300004092|Ga0062389_100111037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2462 | Open in IMG/M |
3300004092|Ga0062389_100116739 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
3300004092|Ga0062389_100646115 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300004092|Ga0062389_102073982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
3300004092|Ga0062389_103843079 | Not Available | 564 | Open in IMG/M |
3300004121|Ga0058882_1490880 | Not Available | 1215 | Open in IMG/M |
3300004152|Ga0062386_100038608 | All Organisms → cellular organisms → Bacteria | 3572 | Open in IMG/M |
3300004152|Ga0062386_100060281 | All Organisms → cellular organisms → Bacteria | 2869 | Open in IMG/M |
3300004152|Ga0062386_100071665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2634 | Open in IMG/M |
3300004152|Ga0062386_100238338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1439 | Open in IMG/M |
3300004268|Ga0066398_10011466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
3300004463|Ga0063356_100091945 | All Organisms → cellular organisms → Bacteria | 3253 | Open in IMG/M |
3300004479|Ga0062595_100108056 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300004479|Ga0062595_100198055 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300004479|Ga0062595_101434059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300004633|Ga0066395_10128117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1261 | Open in IMG/M |
3300004635|Ga0062388_101655784 | Not Available | 652 | Open in IMG/M |
3300005167|Ga0066672_10217586 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300005167|Ga0066672_10905387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
3300005176|Ga0066679_10011396 | All Organisms → cellular organisms → Bacteria | 4421 | Open in IMG/M |
3300005176|Ga0066679_10048372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2437 | Open in IMG/M |
3300005176|Ga0066679_10896114 | Not Available | 559 | Open in IMG/M |
3300005177|Ga0066690_10691914 | Not Available | 676 | Open in IMG/M |
3300005178|Ga0066688_10075096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2017 | Open in IMG/M |
3300005179|Ga0066684_10373642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 955 | Open in IMG/M |
3300005290|Ga0065712_10263499 | Not Available | 931 | Open in IMG/M |
3300005329|Ga0070683_100343694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1421 | Open in IMG/M |
3300005332|Ga0066388_100095265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3419 | Open in IMG/M |
3300005332|Ga0066388_100320903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2194 | Open in IMG/M |
3300005339|Ga0070660_100063616 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
3300005367|Ga0070667_100521585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1090 | Open in IMG/M |
3300005434|Ga0070709_10021409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3765 | Open in IMG/M |
3300005434|Ga0070709_10374137 | Not Available | 1057 | Open in IMG/M |
3300005435|Ga0070714_100042780 | All Organisms → cellular organisms → Bacteria | 3829 | Open in IMG/M |
3300005435|Ga0070714_100091215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2669 | Open in IMG/M |
3300005435|Ga0070714_100556070 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300005435|Ga0070714_101956608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 572 | Open in IMG/M |
3300005436|Ga0070713_101643251 | Not Available | 624 | Open in IMG/M |
3300005436|Ga0070713_101755068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 602 | Open in IMG/M |
3300005437|Ga0070710_10031733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2855 | Open in IMG/M |
3300005437|Ga0070710_10921267 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300005439|Ga0070711_100194050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1562 | Open in IMG/M |
3300005445|Ga0070708_100136426 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
3300005445|Ga0070708_100849249 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300005451|Ga0066681_10411040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
3300005455|Ga0070663_100861688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 780 | Open in IMG/M |
3300005459|Ga0068867_100152787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1815 | Open in IMG/M |
3300005467|Ga0070706_100004947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12758 | Open in IMG/M |
3300005467|Ga0070706_100017362 | All Organisms → cellular organisms → Bacteria | 6640 | Open in IMG/M |
3300005468|Ga0070707_100133210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2417 | Open in IMG/M |
3300005526|Ga0073909_10064874 | Not Available | 1363 | Open in IMG/M |
3300005529|Ga0070741_10002482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 49296 | Open in IMG/M |
3300005529|Ga0070741_10004035 | All Organisms → cellular organisms → Bacteria | 34980 | Open in IMG/M |
3300005530|Ga0070679_101164704 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300005532|Ga0070739_10386027 | Not Available | 653 | Open in IMG/M |
3300005536|Ga0070697_100000727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 24562 | Open in IMG/M |
3300005536|Ga0070697_100012415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6674 | Open in IMG/M |
3300005536|Ga0070697_101107054 | Not Available | 705 | Open in IMG/M |
3300005537|Ga0070730_10000781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 34014 | Open in IMG/M |
3300005537|Ga0070730_10445329 | Not Available | 835 | Open in IMG/M |
3300005538|Ga0070731_10212251 | Not Available | 1285 | Open in IMG/M |
3300005538|Ga0070731_10297796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1071 | Open in IMG/M |
3300005541|Ga0070733_10007116 | All Organisms → cellular organisms → Bacteria | 7254 | Open in IMG/M |
3300005541|Ga0070733_10047054 | All Organisms → cellular organisms → Bacteria | 2699 | Open in IMG/M |
3300005541|Ga0070733_10050218 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
3300005541|Ga0070733_10171639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1413 | Open in IMG/M |
3300005541|Ga0070733_10516942 | Not Available | 799 | Open in IMG/M |
3300005542|Ga0070732_10344629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
3300005542|Ga0070732_10388053 | Not Available | 842 | Open in IMG/M |
3300005545|Ga0070695_100480282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300005554|Ga0066661_10356895 | Not Available | 895 | Open in IMG/M |
3300005556|Ga0066707_10169225 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300005560|Ga0066670_10287895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
3300005568|Ga0066703_10235244 | Not Available | 1113 | Open in IMG/M |
3300005575|Ga0066702_10997276 | Not Available | 501 | Open in IMG/M |
3300005591|Ga0070761_10004782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 7996 | Open in IMG/M |
3300005591|Ga0070761_10006671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 6656 | Open in IMG/M |
3300005591|Ga0070761_10019686 | All Organisms → cellular organisms → Bacteria | 3750 | Open in IMG/M |
3300005591|Ga0070761_10052028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2305 | Open in IMG/M |
3300005602|Ga0070762_10054496 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
3300005602|Ga0070762_10196887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1231 | Open in IMG/M |
3300005607|Ga0070740_10441248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
3300005610|Ga0070763_10026887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2598 | Open in IMG/M |
3300005610|Ga0070763_10052491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1943 | Open in IMG/M |
3300005610|Ga0070763_10148808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1221 | Open in IMG/M |
3300005610|Ga0070763_10155997 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300005614|Ga0068856_100002308 | All Organisms → cellular organisms → Bacteria | 19646 | Open in IMG/M |
3300005712|Ga0070764_10025012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2985 | Open in IMG/M |
3300005712|Ga0070764_10073446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1789 | Open in IMG/M |
3300005712|Ga0070764_10120616 | Not Available | 1418 | Open in IMG/M |
3300005712|Ga0070764_10122023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1411 | Open in IMG/M |
3300005712|Ga0070764_10163372 | Not Available | 1230 | Open in IMG/M |
3300005764|Ga0066903_100697142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1789 | Open in IMG/M |
3300005764|Ga0066903_104626110 | Not Available | 733 | Open in IMG/M |
3300005878|Ga0075297_1009200 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300005921|Ga0070766_10048648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2374 | Open in IMG/M |
3300005944|Ga0066788_10011860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1847 | Open in IMG/M |
3300005993|Ga0080027_10072898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1264 | Open in IMG/M |
3300005994|Ga0066789_10000799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13321 | Open in IMG/M |
3300006028|Ga0070717_10009685 | All Organisms → cellular organisms → Bacteria | 7253 | Open in IMG/M |
3300006028|Ga0070717_10042425 | All Organisms → cellular organisms → Bacteria | 3710 | Open in IMG/M |
3300006028|Ga0070717_10457289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1151 | Open in IMG/M |
3300006050|Ga0075028_100000010 | All Organisms → cellular organisms → Bacteria | 80455 | Open in IMG/M |
3300006050|Ga0075028_100111708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1407 | Open in IMG/M |
3300006052|Ga0075029_100033698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2918 | Open in IMG/M |
3300006052|Ga0075029_100188329 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300006059|Ga0075017_100000333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25477 | Open in IMG/M |
3300006059|Ga0075017_100063166 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
3300006059|Ga0075017_100070321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2388 | Open in IMG/M |
3300006059|Ga0075017_100226739 | Not Available | 1359 | Open in IMG/M |
3300006059|Ga0075017_100886471 | Not Available | 692 | Open in IMG/M |
3300006086|Ga0075019_10667262 | Not Available | 656 | Open in IMG/M |
3300006162|Ga0075030_100048883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3540 | Open in IMG/M |
3300006162|Ga0075030_100268645 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
3300006162|Ga0075030_100599957 | Not Available | 873 | Open in IMG/M |
3300006163|Ga0070715_10022565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2456 | Open in IMG/M |
3300006172|Ga0075018_10039115 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
3300006173|Ga0070716_100704305 | Not Available | 772 | Open in IMG/M |
3300006173|Ga0070716_100984774 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300006174|Ga0075014_100065975 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300006174|Ga0075014_100114713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
3300006174|Ga0075014_100412495 | Not Available | 739 | Open in IMG/M |
3300006175|Ga0070712_100397477 | Not Available | 1138 | Open in IMG/M |
3300006176|Ga0070765_100099485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2509 | Open in IMG/M |
3300006176|Ga0070765_100195271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1834 | Open in IMG/M |
3300006176|Ga0070765_100610080 | Not Available | 1029 | Open in IMG/M |
3300006354|Ga0075021_10286409 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300006358|Ga0068871_100522894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
3300006358|Ga0068871_100879510 | Not Available | 829 | Open in IMG/M |
3300006642|Ga0075521_10398712 | Not Available | 669 | Open in IMG/M |
3300006755|Ga0079222_11013393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300006804|Ga0079221_10065920 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
3300006804|Ga0079221_10200421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1093 | Open in IMG/M |
3300006854|Ga0075425_100997911 | Not Available | 955 | Open in IMG/M |
3300006893|Ga0073928_10000066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 231409 | Open in IMG/M |
3300006893|Ga0073928_10352245 | Not Available | 1089 | Open in IMG/M |
3300006893|Ga0073928_10353302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1087 | Open in IMG/M |
3300006954|Ga0079219_11051121 | Not Available | 683 | Open in IMG/M |
3300006954|Ga0079219_11501922 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300007076|Ga0075435_100747168 | Not Available | 851 | Open in IMG/M |
3300007258|Ga0099793_10146285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1117 | Open in IMG/M |
3300007982|Ga0102924_1274528 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300009038|Ga0099829_10000266 | All Organisms → cellular organisms → Bacteria | 26822 | Open in IMG/M |
3300009088|Ga0099830_10042252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3169 | Open in IMG/M |
3300009088|Ga0099830_11439557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300009089|Ga0099828_11807520 | Not Available | 537 | Open in IMG/M |
3300009090|Ga0099827_10000197 | All Organisms → cellular organisms → Bacteria | 24067 | Open in IMG/M |
3300009090|Ga0099827_10057634 | All Organisms → cellular organisms → Bacteria | 2949 | Open in IMG/M |
3300009521|Ga0116222_1345732 | Not Available | 645 | Open in IMG/M |
3300009523|Ga0116221_1022660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3257 | Open in IMG/M |
3300009523|Ga0116221_1027994 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
3300009623|Ga0116133_1054468 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300009623|Ga0116133_1143777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
3300009624|Ga0116105_1041023 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300009624|Ga0116105_1048585 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300009665|Ga0116135_1495339 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300009759|Ga0116101_1134034 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300009792|Ga0126374_10677636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300009792|Ga0126374_10938530 | Not Available | 674 | Open in IMG/M |
3300010043|Ga0126380_10720046 | Not Available | 805 | Open in IMG/M |
3300010046|Ga0126384_10537533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1013 | Open in IMG/M |
3300010360|Ga0126372_11082945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
3300010371|Ga0134125_10045947 | All Organisms → cellular organisms → Bacteria | 4860 | Open in IMG/M |
3300010371|Ga0134125_10232808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2047 | Open in IMG/M |
3300010376|Ga0126381_100005031 | All Organisms → cellular organisms → Bacteria | 14468 | Open in IMG/M |
3300010376|Ga0126381_103327459 | Not Available | 634 | Open in IMG/M |
3300010376|Ga0126381_103585528 | Not Available | 609 | Open in IMG/M |
3300010379|Ga0136449_100455109 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
3300010379|Ga0136449_101083960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1277 | Open in IMG/M |
3300010396|Ga0134126_10367492 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
3300012096|Ga0137389_11432624 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300012096|Ga0137389_11828947 | Not Available | 503 | Open in IMG/M |
3300012202|Ga0137363_10052245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2935 | Open in IMG/M |
3300012212|Ga0150985_110455419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300012363|Ga0137390_10003797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12413 | Open in IMG/M |
3300012363|Ga0137390_10639906 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300012363|Ga0137390_11385680 | Not Available | 648 | Open in IMG/M |
3300012971|Ga0126369_10068635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3099 | Open in IMG/M |
3300013296|Ga0157374_12986255 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300014168|Ga0181534_10178523 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300014489|Ga0182018_10660565 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300014491|Ga0182014_10408515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300014501|Ga0182024_10006325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 26075 | Open in IMG/M |
3300014654|Ga0181525_10046434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2500 | Open in IMG/M |
3300014838|Ga0182030_10118669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3534 | Open in IMG/M |
3300014839|Ga0182027_12004791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300015241|Ga0137418_10864938 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300015373|Ga0132257_101988795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300017822|Ga0187802_10336463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300017927|Ga0187824_10000033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19938 | Open in IMG/M |
3300017930|Ga0187825_10001245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 7537 | Open in IMG/M |
3300017943|Ga0187819_10033881 | Not Available | 3017 | Open in IMG/M |
3300017955|Ga0187817_10003164 | All Organisms → cellular organisms → Bacteria | 8704 | Open in IMG/M |
3300017959|Ga0187779_10001019 | All Organisms → cellular organisms → Bacteria | 17936 | Open in IMG/M |
3300017970|Ga0187783_10228584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
3300017972|Ga0187781_10559346 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300017975|Ga0187782_10454904 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300017995|Ga0187816_10147304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
3300018062|Ga0187784_10008249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8410 | Open in IMG/M |
3300018086|Ga0187769_10045124 | All Organisms → cellular organisms → Bacteria | 3043 | Open in IMG/M |
3300018086|Ga0187769_10501255 | Not Available | 916 | Open in IMG/M |
3300018086|Ga0187769_10645951 | Not Available | 800 | Open in IMG/M |
3300018086|Ga0187769_10752778 | Not Available | 737 | Open in IMG/M |
3300018088|Ga0187771_10028915 | All Organisms → cellular organisms → Bacteria | 4204 | Open in IMG/M |
3300018088|Ga0187771_10788441 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300018090|Ga0187770_10232547 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
3300018090|Ga0187770_10327154 | Not Available | 1196 | Open in IMG/M |
3300019256|Ga0181508_1191229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2346 | Open in IMG/M |
3300019284|Ga0187797_1295991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 1209 | Open in IMG/M |
3300019887|Ga0193729_1083830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
3300020579|Ga0210407_10036360 | All Organisms → cellular organisms → Bacteria | 3663 | Open in IMG/M |
3300020579|Ga0210407_10976371 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300020581|Ga0210399_10296713 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300020582|Ga0210395_10318373 | Not Available | 1170 | Open in IMG/M |
3300021088|Ga0210404_10456256 | Not Available | 719 | Open in IMG/M |
3300021171|Ga0210405_11366562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300021178|Ga0210408_10906718 | Not Available | 686 | Open in IMG/M |
3300021401|Ga0210393_10978821 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300021404|Ga0210389_10856207 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300021406|Ga0210386_10002455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16016 | Open in IMG/M |
3300021407|Ga0210383_10066343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3015 | Open in IMG/M |
3300021420|Ga0210394_10055601 | All Organisms → cellular organisms → Bacteria | 3451 | Open in IMG/M |
3300021474|Ga0210390_10392409 | Not Available | 1173 | Open in IMG/M |
3300021478|Ga0210402_10002277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 18844 | Open in IMG/M |
3300021559|Ga0210409_10456112 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300021855|Ga0213854_1251705 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
3300022531|Ga0242660_1000777 | All Organisms → cellular organisms → Bacteria | 3733 | Open in IMG/M |
3300022557|Ga0212123_10000747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 100046 | Open in IMG/M |
3300022732|Ga0224569_116500 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300024225|Ga0224572_1013304 | Not Available | 1569 | Open in IMG/M |
3300025412|Ga0208194_1000132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13947 | Open in IMG/M |
3300025905|Ga0207685_10069792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
3300025911|Ga0207654_10036287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2753 | Open in IMG/M |
3300025911|Ga0207654_10240776 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300025922|Ga0207646_10195150 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
3300025922|Ga0207646_10728163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
3300025960|Ga0207651_10817700 | Not Available | 827 | Open in IMG/M |
3300026296|Ga0209235_1017501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3875 | Open in IMG/M |
3300026318|Ga0209471_1171246 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300026322|Ga0209687_1063453 | Not Available | 1200 | Open in IMG/M |
3300027567|Ga0209115_1000051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10520 | Open in IMG/M |
3300027590|Ga0209116_1077807 | Not Available | 725 | Open in IMG/M |
3300027605|Ga0209329_1109249 | Not Available | 607 | Open in IMG/M |
3300027652|Ga0209007_1072961 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300027676|Ga0209333_1002449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8168 | Open in IMG/M |
3300027783|Ga0209448_10026046 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
3300027846|Ga0209180_10237654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 1049 | Open in IMG/M |
3300027853|Ga0209274_10002153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9795 | Open in IMG/M |
3300027854|Ga0209517_10000842 | All Organisms → cellular organisms → Bacteria | 50162 | Open in IMG/M |
3300027855|Ga0209693_10357202 | Not Available | 708 | Open in IMG/M |
3300027857|Ga0209166_10008451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 6804 | Open in IMG/M |
3300027862|Ga0209701_10022370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4120 | Open in IMG/M |
3300027867|Ga0209167_10185605 | Not Available | 1103 | Open in IMG/M |
3300027875|Ga0209283_10035919 | All Organisms → cellular organisms → Bacteria | 3109 | Open in IMG/M |
3300027879|Ga0209169_10454086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300027895|Ga0209624_10592096 | Not Available | 736 | Open in IMG/M |
3300027911|Ga0209698_10038027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4333 | Open in IMG/M |
3300028019|Ga0224573_1008352 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300028020|Ga0265351_1023378 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300028047|Ga0209526_10208827 | Not Available | 1349 | Open in IMG/M |
3300028047|Ga0209526_10782930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300028536|Ga0137415_10000037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 101769 | Open in IMG/M |
3300028560|Ga0302144_10270046 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300028806|Ga0302221_10173919 | Not Available | 945 | Open in IMG/M |
3300029913|Ga0311362_10056479 | All Organisms → cellular organisms → Bacteria | 5807 | Open in IMG/M |
3300030013|Ga0302178_10295395 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300030503|Ga0311370_10019692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 10384 | Open in IMG/M |
3300030707|Ga0310038_10035151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2947 | Open in IMG/M |
3300031234|Ga0302325_10251142 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
3300031234|Ga0302325_11625061 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300031236|Ga0302324_100139650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3998 | Open in IMG/M |
3300031236|Ga0302324_100418596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1990 | Open in IMG/M |
3300031524|Ga0302320_10013819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16786 | Open in IMG/M |
3300031708|Ga0310686_111484196 | All Organisms → cellular organisms → Bacteria | 3254 | Open in IMG/M |
3300031715|Ga0307476_10199728 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300031740|Ga0307468_100890638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
3300031753|Ga0307477_10026056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3994 | Open in IMG/M |
3300031880|Ga0318544_10105737 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300031912|Ga0306921_11879396 | Not Available | 641 | Open in IMG/M |
3300031938|Ga0308175_101173081 | Not Available | 853 | Open in IMG/M |
3300031942|Ga0310916_10043115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3407 | Open in IMG/M |
3300031962|Ga0307479_10091605 | All Organisms → cellular organisms → Bacteria | 2948 | Open in IMG/M |
3300031962|Ga0307479_10110466 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
3300032074|Ga0308173_10512347 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300032515|Ga0348332_11475833 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
3300032783|Ga0335079_10049180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4830 | Open in IMG/M |
3300032783|Ga0335079_12269201 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300032805|Ga0335078_10000323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 76622 | Open in IMG/M |
3300032805|Ga0335078_10000458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 63157 | Open in IMG/M |
3300032805|Ga0335078_10089842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4454 | Open in IMG/M |
3300032829|Ga0335070_10002072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 23340 | Open in IMG/M |
3300032893|Ga0335069_10079669 | All Organisms → cellular organisms → Bacteria | 4188 | Open in IMG/M |
3300032898|Ga0335072_10421364 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300033004|Ga0335084_10859957 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300033134|Ga0335073_10223943 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
3300033158|Ga0335077_10080994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3854 | Open in IMG/M |
3300033755|Ga0371489_0023230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 4899 | Open in IMG/M |
3300033808|Ga0314867_003571 | All Organisms → cellular organisms → Bacteria | 3606 | Open in IMG/M |
3300033977|Ga0314861_0009365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7188 | Open in IMG/M |
3300034268|Ga0372943_0779735 | Not Available | 633 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.71% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.79% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.49% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.49% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.49% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.49% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.35% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.13% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.13% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.83% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.22% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.91% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.61% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.61% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.61% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.61% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.30% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.30% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.30% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.30% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.30% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.30% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.30% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.30% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.30% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.30% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.30% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.30% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.30% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.30% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028019 | Spruce roots microbial communities from Bohemian Forest, Czech Republic ? CRU1 | Host-Associated | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1014320492 | 3300000364 | Soil | MTLQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPSLFGSD* |
INPhiseqgaiiFebDRAFT_1015949772 | 3300000364 | Soil | MDGISPNTRLPECWLHSLVCPRRYRAVLPSSVRANLFGSD* |
JGI12270J11330_100041077 | 3300000567 | Peatlands Soil | MRYQAANSHLPVCWLRSLVCPRRYRAVLPSHLRPNLFGSD* |
JGI12270J11330_100125823 | 3300000567 | Peatlands Soil | MLRMNPNSRLSQSHRPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12270J11330_100311955 | 3300000567 | Peatlands Soil | MRSQHPNSHLPACWLHFLVCPRRYLAVLPSQARPSLFGSD* |
JGI12648J13191_10014772 | 3300001084 | Forest Soil | MLHKVSNSCLPNAHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12694J13545_10036361 | 3300001166 | Forest Soil | MLRNLSNSSLANSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12269J14319_100144215 | 3300001356 | Peatlands Soil | MNPNSHLXNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12269J14319_100621452 | 3300001356 | Peatlands Soil | MTYKSSNSRLPHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12269J14319_101288792 | 3300001356 | Peatlands Soil | MLRMNPNSRRPSLQLSECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12712J15308_100006014 | 3300001471 | Forest Soil | MLRNHPNSRRPHLHLVYADVSECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12659J15293_100108582 | 3300001546 | Forest Soil | MLRHNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12635J15846_100194954 | 3300001593 | Forest Soil | MLRNKSNSLQPKSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI12627J18819_100194585 | 3300001867 | Forest Soil | MLRKNTNSRVPYAQAGECWLHSLVCPRRYRANLPSRLRPSLFGSD* |
JGIcombinedJ26739_1001634662 | 3300002245 | Forest Soil | MLRNTPNSYHPNSYRPDLHLPECWLRHLVCPRRYRANLPSRLRPSLFGSD* |
JGIcombinedJ26739_1002336423 | 3300002245 | Forest Soil | MRHQKPNSHLPVCWLDSLVCPRRYRAVLPSRLRPNLFGSD* |
JGIcombinedJ26739_1006725751 | 3300002245 | Forest Soil | MLQIHPKSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI25385J37094_100847282 | 3300002558 | Grasslands Soil | MRQQNPNSHLPVCWLHFLVCPRRYRAVLPSQARPNLFGSD* |
C688J35102_1190130772 | 3300002568 | Soil | YNHLAIFFIAMLQTNPNSHLPECWLRCLVCPRRYRANLPSRLRPSLFGSD* |
JGI25616J43925_100272271 | 3300002917 | Grasslands Soil | PFATMQKNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI25616J43925_101675282 | 3300002917 | Grasslands Soil | MLRQNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
JGI26340J50214_100689632 | 3300003368 | Bog Forest Soil | MLQKNTNPHFQSAECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062385_103946231 | 3300004080 | Bog Forest Soil | MLRNVSNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062384_1000073875 | 3300004082 | Bog Forest Soil | MLRKNPNSRRPNLHLAYADLSECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062384_1002079872 | 3300004082 | Bog Forest Soil | MLRNKSNSHLPNAHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062387_1005948942 | 3300004091 | Bog Forest Soil | MLRYVSNSCMPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062387_1008443062 | 3300004091 | Bog Forest Soil | MRYQRPNSHLPACWLQFLVCPRRHLAVLPSQARPSLFGSD* |
Ga0062387_1017276332 | 3300004091 | Bog Forest Soil | MLHNVSNSNQPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062389_1001110372 | 3300004092 | Bog Forest Soil | MIQVCVLMRNQNSNSRLPVCWLHFLVCPRRYRAVLPSRRRPSLFGSD* |
Ga0062389_1001167391 | 3300004092 | Bog Forest Soil | VAMRQQKPNSHLPVCWLHSLVCPRRHLAVLPSRSRPSLFGSD* |
Ga0062389_1006461151 | 3300004092 | Bog Forest Soil | MLRNNSNPVLPRVQSAECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062389_1020739822 | 3300004092 | Bog Forest Soil | MDSRENPNSRLCDCWLHILVCPRRYRAVLPSRLRPSLFGSD* |
Ga0062389_1038430792 | 3300004092 | Bog Forest Soil | MDKECCPMRHQKPNSHLPVCWLHFLVCPRRYLAVLPSQARPSLFGSD* |
Ga0058882_14908801 | 3300004121 | Forest Soil | VPMLRNDSNLPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062386_1000386085 | 3300004152 | Bog Forest Soil | MRHQTANLHLPVCWLQSLVCPRRYRAVLPSRLRPSLFGSD* |
Ga0062386_1000602814 | 3300004152 | Bog Forest Soil | MLRKNSNSLPHFQSAECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062386_1000716652 | 3300004152 | Bog Forest Soil | MLRNKSNSHLLYSNRPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0062386_1002383382 | 3300004152 | Bog Forest Soil | MLQKNPNSHLPYSPRAECWLHCLVCPRRYRANLPSRLRPNLFGSD* |
Ga0066398_100114662 | 3300004268 | Tropical Forest Soil | MRVRCPNANLTVCWLHCLVCPRRYLAVLPSQARPNLFGSD* |
Ga0063356_1000919453 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSAQNSNSHLPACWLHQLVCPRRYLAVLPSRARANLFGSD* |
Ga0062595_1001080562 | 3300004479 | Soil | MRFTSPNSHLPACWLHMLVCPRRYLAVLPSNTRPSLFGSD* |
Ga0062595_1001980552 | 3300004479 | Soil | MRFWNPNSHLPSCWLHMLVCPRRYLAVLPSRTRPSLFGSD* |
Ga0062595_1014340592 | 3300004479 | Soil | MRHHNPNSHLPVCWLDSLVCPRRHLAVLPSQARPSLFGSD* |
Ga0066395_101281171 | 3300004633 | Tropical Forest Soil | MSLQNPNSRLPVCWLHQLVCPRRHLAVLPSQVRPSLFGSD* |
Ga0062388_1016557842 | 3300004635 | Bog Forest Soil | MLRIHPKSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0066672_102175862 | 3300005167 | Soil | MYLPFNMRRDHANSHLPACWLHCLVCPRRYLAVLPSQARPNLFGSD* |
Ga0066672_109053872 | 3300005167 | Soil | MMRLQNPNSHLPACWLHMLVCPRRYLAVLPSQSRPSLFGSD* |
Ga0066679_100113966 | 3300005176 | Soil | QGLRRVCFSAIMKMYLPFNMRRDHANSHLPACWLHCLVCPRRYLAVLPSQARPNLFGSD* |
Ga0066679_100483722 | 3300005176 | Soil | MLHNKPNSHLPECWLHCLVCPRRYRANLPTRLRPNLFGSD* |
Ga0066679_108961142 | 3300005176 | Soil | MLRNKPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0066690_106919141 | 3300005177 | Soil | MLRKNPNSPVLCGPSAHAQSSECWLHSLVCPRRYRANLPSRLRPSLFGSD* |
Ga0066688_100750962 | 3300005178 | Soil | MKMYLPFNMRRDHANSHLPACWLHCLVCPRRYLAVLPSQARPNLFGSD* |
Ga0066684_103736422 | 3300005179 | Soil | MYHQNANSHLPVCWLHFLVCPRRHLVVLPSQARPSLFGSD* |
Ga0065712_102634992 | 3300005290 | Miscanthus Rhizosphere | MRHQKPNSHLPVCWLHFLVCPRRYLAVLPSQARPSLFGSD* |
Ga0070683_1003436942 | 3300005329 | Corn Rhizosphere | MRVRYPNANLPVCWLHCLVCPRRHLAVLPSQARPNLFGSD* |
Ga0066388_1000952652 | 3300005332 | Tropical Forest Soil | MTLQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPNLFGSD* |
Ga0066388_1003209032 | 3300005332 | Tropical Forest Soil | MNLQNANSHLPTCWLHQLCCPRRHLAVLPSQVRPNLFGSD* |
Ga0070660_1000636162 | 3300005339 | Corn Rhizosphere | MRHQKPNSHLPVCWLQFLVCPRRYLAVLPSQARPSLFGSD* |
Ga0070667_1005215851 | 3300005367 | Switchgrass Rhizosphere | YNQSRFSVRVRYPNSNLPICWLHCLVCPRRHLAVLPSQARPNLFGSD* |
Ga0070709_100214092 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHQTSNSHLPVCWLDFLVYPRRHPAVLPSQARPSLFGSD* |
Ga0070709_103741371 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHTHPNSRVAPRNSAECWLHSLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070714_1000427804 | 3300005435 | Agricultural Soil | MSSKSCNSMTLQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPNLFGSD* |
Ga0070714_1000912152 | 3300005435 | Agricultural Soil | MHFQNANSHLPTCWLHMLVCPRRYLAVLPSQSRPSLFGSD* |
Ga0070714_1005560702 | 3300005435 | Agricultural Soil | MNLQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPNLFGSD* |
Ga0070714_1019566082 | 3300005435 | Agricultural Soil | MHFQNANSHLPACWLHMLVCPRRYLAVLPSQSRPSLFGSD* |
Ga0070713_1016432511 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEECCPMRHQTSNSHLPVCWLDFLVYPRRHPAVLPSQARPSLFGSD* |
Ga0070713_1017550681 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPQNSNSHLPVCWLHFLVCPRRHLAVLPSQARPSLFGSD* |
Ga0070710_100317334 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLQNPNSHLPVCWLRQLCCPRRHLAVLPSQVRPNLFGCDNS |
Ga0070710_109212671 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFWNPNSHLPSCWLHMLVCPRRYLAVLHSHSRPSLFGSD |
Ga0070711_1001940502 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RPMRNQRPNSHLPACWLEFLVCPRRHLAVLPSQARPSLFGSD* |
Ga0070708_1001364262 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VRFKNPNSHLPACWLHMLVCPRRYLAVLPSQVRPSLFGSD* |
Ga0070708_1008492491 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHQKPNSHLPVCWLHFLVRPRRYLAVLPSQARPSLFGSD* |
Ga0066681_104110402 | 3300005451 | Soil | MKLVRFTSPNSHLPACWLHMLVCPRRYLAVLPAHTRPSLFGSD* |
Ga0070663_1008616882 | 3300005455 | Corn Rhizosphere | MRAQKPNSHLPVCWLHQLVCPRRYLAVLPSRARAGLFGSD* |
Ga0068867_1001527871 | 3300005459 | Miscanthus Rhizosphere | MRVRRSSNSHLPECWLHFLVGPRRYRAVLPSNRRPSLFGGD* |
Ga0070706_10000494711 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHQNPNSHLPVCWLDSLVGPRRHLAVLPSQARPSLFGSD* |
Ga0070706_1000173628 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLHNKPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070707_1001332102 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQQNPNSHLPVCWLHGLVCPRRYRAVLPSQARPNLFGSD* |
Ga0073909_100648741 | 3300005526 | Surface Soil | MNLQNPNSHLPVCWLHQLCCPRRHLAVLPSQVRPNLFGCD* |
Ga0070741_1000248219 | 3300005529 | Surface Soil | MHFKNANSHLPACWLHMLVCPRRYLAVLPSQLRPSLFGSD* |
Ga0070741_100040355 | 3300005529 | Surface Soil | MRYERSNSHLPACWLHCLVCPRRHLAVLPSRSRPNLFGSD* |
Ga0070679_1011647042 | 3300005530 | Corn Rhizosphere | MLQTNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070739_103860272 | 3300005532 | Surface Soil | SNSHLPACWLQSLVCPRRYRAVLPSRLRPSLFGSD* |
Ga0070697_1000007279 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPLNLNSHLPACWLHFLVAPRRYLAVLPSQARPSLFGSD* |
Ga0070697_1000124151 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SLMRQQNPNSHLPVCWLHGLVCPRRYRAVLPSQARPNLFGSD* |
Ga0070697_1011070542 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHQNPNSHPPVCWLDFLVCPRRHPAVLPSQARPSLFGSD* |
Ga0070730_100007814 | 3300005537 | Surface Soil | MLRKLLNSHMPECWLDSLVCPRRYRANLPSRLRPNLFGSD* |
Ga0070730_104453292 | 3300005537 | Surface Soil | MRHQQTNSHLPARWLQSLVCPRRYLAVLPSQARPSLFGSD* |
Ga0070731_102122512 | 3300005538 | Surface Soil | MRFQAANSHLPVCWLQQLVCPRRYRAVLPSNLRPSLFGSD* |
Ga0070731_102977962 | 3300005538 | Surface Soil | MRHQNSNSHLPVCWLDFLVCPRRHPAVLPSQARPSLFGSD* |
Ga0070733_100071165 | 3300005541 | Surface Soil | MRFQNPNSHLPACWLHSLVCPRRYRAVLPSRLRPNLFGSD* |
Ga0070733_100470542 | 3300005541 | Surface Soil | MLRNVSNSQLNSHKPECWLQSLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070733_100502182 | 3300005541 | Surface Soil | MLRDKSNSHLPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070733_101716392 | 3300005541 | Surface Soil | MLRNRPNSRRPNLHLVYADLSECWLDCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070733_105169422 | 3300005541 | Surface Soil | MLRNKSNSHLLHSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070732_103446292 | 3300005542 | Surface Soil | MRRDHANSHLPACWLHCLVCPRRYLAVLPSQARPNLFGSD* |
Ga0070732_103880532 | 3300005542 | Surface Soil | HNKPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070695_1004802822 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHQKPNSHLPVCWLQFLVCPRRYLAVLPSQARPSLFGSDS |
Ga0066661_103568951 | 3300005554 | Soil | KMYLPFNMRRDHANSHLPACWLHCLVCPRRYLAVLPSQARPNLFGSD* |
Ga0066707_101692252 | 3300005556 | Soil | MITEMQFKNPNAHLPACWLHMLVCPRRYLAVLPSQVRPNLFGSD* |
Ga0066670_102878951 | 3300005560 | Soil | MEIELVMHFQNANSHLPACWLHMLVCPRRYLAVLPSQSRPSLFGSD* |
Ga0066703_102352441 | 3300005568 | Soil | NPNSHLPECWLDCLVCPRRYRSVLPSRLRPSLFGSD* |
Ga0066702_109972761 | 3300005575 | Soil | ANSHLPACWLHCLVCPRRYLAVLPSQARPNLFGSD* |
Ga0070761_100047822 | 3300005591 | Soil | MLRNKSNSLQPDSNLLSSNLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070761_100066715 | 3300005591 | Soil | MLHNNPNSRRPSLRRPSLQLVYADLSECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070761_100196863 | 3300005591 | Soil | MPRNRSNSSQINLHKPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070761_100520282 | 3300005591 | Soil | MLRNHPNSRRPHLQIVYADLSECWLHCLVGPRRYRANLPSRLRPSLFGSD* |
Ga0070762_100544963 | 3300005602 | Soil | MLHNNSNSLPNAPLVGSTRPECWLHSLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070762_101968872 | 3300005602 | Soil | MSVKTWLPMLRNVSRSHEPNSHLPECWLHCLLRPRRYRANLPSRLRPSLFGSD* |
Ga0070740_104412481 | 3300005607 | Surface Soil | MFKNPNSHLPVCWLHMLVCPRRYLAVLPSQLRPSLFGSD* |
Ga0070763_100268872 | 3300005610 | Soil | MLRKYPNSRLLHAQSAECWLHCLVCPRRYRANLPSRSRPSLFGSD* |
Ga0070763_100524913 | 3300005610 | Soil | MLRNHPNSRRPHLQLVYADLSECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070763_101488082 | 3300005610 | Soil | MLHNKSNSAMANSHFLPVQSAECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070763_101559972 | 3300005610 | Soil | MLHNNPNSRRPSLRRPSLQLVYADLSECWLHCLVCPRRYRANLPSHLRPSLFGSD* |
Ga0068856_1000023088 | 3300005614 | Corn Rhizosphere | MLQKNPNSRLPMSNAAECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070764_100250123 | 3300005712 | Soil | MLLKNPNSNLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070764_100734462 | 3300005712 | Soil | MRQQKPNSHLPACWLHSLVCPRRHLAVLPSRSRPSLFGSD* |
Ga0070764_101206162 | 3300005712 | Soil | MLRNNPNPRSQNLQLVYADLSECWLHCLVCPRRYRANLPSHLRPSLFGSD* |
Ga0070764_101220232 | 3300005712 | Soil | NSHLPACWLHSLVCPRRHLAVLPSRSRPSLFGSD* |
Ga0070764_101633721 | 3300005712 | Soil | MLHNNPNSRQPHLHLVYADLSECWLHCLVCPRRYRANLPSHLRPSLFGSD* |
Ga0066903_1006971422 | 3300005764 | Tropical Forest Soil | MSLQNPNSHLPVCWLHQLVCPRRHLAVLPSQVRPSLFGSD* |
Ga0066903_1046261102 | 3300005764 | Tropical Forest Soil | MRFAAPNSHLSACWLHFLVCPRRYLAVLPSQARPNLFGSD* |
Ga0075297_10092002 | 3300005878 | Rice Paddy Soil | MLQKNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070766_100486482 | 3300005921 | Soil | MLRKNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0066788_100118602 | 3300005944 | Soil | MLRNQPNSHLPECWLRFLVCPRRYRAVLPSNRRPSLFGSD* |
Ga0080027_100728982 | 3300005993 | Prmafrost Soil | RLVNFNVPNSHLPACWLHMLVCPRRYLAVLPSQVRPSLFGSD* |
Ga0066789_1000079914 | 3300005994 | Soil | VNFNVPNSHLPACWLHMLVCPRRYLAVLPSQVRPSLFGSD* |
Ga0070717_100096852 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMHNKPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070717_100424251 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQTHPNSRVAPRNSAECWLHSLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070717_104572892 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFQSANSHLPACWLHMLVCPRRYLAVLPSQSRPSLFGSD* |
Ga0075028_10000001050 | 3300006050 | Watersheds | MMRNRPNSHLPECWLDMLVCPRRYRCVLPSSRRPSLFGSD* |
Ga0075028_1001117082 | 3300006050 | Watersheds | MRHQNPNSHLPVCWLDSLVCPRRYLTVLPSQARPSLFGSD* |
Ga0075029_1000336983 | 3300006052 | Watersheds | MLQKNPNSHLPECWLHCLVCPRRYRANLPSRLRPNLFGSD* |
Ga0075029_1001883292 | 3300006052 | Watersheds | MIMRREHPNSHLPVCWLHCLVCPRRHLAVLPSQVRPSLFGSD* |
Ga0075017_10000033314 | 3300006059 | Watersheds | MLQKNPNPHFQSSECWLHCLVCPRRYRAHLPSRLRPSLFGSD* |
Ga0075017_1000631663 | 3300006059 | Watersheds | MILQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPSLFGSD* |
Ga0075017_1000703212 | 3300006059 | Watersheds | MMRNRPNSHLPECWLHMLVCPRRYRSVLPSSIRPSLFGSD* |
Ga0075017_1002267392 | 3300006059 | Watersheds | MRYQKPNSHLPVCWLHFLVCPRRYLAVLPSQARPSLFGSD* |
Ga0075017_1008864712 | 3300006059 | Watersheds | MLRNKSNSHLPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0075019_106672621 | 3300006086 | Watersheds | YNQSAMLTANELRKNANSRVPYAQAGECWLHSLVCPRRYRANLPSRLRPSLFGSD* |
Ga0075030_1000488832 | 3300006162 | Watersheds | MPQRISNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0075030_1002686452 | 3300006162 | Watersheds | PNSHLPACWLHILVCPRRYLAVLPSQARPSLFGSD* |
Ga0075030_1005999572 | 3300006162 | Watersheds | PHAQSAECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070715_100225652 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLQNPNSHLPVCWLRQLCCPRRHLAVLPSQVRPNLFGCD* |
Ga0075018_100391153 | 3300006172 | Watersheds | MRRQTPNSCWLHFLVCPRRYLAVLPSQARPSLFGSD* |
Ga0070716_1007043052 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MEIEPVMHFQNANSHLPACWLHMLVCPRRYLAVLPSQSRPSLFGSD* |
Ga0070716_1009847741 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQTHPNSRVAPRNSAECWLHSMVCPRRYRANLPSRLRPSL |
Ga0075014_1000659752 | 3300006174 | Watersheds | MNLQNPNSHLPVCWLHQLVCPRRHLAVLPSQVRPSLFGSD* |
Ga0075014_1001147131 | 3300006174 | Watersheds | MLRKNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGS |
Ga0075014_1004124952 | 3300006174 | Watersheds | MLHNHPNSRLPHAQSAECWLHSLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070712_1003974771 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NPNSHLPECWLRCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070765_1000994852 | 3300006176 | Soil | MLHNKSNSAMANSHLLPVQSAECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0070765_1001952712 | 3300006176 | Soil | MRHQKSNSHLPACWLHSLVCPRRHLAVLPSRSRPSLFGSD* |
Ga0070765_1006100801 | 3300006176 | Soil | SVKTWLPMLRNVSRSHEPNSHLPECWLHCLLRPRRYRANLPSRLRPSLFGSD* |
Ga0075021_102864093 | 3300006354 | Watersheds | MRHQQPNSHLPACWLQSLVCPRRYLAVLPSQARPSLFGSD* |
Ga0068871_1005228942 | 3300006358 | Miscanthus Rhizosphere | MRHQKPNSHLPVCWLQFLVCPRRYLAVLPSQARPSLFGSD |
Ga0068871_1008795101 | 3300006358 | Miscanthus Rhizosphere | SVVMRLQNLNSHKPACWLQSLVCPRRYLSVLPSQARPNLFGSD* |
Ga0075521_103987122 | 3300006642 | Arctic Peat Soil | MLRNKPNSRLPKALRALVLRSECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0079222_110133931 | 3300006755 | Agricultural Soil | MESPMRFKNPNSHLPACCLHMLVCPRRYLAVLPSHIHQAPVLSVV |
Ga0079221_100659202 | 3300006804 | Agricultural Soil | MLQTHPNSRVAPRNSAECWLHSMVCPRRYRANLPSRLRPSLFGSD* |
Ga0079221_102004212 | 3300006804 | Agricultural Soil | MRALHNPNAHLPACWLHRLVCPRRCLAVLPSQARPSLFGSD* |
Ga0075425_1009979112 | 3300006854 | Populus Rhizosphere | NDQGKSELISMRFLNPNSHLPACWLHFLVCPRRYRAVLPARLRPNLFGGD* |
Ga0073928_10000066156 | 3300006893 | Iron-Sulfur Acid Spring | MLRNKLNSHLRNPHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0073928_103522452 | 3300006893 | Iron-Sulfur Acid Spring | EGVTPPVGSGYMGKECRPMRHQKPNSHLPACWLHFLVCPRRYLAVLPSQARPSLFGSD* |
Ga0073928_103533022 | 3300006893 | Iron-Sulfur Acid Spring | MLRNKSNSHLPDSNQAEGRLPCLVYPSMLCPRRYWAVLPSRLRPSLFASD* |
Ga0079219_110511212 | 3300006954 | Agricultural Soil | MRVRCVNANLPACWLHCLVCPRRYLAVLPSQARPSLFGSD* |
Ga0079219_115019222 | 3300006954 | Agricultural Soil | MLQTHPNSRVVPRNSAECWLHSLVCPRRYRANLPSRLRPSLFGSD* |
Ga0075435_1007471681 | 3300007076 | Populus Rhizosphere | MRAQNPNSHLPACWLHQLVCPRRYLAVLPSRARANLFGSD* |
Ga0099793_101462852 | 3300007258 | Vadose Zone Soil | MSLQNANSRLPVCWLQQLVCPRRHLAVLPSQVRPSLFGSD* |
Ga0102924_12745281 | 3300007982 | Iron-Sulfur Acid Spring | MLRNVPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFG |
Ga0099829_1000026618 | 3300009038 | Vadose Zone Soil | MRHQNPNSHLPMCWLDSLVGPRRHLAVLPSQARPSLFGSD* |
Ga0099830_100422523 | 3300009088 | Vadose Zone Soil | MRQQNPNSHLPVCWLHLLVCPRRYLAVLPSQARPGLFGSD* |
Ga0099830_114395572 | 3300009088 | Vadose Zone Soil | MLRNQPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0099828_118075201 | 3300009089 | Vadose Zone Soil | NSHLPACWLHMLVCPRRYLAVLPSQVRPSLFGSD* |
Ga0099827_1000019713 | 3300009090 | Vadose Zone Soil | MRHQNPNSHLPVCWLDSLVGPRRHLAVLPSQVRPSLFGSD* |
Ga0099827_100576343 | 3300009090 | Vadose Zone Soil | MRDDKPNSHLPVCWLHFIVCPRRYIAVLPSHARPSLIGSD* |
Ga0116222_13457321 | 3300009521 | Peatlands Soil | SNSLLSSHLPECWLHCLVCPRRYRANLPSRLRPNLFGSD* |
Ga0116221_10226604 | 3300009523 | Peatlands Soil | MLPRIPNSRLPYASPAECWLHCLVCPRRYRANLPSRLRPNLFGSD* |
Ga0116221_10279942 | 3300009523 | Peatlands Soil | MLRKNPNSRLPNAHLPECWLHCLVCPRRYRANLPSRLRPNLFGSD* |
Ga0116133_10544683 | 3300009623 | Peatland | MLHNVSNSNQPNAHRPECWLHCLVCPSMLCPRRYRANLPSRLRPSLFGS |
Ga0116133_11437771 | 3300009623 | Peatland | MLQKNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLF |
Ga0116105_10410231 | 3300009624 | Peatland | MLRKNSNSRRANLHPVYADLSECWLHCLVCPRRYRAN |
Ga0116105_10485851 | 3300009624 | Peatland | MLHNVSNSNQPNAHRPECWLHCLVCPSMLCPRRYRANLPSRLRPSL |
Ga0116135_14953392 | 3300009665 | Peatland | MLRNHPNSRRPNLQPVYADLSECWLHCLVCPRRYRANL |
Ga0116101_11340342 | 3300009759 | Peatland | MLRHTYNSRLPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFG |
Ga0126374_106776361 | 3300009792 | Tropical Forest Soil | MRATKSNSRLSAWFDMLVCPRRYLAVLPSHSRPSLFGS |
Ga0126374_109385301 | 3300009792 | Tropical Forest Soil | MKCCNSMNLQNSNSHLPACWLHQLCCPRRHLAVLPSQVRPNLFGSD* |
Ga0126380_107200462 | 3300010043 | Tropical Forest Soil | MRATKSNSRLSARFDMLVRPRRYLAVLPSHSRPSLFGSD* |
Ga0126384_105375332 | 3300010046 | Tropical Forest Soil | MRATKSNSRLSAQFDMLVRPRRYLAVLPSHSRPSLFGSD* |
Ga0126372_110829452 | 3300010360 | Tropical Forest Soil | MVAGMRATKSNSRLSAWFDMLVCPRRYLAVLPSHSRPSLFGSD* |
Ga0134125_100459478 | 3300010371 | Terrestrial Soil | MPQPKLNTHLPECWLHFLVGPRRFRAVLPSNRRPSLFGSD* |
Ga0134125_102328083 | 3300010371 | Terrestrial Soil | MLQPKLNTHLPECWLHFLVGPRRFRAVLPSNRRPGLFGSD* |
Ga0126381_10000503110 | 3300010376 | Tropical Forest Soil | MLRGNSISHPFGLQSAECWLDGLVCPRRYRANLPSRLRPNLFGSD* |
Ga0126381_1033274591 | 3300010376 | Tropical Forest Soil | MLPRNPNSRLVHAQSAECWLDGLVCPRRYRAILPSRLR |
Ga0126381_1035855282 | 3300010376 | Tropical Forest Soil | MVAGMRATKSNSRLSARFDMLVRPRRYLAVLPSHSRPSLFGSD* |
Ga0136449_1004551092 | 3300010379 | Peatlands Soil | MYQCENPNLHLPECWLHFLVGPRRYRAVLPSRRRPSLFGSD* |
Ga0136449_1010839602 | 3300010379 | Peatlands Soil | MIQVCVPMRHQNSNSHLPVCWLHFLVCPRRYLAVLPSQARPSLFGS |
Ga0134126_103674922 | 3300010396 | Terrestrial Soil | FRNPNSHLPACWLHMLVCPRRYLAVLPSNTRPSLFGSD* |
Ga0137389_114326242 | 3300012096 | Vadose Zone Soil | MRQQNPNSHLPVCWLHLLVCPRRYLAVLPSQARPGLFG |
Ga0137389_118289471 | 3300012096 | Vadose Zone Soil | EFLKMRQQNPNSHLPVCWLHFLVCPRRYRAVLPSQARPNLFGSD* |
Ga0137363_100522454 | 3300012202 | Vadose Zone Soil | MRHQNPNSHLPVCWLDFLVCPRRHLAGLPSQARPSLFGSD* |
Ga0150985_1104554192 | 3300012212 | Avena Fatua Rhizosphere | VDMRFTNPNSHLPACWIHFLVCPRPHLAVLPSQARPNLFGSD* |
Ga0137390_100037976 | 3300012363 | Vadose Zone Soil | MAQKNPNSHLPECWLHCLVCPRRYRAVLPSRLRPSLFGSD* |
Ga0137390_106399062 | 3300012363 | Vadose Zone Soil | MAQKNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGS |
Ga0137390_113856801 | 3300012363 | Vadose Zone Soil | NPNSHLPACWLHMLVCPRRYLAVLPSQVRPSLFGSD* |
Ga0126369_100686351 | 3300012971 | Tropical Forest Soil | MCPERPNSHLPACWLHFLVCPRRYLAVLPSQARPN |
Ga0157374_129862551 | 3300013296 | Miscanthus Rhizosphere | MLQKNPNSRLPMSNAAECWLHCLVCPRRYRANLPSRLRPSLF |
Ga0181534_101785231 | 3300014168 | Bog | MLHKNSNSLPNAPLVGSTRPECWLHSLVCPRRYRA |
Ga0182018_106605652 | 3300014489 | Palsa | MLRNRPNSHLPECWLHCLVCPRRYRANLPSRLRPSLF |
Ga0182014_104085151 | 3300014491 | Bog | MYQCENPNLHLPDCWLHFLVGPRRYRAVLPSRLRPSLFGSD* |
Ga0182024_1000632523 | 3300014501 | Permafrost | MRYQSPNSHLPACWLQFLVCPRRHLAVLPSQARPSLFGSD* |
Ga0181525_100464341 | 3300014654 | Bog | MLRNHSNSRRPNLQPVYADLSECWLHCLVCPRRYRANLPSRLRPSLF |
Ga0182030_101186693 | 3300014838 | Bog | MLRNNSNSALPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD* |
Ga0182027_120047912 | 3300014839 | Fen | MYQCENPNLHLPDCWLHFLVGPRRYRAVLPSRLRPSLFG |
Ga0137418_108649381 | 3300015241 | Vadose Zone Soil | MLRKNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0132257_1019887951 | 3300015373 | Arabidopsis Rhizosphere | MRHHNPNSHLPVCWLDSLVCPRRHLAVLPSQARPSL |
Ga0187802_103364631 | 3300017822 | Freshwater Sediment | MLRNKSNSHLSNSHLPECWLHCLVCPRRYRANLPSRLRP |
Ga0187824_1000003317 | 3300017927 | Freshwater Sediment | MRHQKPNSHLPVCWLHFLVCPRRYLAVLPSQARPSLFGSD |
Ga0187825_100012457 | 3300017930 | Freshwater Sediment | SMTLQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPSLFGSD |
Ga0187819_100338813 | 3300017943 | Freshwater Sediment | MRTNLLNSHLPECWLHQLVCPRRYRAVLPSCVRANLFGSD |
Ga0187817_100031649 | 3300017955 | Freshwater Sediment | MLQKNPNSHLPYSPRAYSPRTECWLHSLVCPRRYRANLPSRLRPNLFGSD |
Ga0187779_100010191 | 3300017959 | Tropical Peatland | MHSHLLNSHLPECWLHQLVCPRRYRAVLPSCVRANLFGSD |
Ga0187783_102285841 | 3300017970 | Tropical Peatland | MLRRNSNSNLPDSHLPECWLHCLVCPRRYRAVLPSRLRPNLFGSD |
Ga0187781_105593462 | 3300017972 | Tropical Peatland | MLDKNSNSLLHSHLPECWLHCLVCPRRYRANLPSRLRPNLFGSD |
Ga0187782_104549042 | 3300017975 | Tropical Peatland | MLDKNSNSLLHSHLPECWLHRLVCPRRYRANLPSRLRPNLFGSD |
Ga0187816_101473042 | 3300017995 | Freshwater Sediment | MLRNKSNSHLSNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0187784_100082492 | 3300018062 | Tropical Peatland | MLRENPNSYLPECWLDGSPCPRRYRAVLPSRLRPSLFGSD |
Ga0187769_100451244 | 3300018086 | Tropical Peatland | QLTNSHLPACWLRSLVCPRRYRAVLPSRLRPNLFGSD |
Ga0187769_105012552 | 3300018086 | Tropical Peatland | MFTMLRQESNSLLHSHLPECWLHCLVCPRRYRANLPSRLRPNLF |
Ga0187769_106459512 | 3300018086 | Tropical Peatland | LPHAQSAECWLHSLVCPRRYRANLPSRLRPNLFGSD |
Ga0187769_107527782 | 3300018086 | Tropical Peatland | ILTMVCVPMRFQGSNTHLPACWLQMLVCPRRYRALLPSRLRPNLFGSD |
Ga0187771_100289154 | 3300018088 | Tropical Peatland | MRYQLTNSHLPVCWLHFLVCPRRYRAVLPSRLRPNLFGSD |
Ga0187771_107884412 | 3300018088 | Tropical Peatland | MRFLGSNSRLPVCWLRMLVCPRRYRAVLPSRLRPNLF |
Ga0187770_102325472 | 3300018090 | Tropical Peatland | MLRNNPNSHLPECWLRSLVCPRRYRANLPSRLRPNLFGSD |
Ga0187770_103271542 | 3300018090 | Tropical Peatland | MLRYDLKSSLAGSRLPECWLHCLVCPRRYRANLPSRLRPNLFGSD |
Ga0181508_11912294 | 3300019256 | Peatland | IAMLQKNLNSHLPLSLRAECWLDCLVCPRRYRANLPSRLRPSLFGSD |
Ga0187797_12959911 | 3300019284 | Peatland | RFQGSNSHLPACWLQMLVCPRRYRAVLPSRLRPNLFGSD |
Ga0193729_10838301 | 3300019887 | Soil | MRHQTSNSHLPVCWLDFLVCPRRHLAVLPSQVRPSL |
Ga0210407_100363603 | 3300020579 | Soil | MNLQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPNLFGCD |
Ga0210407_109763711 | 3300020579 | Soil | MRHKNSNPHLPACWLHFLVCPRRYLAVLPSQARPSL |
Ga0210399_102967131 | 3300020581 | Soil | PMRHQKPNSHLPVCWLHFLVCPRRYLAVLPSQARPSLFGSD |
Ga0210395_103183731 | 3300020582 | Soil | ENSNSHLHACWLHFLVCPRRYLAVLPSQARPSLFGSD |
Ga0210404_104562562 | 3300021088 | Soil | MNLQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPSLFGSD |
Ga0210405_113665622 | 3300021171 | Soil | MRRRNPNSNLPECWLHFLVCPRRYLAVLPSQARPSLFGS |
Ga0210408_109067181 | 3300021178 | Soil | MGKECRPMRHQKLNSHLPVCWLHFLVCPRRYLAVLPSQARPSLFGSD |
Ga0210393_109788212 | 3300021401 | Soil | MLRNVSNSLLNSHKPECWLQSLVCPRRYRANLPSRLRPSL |
Ga0210389_108562072 | 3300021404 | Soil | MLRNVPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGS |
Ga0210386_1000245519 | 3300021406 | Soil | MRHQKPNSHLPACWLHFLVCPRRYLAVLPSQARPSLFGSD |
Ga0210383_100663432 | 3300021407 | Soil | MQRKNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0210394_100556011 | 3300021420 | Soil | MLRNNPHSRVPYTLRAECWLDGLVCPRRYRANLPSRLRPSLFGSD |
Ga0210390_103924091 | 3300021474 | Soil | RRQNPNSHLPACWLHFLVCPRRYLAVLPAQARPSLFGSD |
Ga0210402_1000227723 | 3300021478 | Soil | MRRENPNSNLPACWLHFLVCPRRYLAVLPSQARPSLFGSD |
Ga0210409_104561122 | 3300021559 | Soil | MRHQNPNSHLPVCWLDFLVCPRRHLAVLPSQARPS |
Ga0213854_12517051 | 3300021855 | Watersheds | VPTMRFDLSNSHLPSCWLHFLVGPRRYLAVLPSHTRPSLFGSD |
Ga0242660_10007771 | 3300022531 | Soil | RLAMLRNKPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0212123_1000074770 | 3300022557 | Iron-Sulfur Acid Spring | MLRNKLNSHLRNPHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0224569_1165001 | 3300022732 | Rhizosphere | MLRNVSNSCLPNAHLPECWLHCLVCPRRYRANLPSRLRPSLFGS |
Ga0224572_10133041 | 3300024225 | Rhizosphere | MLRNVSNSILFGAAGNLHMRECWLDCLVCPRRYRANLPSRL |
Ga0208194_10001323 | 3300025412 | Peatland | MLRHTYNSRLPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0207685_100697923 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLQNPNSHLPVCWLRQLCCPRRHLAVLPSQVRPN |
Ga0207654_100362871 | 3300025911 | Corn Rhizosphere | KRVTIKTMRFTSPNSHLPACWLHMLVCPRRYLAVLPSNTRPSLFGSD |
Ga0207654_102407762 | 3300025911 | Corn Rhizosphere | MRFTSPNSHLPACWLHMLVCPRRYLAVLPSNTRPSL |
Ga0207646_101951501 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KSLMRQQNPNSHLPVCWLHGLVCPRRYRAVLPSQARPNLFGSD |
Ga0207646_107281631 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRQQNPNSHLPVCWLHGLVCPRRYRAVLPSQARPNLF |
Ga0207651_108177001 | 3300025960 | Switchgrass Rhizosphere | NRDIMLVRRSSNSHLPECWLHFLVGPRRYRAVLPSNRRPSLFGGD |
Ga0209235_10175012 | 3300026296 | Grasslands Soil | MRQQNPNSHLPVCWLHFLVCPRRYRAVLPSQARPNLFGSD |
Ga0209471_11712461 | 3300026318 | Soil | MLHNKPNSHLPECWLHCLVCPRRYRANLPTRLRPNLFGSD |
Ga0209687_10634531 | 3300026322 | Soil | MKMYLPFNMRRDHANSHLPACWLHCLVCPRRYLAVLPSQARPNLFGSD |
Ga0209115_10000518 | 3300027567 | Forest Soil | MLHNNPNSRQPHLHLVYADLSECWLHCLVCPRRYRANLPSHLRPSLFGSD |
Ga0209116_10778071 | 3300027590 | Forest Soil | AMLHNNPNSRQPHLHLVYADLSECWLHCLVCPRRYRANLPSHLRPSLFGSD |
Ga0209329_11092491 | 3300027605 | Forest Soil | MLRNQPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0209007_10729611 | 3300027652 | Forest Soil | MLHKVSNSCLPNAHLPECWLHCLVCPRRYRANLPSRLRPSL |
Ga0209333_10024497 | 3300027676 | Forest Soil | MLRNKSNSLQPKSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0209448_100260462 | 3300027783 | Bog Forest Soil | MLRYVSNSCMPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0209180_102376541 | 3300027846 | Vadose Zone Soil | MLRNKPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0209274_100021537 | 3300027853 | Soil | MLRNKSNSLQPDSNLLSSNLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0209517_1000084241 | 3300027854 | Peatlands Soil | MLRKNPNSRLPNAHLPECWLHCLVCPRRYRANLPSRLRPNLFGSD |
Ga0209693_103572021 | 3300027855 | Soil | RNKSNSLQPDSNLLSSNLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0209166_100084514 | 3300027857 | Surface Soil | MLRKLLNSHMPECWLDSLVCPRRYRANLPSRLRPNLFGSD |
Ga0209701_100223703 | 3300027862 | Vadose Zone Soil | MRQQNPNSHLPVCWLHLLVCPRRYLAVLPSQARPGLFGSD |
Ga0209167_101856052 | 3300027867 | Surface Soil | MRFQNPNSHLPACWLHSLVCPRRYRAVLPSRLRPNLFGSD |
Ga0209283_100359195 | 3300027875 | Vadose Zone Soil | MRHQNPNSHLPVCWLDSLVGPRRHLAVLPSQARPSLFGSD |
Ga0209169_104540861 | 3300027879 | Soil | MLRNHPNSRRPHLQIVYADLSECWLHCLVGPRRYRANLPSRLRPSLFGS |
Ga0209624_105920961 | 3300027895 | Forest Soil | CANSHLPVCWLNFLVCPRRHLAVLPSQARPSLFGSD |
Ga0209698_100380276 | 3300027911 | Watersheds | MRYQKPNSHLPVCWLHFLVCPRRYLAVLPSQARPSLFGSD |
Ga0224573_10083521 | 3300028019 | Roots | MLRNVSNSILFGAAGNLHMRECWLDCLVCPRRYRANL |
Ga0265351_10233782 | 3300028020 | Soil | MLRNKPNSHLPNSHLPECWLHCLVCPRRYRANLPSRL |
Ga0209526_102088271 | 3300028047 | Forest Soil | MLRNVSNSKLPNHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0209526_107829301 | 3300028047 | Forest Soil | MRHQNPNSNLRVCWLPLPVCPRRHLAVLPSQARPSLFGSD |
Ga0137415_1000003746 | 3300028536 | Vadose Zone Soil | MSLQNANSRLPVCWLQQLVCPRRHLAVLPSQVRPSLFGSD |
Ga0302144_102700461 | 3300028560 | Bog | MLRNIHNSPLPNSHLPECWLHCLVCPRRYRANLPSRLRPSLF |
Ga0302221_101739191 | 3300028806 | Palsa | PMLRNVPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0311362_100564793 | 3300029913 | Bog | MLRQNSNSHLLYLNQAECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0302178_102953952 | 3300030013 | Palsa | MLRNVSNSPQPNSHLPECWLQSLVCPRRYRANLPSRLRPSL |
Ga0311370_100196924 | 3300030503 | Palsa | MLRNHPNSRRPNLQPVYADLSECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0310038_100351511 | 3300030707 | Peatlands Soil | PNSHLPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0302325_102511424 | 3300031234 | Palsa | MLRNKPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFASD |
Ga0302325_116250611 | 3300031234 | Palsa | MLRNKSNSHLPECWLHCLVCPRRYRANLPSRLRPSL |
Ga0302324_1001396502 | 3300031236 | Palsa | MLRNISNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0302324_1004185963 | 3300031236 | Palsa | RNKPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFASD |
Ga0302320_100138198 | 3300031524 | Bog | MLRHIYNSRLPNSHLPECWLHCLVCPRRYRATLPSRLRPSLFGSD |
Ga0310686_1114841961 | 3300031708 | Soil | MRHQDPNSHLPACWLHFLVCPRRYLAVLPSQARPS |
Ga0307476_101997281 | 3300031715 | Hardwood Forest Soil | RFAMLRHNPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0307468_1008906381 | 3300031740 | Hardwood Forest Soil | MNLHNVNSHLPVCWLHQLCCPRRHLAVLPSQVRPNL |
Ga0307477_100260563 | 3300031753 | Hardwood Forest Soil | MQRKNPNSHLPECWLHCLVCPRRYRSVLPARLRPSLFGSD |
Ga0318544_101057371 | 3300031880 | Soil | MNAWIVVFMTLQNPNSHLPACWLHQLCCPRRHLAVLPSQ |
Ga0306921_118793962 | 3300031912 | Soil | NPNSHLPVCWLRELVCPRRYLAVLPSHARANLFGSD |
Ga0308175_1011730811 | 3300031938 | Soil | RFNSPNSHLPACWLHMLVCPRRYLAVLPSNTRPSLFGSD |
Ga0310916_100431155 | 3300031942 | Soil | MNAWIVVFMTLQNPNSHLPACWLHQLCCPRRHLAVLPSQVRPSLFGSD |
Ga0307479_100916051 | 3300031962 | Hardwood Forest Soil | RCLLMQRKNPNSHLPECWLHCLVCPRRYRSVLPARLRPSLFGSD |
Ga0307479_101104661 | 3300031962 | Hardwood Forest Soil | MLRNVSNSCLPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0308173_105123472 | 3300032074 | Soil | MVRFNSPNSHLPACWLHMLVCPRRYLAVLPSNTRPSLFGSD |
Ga0348332_114758331 | 3300032515 | Plant Litter | RQWLPMLRNKSNSRLPNAHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0335079_100491804 | 3300032783 | Soil | MKLTTVQFKNPNSHLPACWLHMLVCPRRYLAVLPSQLRPSLFGSD |
Ga0335079_122692012 | 3300032783 | Soil | MVCGICARMLRNRPNSHLPECWLHCLVCPRRYRANLPSRLRPS |
Ga0335078_1000032368 | 3300032805 | Soil | MLQKNSNSRFPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFASD |
Ga0335078_1000045812 | 3300032805 | Soil | MRMQDSNTHLPACWLQPLVCPRRYRAVLPSRLRPSLFGSD |
Ga0335078_100898425 | 3300032805 | Soil | MRRAFANSRLPECWLHFLVGPRRYRAVLPSRLRPSLFGSD |
Ga0335070_100020723 | 3300032829 | Soil | MRFQTANSHLPVCWLHCLVCPRRYLAVLPSQARPNLFGSD |
Ga0335069_100796696 | 3300032893 | Soil | MRYQGSNSHLPACWLQSLVCPRRYRAVLPSNLRPSLFGSD |
Ga0335072_104213642 | 3300032898 | Soil | MLQKNSNSRFPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0335084_108599572 | 3300033004 | Soil | MNMTMRLQNPNSHLPVCWLHFLVCPRRYLAGLPSQARPNLFGSD |
Ga0335073_102239431 | 3300033134 | Soil | MKSRPMQFKNPNSHLPACWLHMLVCPRRYLAVLPSQLRPSLFGSD |
Ga0335077_100809941 | 3300033158 | Soil | NRNGVPVRLQNPNSHLPACWLHFLVGPRRHLAVLPSQARPSLFGSD |
Ga0371489_0023230_4751_4897 | 3300033755 | Peat Soil | WLPMLRNVSNSHPPNSHLPECWLHCLVCPRRYRANLPSRLRPSLFGSD |
Ga0314867_003571_3017_3139 | 3300033808 | Peatland | MRFQGSNSHLPACWLHFLVCPRRYRAVLPSRLRPNLFGSD |
Ga0314861_0009365_2891_3028 | 3300033977 | Peatland | MLQKNTQLRLPYFNRAECWLHCLVCPRRYRANLPSRLRPNLFGSD |
Ga0372943_0779735_484_606 | 3300034268 | Soil | MRFQNPNSHTPACWLQSLVSPRRYLAVLPSQARPNLFGSD |
⦗Top⦘ |