Metagenome / Metatranscriptome Family F009109

Basic Information
Family ID	F009109
Family Type	Metagenome / Metatranscriptome
Number of Sequences	323
Average Sequence Length	43 residues
Representative Sequence	MTLQEAKSIARHLGLTLRKVRSGDYRVNFRDGNETTAYY
Number of Associated Samples	183
Number of Associated Scaffolds	323

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	51.70 %
% of genes near scaffold ends (potentially truncated)	93.81 %
% of genes from short scaffolds (< 2000 bps)	94.43 %
Associated GOLD sequencing projects	168
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (98.762 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.294 % of family members)
Environment Ontology (ENVO)	Unclassified (54.180 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (47.988 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 16.42% β-sheet: 14.93% Coil/Unstructured: 68.66%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 323 Family Scaffolds
PF12625	Arabinose_bd	14.24
PF12833	HTH_18	3.72
PF04392	ABC_sub_bind	2.79
PF13676	TIR_2	1.55
PF14020	DUF4236	1.24
PF02627	CMD	0.93
PF00589	Phage_integrase	0.62
PF00072	Response_reg	0.31
PF00196	GerE	0.31
PF00149	Metallophos	0.31
PF03795	YCII	0.31
PF08239	SH3_3	0.31
PF08281	Sigma70_r4_2	0.31
PF06411	HdeA	0.31
PF14373	Imm_superinfect	0.31
PF04542	Sigma70_r2	0.31
PF09084	NMT1	0.31
PF00486	Trans_reg_C	0.31
PF07045	DUF1330	0.31
PF01494	FAD_binding_3	0.31
PF12770	CHAT	0.31
PF01315	Ald_Xan_dh_C	0.31
PF10881	DUF2726	0.31
PF04241	DUF423	0.31
PF00999	Na_H_Exchanger	0.31
PF13649	Methyltransf_25	0.31
PF13924	Lipocalin_5	0.31

COG ID	Name	Functional Category	% Frequency in 323 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	2.79
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.93
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.93
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	0.62
COG0025	NhaP-type Na+/H+ or K+/H+ antiporter	Inorganic ion transport and metabolism [P]	0.31
COG0475	Kef-type K+ transport system, membrane component KefB	Inorganic ion transport and metabolism [P]	0.31
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.31
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.31
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.31
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.31
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.31
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.31
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.31
COG2350	YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.31
COG2363	Uncharacterized membrane protein YgdD, TMEM256/DUF423 family	Function unknown [S]	0.31
COG3004	Na+/H+ antiporter NhaA	Energy production and conversion [C]	0.31
COG3263	NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains	Energy production and conversion [C]	0.31
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.31
COG4651	Predicted Kef-type K+ transport protein, K+/H+ antiporter domain	Inorganic ion transport and metabolism [P]	0.31
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.31
COG5470	Uncharacterized conserved protein, DUF1330 family	Function unknown [S]	0.31

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.76 %
Unclassified	root	N/A	1.24 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.76 %
Unclassified	root	N/A	1.24 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.76 %
Unclassified	root	N/A	1.24 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	95.36 %
Unclassified	root	N/A	1.24 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.31 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	91.64 %
Unclassified	root	N/A	1.24 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.31 %

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	80.19 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6.50 %
Unclassified	root	N/A	1.24 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.31 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	80.19 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	2.17 %
Unclassified	root	N/A	1.24 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.31 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.93 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	80.19 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.17 %
Unclassified	root	N/A	1.24 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.31 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	80.19 %
Unclassified	root	N/A	1.24 %
unclassified Bradyrhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium	0.31 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.31 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.31 %
unclassified Methylobacterium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium	0.93 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.62 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	80.19 %
Unclassified	root	N/A	1.24 %
Bradyrhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	0.31 %
Rhizobium leguminosarum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	0.31 %
Bradyrhizobium erythrophlei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	0.31 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.31 %
Methylobacterium sp. E-025	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-025	0.93 %
Bradyrhizobium diazoefficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	0.62 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000597\|AF_2010_repII_A1DRAFT_10051312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1071	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10160965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	537	Open in IMG/M
3300000597\|AF_2010_repII_A1DRAFT_10164938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	529	Open in IMG/M
3300000793\|AF_2010_repII_A001DRAFT_10072031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	746	Open in IMG/M
3300000955\|JGI1027J12803_100528340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	683	Open in IMG/M
3300002910\|JGI25615J43890_1083458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	560	Open in IMG/M
3300004629\|Ga0008092_11278310	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1784	Open in IMG/M
3300004633\|Ga0066395_10209200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	1026	Open in IMG/M
3300005167\|Ga0066672_10527458	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	765	Open in IMG/M
3300005332\|Ga0066388_104559792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	705	Open in IMG/M
3300005332\|Ga0066388_105324543	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	652	Open in IMG/M
3300005332\|Ga0066388_105801863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	624	Open in IMG/M
3300005332\|Ga0066388_106810735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	575	Open in IMG/M
3300005332\|Ga0066388_108007812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	528	Open in IMG/M
3300005337\|Ga0070682_100966060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	705	Open in IMG/M
3300005356\|Ga0070674_100446588	All Organisms → cellular organisms → Bacteria → Proteobacteria	1066	Open in IMG/M
3300005356\|Ga0070674_102087925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	517	Open in IMG/M
3300005536\|Ga0070697_100176010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1812	Open in IMG/M
3300005713\|Ga0066905_100366749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1156	Open in IMG/M
3300005713\|Ga0066905_100453052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1055	Open in IMG/M
3300005713\|Ga0066905_100663729	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	890	Open in IMG/M
3300005713\|Ga0066905_102135594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	521	Open in IMG/M
3300005713\|Ga0066905_102235319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	510	Open in IMG/M
3300005764\|Ga0066903_100412507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2230	Open in IMG/M
3300005764\|Ga0066903_100653542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.	1839	Open in IMG/M
3300005764\|Ga0066903_101532121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1260	Open in IMG/M
3300005764\|Ga0066903_102502670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	999	Open in IMG/M
3300005764\|Ga0066903_104502169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	743	Open in IMG/M
3300005764\|Ga0066903_104727337	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	725	Open in IMG/M
3300005764\|Ga0066903_106106227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	630	Open in IMG/M
3300005764\|Ga0066903_106572198	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	605	Open in IMG/M
3300005764\|Ga0066903_108635812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	518	Open in IMG/M
3300006028\|Ga0070717_11696851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	572	Open in IMG/M
3300006038\|Ga0075365_10168421	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1529	Open in IMG/M
3300006163\|Ga0070715_10105034	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1324	Open in IMG/M
3300006175\|Ga0070712_100898179	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	764	Open in IMG/M
3300006176\|Ga0070765_102094072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	529	Open in IMG/M
3300006576\|Ga0074047_11800261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	577	Open in IMG/M
3300006581\|Ga0074048_13342545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	670	Open in IMG/M
3300006791\|Ga0066653_10348940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	750	Open in IMG/M
3300006845\|Ga0075421_100162541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2786	Open in IMG/M
3300006904\|Ga0075424_102697499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	519	Open in IMG/M
3300009100\|Ga0075418_11474644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	738	Open in IMG/M
3300009100\|Ga0075418_12762188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	536	Open in IMG/M
3300009137\|Ga0066709_100656243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1503	Open in IMG/M
3300009148\|Ga0105243_12253272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	582	Open in IMG/M
3300009156\|Ga0111538_12762076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	615	Open in IMG/M
3300009162\|Ga0075423_10571681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1190	Open in IMG/M
3300009177\|Ga0105248_11078885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	907	Open in IMG/M
3300009792\|Ga0126374_10679364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	771	Open in IMG/M
3300010043\|Ga0126380_10414965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1005	Open in IMG/M
3300010043\|Ga0126380_10441452	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	980	Open in IMG/M
3300010043\|Ga0126380_10884514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	740	Open in IMG/M
3300010043\|Ga0126380_11393758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	615	Open in IMG/M
3300010046\|Ga0126384_10033076	All Organisms → cellular organisms → Bacteria → Proteobacteria	3448	Open in IMG/M
3300010046\|Ga0126384_10472297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1075	Open in IMG/M
3300010046\|Ga0126384_10944572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	782	Open in IMG/M
3300010046\|Ga0126384_11226175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	693	Open in IMG/M
3300010047\|Ga0126382_10215616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1378	Open in IMG/M
3300010047\|Ga0126382_12427048	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	510	Open in IMG/M
3300010048\|Ga0126373_11014062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	895	Open in IMG/M
3300010333\|Ga0134080_10319868	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	700	Open in IMG/M
3300010359\|Ga0126376_12285444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	586	Open in IMG/M
3300010360\|Ga0126372_11847866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	648	Open in IMG/M
3300010360\|Ga0126372_12692081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	549	Open in IMG/M
3300010361\|Ga0126378_10232554	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1931	Open in IMG/M
3300010361\|Ga0126378_12050983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	652	Open in IMG/M
3300010366\|Ga0126379_12066967	All Organisms → cellular organisms → Bacteria	672	Open in IMG/M
3300010366\|Ga0126379_12626152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	601	Open in IMG/M
3300010366\|Ga0126379_13228973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	546	Open in IMG/M
3300010373\|Ga0134128_12822339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	535	Open in IMG/M
3300010375\|Ga0105239_10936645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	995	Open in IMG/M
3300010376\|Ga0126381_104335165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	549	Open in IMG/M
3300010397\|Ga0134124_12501550	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	558	Open in IMG/M
3300010398\|Ga0126383_10712800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1082	Open in IMG/M
3300010398\|Ga0126383_10796219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1028	Open in IMG/M
3300010398\|Ga0126383_11998672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	667	Open in IMG/M
3300010398\|Ga0126383_13211324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	534	Open in IMG/M
3300010403\|Ga0134123_12681295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	566	Open in IMG/M
3300010868\|Ga0124844_1013801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2116	Open in IMG/M
3300011107\|Ga0151490_1764609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	510	Open in IMG/M
3300012201\|Ga0137365_10139625	All Organisms → cellular organisms → Bacteria	1822	Open in IMG/M
3300012201\|Ga0137365_10307989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1173	Open in IMG/M
3300012201\|Ga0137365_10853980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	665	Open in IMG/M
3300012202\|Ga0137363_10113536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2079	Open in IMG/M
3300012208\|Ga0137376_11374355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300012211\|Ga0137377_10395271	All Organisms → cellular organisms → Bacteria	1320	Open in IMG/M
3300012211\|Ga0137377_11358192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	640	Open in IMG/M
3300012232\|Ga0137435_1194744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	622	Open in IMG/M
3300012356\|Ga0137371_11268528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	547	Open in IMG/M
3300012582\|Ga0137358_10350302	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1000	Open in IMG/M
3300012683\|Ga0137398_10115211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1709	Open in IMG/M
3300012941\|Ga0162652_100028641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	823	Open in IMG/M
3300012948\|Ga0126375_10733138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	774	Open in IMG/M
3300012961\|Ga0164302_11518023	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	553	Open in IMG/M
3300012971\|Ga0126369_13373395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	523	Open in IMG/M
3300012984\|Ga0164309_11841814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	519	Open in IMG/M
3300012986\|Ga0164304_11031130	Not Available	653	Open in IMG/M
3300013102\|Ga0157371_10309208	All Organisms → cellular organisms → Bacteria → Proteobacteria	1145	Open in IMG/M
3300015371\|Ga0132258_12232442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1374	Open in IMG/M
3300015371\|Ga0132258_13063391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1157	Open in IMG/M
3300015372\|Ga0132256_100352528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1566	Open in IMG/M
3300015372\|Ga0132256_101331706	Not Available	830	Open in IMG/M
3300015373\|Ga0132257_101422317	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	883	Open in IMG/M
3300015374\|Ga0132255_100871397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1345	Open in IMG/M
3300016270\|Ga0182036_10383062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1091	Open in IMG/M
3300016270\|Ga0182036_10636621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	858	Open in IMG/M
3300016270\|Ga0182036_11163508	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	640	Open in IMG/M
3300016270\|Ga0182036_11834394	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	514	Open in IMG/M
3300016294\|Ga0182041_10130025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1907	Open in IMG/M
3300016294\|Ga0182041_11313098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	662	Open in IMG/M
3300016294\|Ga0182041_11725597	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	580	Open in IMG/M
3300016294\|Ga0182041_11827109	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	564	Open in IMG/M
3300016319\|Ga0182033_10169901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-025	1704	Open in IMG/M
3300016319\|Ga0182033_10186196	All Organisms → cellular organisms → Bacteria → Proteobacteria	1639	Open in IMG/M
3300016319\|Ga0182033_10274942	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1379	Open in IMG/M
3300016319\|Ga0182033_10407848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1150	Open in IMG/M
3300016319\|Ga0182033_10838311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	812	Open in IMG/M
3300016319\|Ga0182033_10877271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	794	Open in IMG/M
3300016341\|Ga0182035_12092469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	514	Open in IMG/M
3300016357\|Ga0182032_10138264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1784	Open in IMG/M
3300016357\|Ga0182032_10207093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1497	Open in IMG/M
3300016357\|Ga0182032_10532640	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	970	Open in IMG/M
3300016357\|Ga0182032_10983942	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	720	Open in IMG/M
3300016357\|Ga0182032_11119523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	676	Open in IMG/M
3300016371\|Ga0182034_10260200	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1373	Open in IMG/M
3300016371\|Ga0182034_10377522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1157	Open in IMG/M
3300016371\|Ga0182034_11468194	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300016387\|Ga0182040_10931893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	721	Open in IMG/M
3300016404\|Ga0182037_11411620	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	616	Open in IMG/M
3300016404\|Ga0182037_11594552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	580	Open in IMG/M
3300016422\|Ga0182039_10180973	All Organisms → cellular organisms → Bacteria → Proteobacteria	1664	Open in IMG/M
3300016422\|Ga0182039_11279610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	664	Open in IMG/M
3300016422\|Ga0182039_12243314	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	504	Open in IMG/M
3300016445\|Ga0182038_10118062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1964	Open in IMG/M
3300016445\|Ga0182038_10416804	All Organisms → cellular organisms → Bacteria	1129	Open in IMG/M
3300018051\|Ga0184620_10059650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1097	Open in IMG/M
3300018054\|Ga0184621_10323376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	543	Open in IMG/M
3300018066\|Ga0184617_1035095	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1211	Open in IMG/M
3300018468\|Ga0066662_10577217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1046	Open in IMG/M
3300018469\|Ga0190270_13219567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	517	Open in IMG/M
3300021168\|Ga0210406_10588119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	870	Open in IMG/M
3300021178\|Ga0210408_11200598	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	579	Open in IMG/M
3300021363\|Ga0193699_10418267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	554	Open in IMG/M
3300021432\|Ga0210384_10888534	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	791	Open in IMG/M
3300021475\|Ga0210392_10778236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	714	Open in IMG/M
3300021560\|Ga0126371_10131536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens	2542	Open in IMG/M
3300021560\|Ga0126371_10638074	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1214	Open in IMG/M
3300021560\|Ga0126371_11961321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	704	Open in IMG/M
3300021560\|Ga0126371_12002389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	697	Open in IMG/M
3300025900\|Ga0207710_10341394	All Organisms → cellular organisms → Bacteria → Proteobacteria	762	Open in IMG/M
3300025906\|Ga0207699_11038457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	606	Open in IMG/M
3300025915\|Ga0207693_10579227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	874	Open in IMG/M
3300025915\|Ga0207693_11070698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	613	Open in IMG/M
3300025929\|Ga0207664_11492891	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	597	Open in IMG/M
3300025932\|Ga0207690_10706686	All Organisms → cellular organisms → Bacteria → Proteobacteria	829	Open in IMG/M
3300025986\|Ga0207658_11493031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	618	Open in IMG/M
3300027874\|Ga0209465_10564866	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	565	Open in IMG/M
3300027903\|Ga0209488_11220940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	505	Open in IMG/M
3300027909\|Ga0209382_10661855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1129	Open in IMG/M
3300027909\|Ga0209382_11048378	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	846	Open in IMG/M
3300027909\|Ga0209382_11905253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	574	Open in IMG/M
3300028708\|Ga0307295_10083641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	849	Open in IMG/M
3300028712\|Ga0307285_10219107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	536	Open in IMG/M
3300028744\|Ga0307318_10148854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	803	Open in IMG/M
3300028768\|Ga0307280_10289344	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	596	Open in IMG/M
3300028784\|Ga0307282_10207724	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	937	Open in IMG/M
3300028793\|Ga0307299_10008953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3519	Open in IMG/M
3300028796\|Ga0307287_10227953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	706	Open in IMG/M
3300028814\|Ga0307302_10571077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	562	Open in IMG/M
3300028819\|Ga0307296_10724703	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	543	Open in IMG/M
3300028828\|Ga0307312_10572981	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	746	Open in IMG/M
3300028884\|Ga0307308_10386542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	670	Open in IMG/M
3300031198\|Ga0307500_10214429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	580	Open in IMG/M
3300031226\|Ga0307497_10568208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	569	Open in IMG/M
3300031226\|Ga0307497_10593284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	559	Open in IMG/M
3300031231\|Ga0170824_127982363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	644	Open in IMG/M
3300031474\|Ga0170818_105288693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	622	Open in IMG/M
3300031543\|Ga0318516_10022304	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3252	Open in IMG/M
3300031543\|Ga0318516_10140562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1384	Open in IMG/M
3300031543\|Ga0318516_10400888	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	790	Open in IMG/M
3300031543\|Ga0318516_10701062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	575	Open in IMG/M
3300031545\|Ga0318541_10675258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	577	Open in IMG/M
3300031545\|Ga0318541_10716712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	559	Open in IMG/M
3300031546\|Ga0318538_10244825	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	962	Open in IMG/M
3300031546\|Ga0318538_10471557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	680	Open in IMG/M
3300031549\|Ga0318571_10372270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	552	Open in IMG/M
3300031561\|Ga0318528_10085005	All Organisms → cellular organisms → Bacteria → Proteobacteria	1645	Open in IMG/M
3300031561\|Ga0318528_10114767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1421	Open in IMG/M
3300031564\|Ga0318573_10047445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2084	Open in IMG/M
3300031572\|Ga0318515_10261457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	928	Open in IMG/M
3300031572\|Ga0318515_10522143	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	633	Open in IMG/M
3300031573\|Ga0310915_10087880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-025	2079	Open in IMG/M
3300031573\|Ga0310915_10743428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	691	Open in IMG/M
3300031573\|Ga0310915_10770451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	677	Open in IMG/M
3300031640\|Ga0318555_10414167	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	730	Open in IMG/M
3300031668\|Ga0318542_10352487	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	757	Open in IMG/M
3300031680\|Ga0318574_10427051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	775	Open in IMG/M
3300031680\|Ga0318574_10601876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	644	Open in IMG/M
3300031680\|Ga0318574_10728025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	581	Open in IMG/M
3300031682\|Ga0318560_10695376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	550	Open in IMG/M
3300031713\|Ga0318496_10377289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	784	Open in IMG/M
3300031713\|Ga0318496_10706611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	556	Open in IMG/M
3300031719\|Ga0306917_10210782	All Organisms → cellular organisms → Bacteria → Proteobacteria	1475	Open in IMG/M
3300031719\|Ga0306917_10687454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	804	Open in IMG/M
3300031719\|Ga0306917_10783735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	748	Open in IMG/M
3300031719\|Ga0306917_11114289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	614	Open in IMG/M
3300031723\|Ga0318493_10010854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei	3767	Open in IMG/M
3300031723\|Ga0318493_10810876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	528	Open in IMG/M
3300031724\|Ga0318500_10740303	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	502	Open in IMG/M
3300031736\|Ga0318501_10610426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	599	Open in IMG/M
3300031744\|Ga0306918_10125266	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1867	Open in IMG/M
3300031744\|Ga0306918_10958324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	665	Open in IMG/M
3300031747\|Ga0318502_10113025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1517	Open in IMG/M
3300031763\|Ga0318537_10032538	All Organisms → cellular organisms → Bacteria	1860	Open in IMG/M
3300031763\|Ga0318537_10313603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	580	Open in IMG/M
3300031763\|Ga0318537_10375371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	524	Open in IMG/M
3300031764\|Ga0318535_10540571	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	517	Open in IMG/M
3300031764\|Ga0318535_10560592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	506	Open in IMG/M
3300031765\|Ga0318554_10442941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	736	Open in IMG/M
3300031768\|Ga0318509_10171061	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1203	Open in IMG/M
3300031768\|Ga0318509_10424941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	743	Open in IMG/M
3300031770\|Ga0318521_10857967	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	554	Open in IMG/M
3300031771\|Ga0318546_10168730	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1483	Open in IMG/M
3300031771\|Ga0318546_11105983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	557	Open in IMG/M
3300031771\|Ga0318546_11149941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	545	Open in IMG/M
3300031777\|Ga0318543_10069127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1476	Open in IMG/M
3300031777\|Ga0318543_10258885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	776	Open in IMG/M
3300031778\|Ga0318498_10357536	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	651	Open in IMG/M
3300031778\|Ga0318498_10522715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	521	Open in IMG/M
3300031781\|Ga0318547_10163264	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1316	Open in IMG/M
3300031781\|Ga0318547_10681973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	638	Open in IMG/M
3300031781\|Ga0318547_10960170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	534	Open in IMG/M
3300031792\|Ga0318529_10364808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	672	Open in IMG/M
3300031793\|Ga0318548_10319242	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	763	Open in IMG/M
3300031794\|Ga0318503_10028959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1613	Open in IMG/M
3300031794\|Ga0318503_10150701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	750	Open in IMG/M
3300031794\|Ga0318503_10249053	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	576	Open in IMG/M
3300031797\|Ga0318550_10092954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1414	Open in IMG/M
3300031798\|Ga0318523_10159552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1123	Open in IMG/M
3300031805\|Ga0318497_10375481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	795	Open in IMG/M
3300031821\|Ga0318567_10827632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	524	Open in IMG/M
3300031833\|Ga0310917_10046645	All Organisms → cellular organisms → Bacteria → Proteobacteria	2643	Open in IMG/M
3300031833\|Ga0310917_10745219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	662	Open in IMG/M
3300031845\|Ga0318511_10213260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	860	Open in IMG/M
3300031859\|Ga0318527_10256434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	743	Open in IMG/M
3300031860\|Ga0318495_10502720	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	529	Open in IMG/M
3300031879\|Ga0306919_10089079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. E-025	2146	Open in IMG/M
3300031879\|Ga0306919_10170885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1599	Open in IMG/M
3300031879\|Ga0306919_11510547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	505	Open in IMG/M
3300031880\|Ga0318544_10127436	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300031890\|Ga0306925_10741229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1024	Open in IMG/M
3300031890\|Ga0306925_10854763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	939	Open in IMG/M
3300031890\|Ga0306925_11289993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	726	Open in IMG/M
3300031890\|Ga0306925_11488247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	663	Open in IMG/M
3300031890\|Ga0306925_11590253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	636	Open in IMG/M
3300031893\|Ga0318536_10082691	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1594	Open in IMG/M
3300031894\|Ga0318522_10128953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	948	Open in IMG/M
3300031897\|Ga0318520_10127587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1455	Open in IMG/M
3300031910\|Ga0306923_11497491	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	706	Open in IMG/M
3300031910\|Ga0306923_12194165	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	554	Open in IMG/M
3300031912\|Ga0306921_10185488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2438	Open in IMG/M
3300031912\|Ga0306921_10935700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum	982	Open in IMG/M
3300031912\|Ga0306921_11684750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	686	Open in IMG/M
3300031912\|Ga0306921_12009528	Not Available	615	Open in IMG/M
3300031912\|Ga0306921_12292324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	566	Open in IMG/M
3300031941\|Ga0310912_10040819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3217	Open in IMG/M
3300031941\|Ga0310912_10233137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1413	Open in IMG/M
3300031941\|Ga0310912_10527629	All Organisms → cellular organisms → Bacteria	920	Open in IMG/M
3300031942\|Ga0310916_10188159	All Organisms → cellular organisms → Bacteria	1722	Open in IMG/M
3300031942\|Ga0310916_10289205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1386	Open in IMG/M
3300031942\|Ga0310916_10504273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1031	Open in IMG/M
3300031942\|Ga0310916_10756552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	820	Open in IMG/M
3300031942\|Ga0310916_11097224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	661	Open in IMG/M
3300031945\|Ga0310913_10085677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2109	Open in IMG/M
3300031945\|Ga0310913_10892930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	625	Open in IMG/M
3300031946\|Ga0310910_10633273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	847	Open in IMG/M
3300031947\|Ga0310909_10317681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1306	Open in IMG/M
3300031954\|Ga0306926_10265014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2128	Open in IMG/M
3300031954\|Ga0306926_10350680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1824	Open in IMG/M
3300031954\|Ga0306926_11672659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	727	Open in IMG/M
3300031954\|Ga0306926_12279639	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	600	Open in IMG/M
3300031954\|Ga0306926_12485544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	568	Open in IMG/M
3300031954\|Ga0306926_12789867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	528	Open in IMG/M
3300031981\|Ga0318531_10210662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	876	Open in IMG/M
3300031981\|Ga0318531_10494141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	554	Open in IMG/M
3300031981\|Ga0318531_10588306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	504	Open in IMG/M
3300032035\|Ga0310911_10227775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1064	Open in IMG/M
3300032039\|Ga0318559_10061986	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1592	Open in IMG/M
3300032041\|Ga0318549_10042636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1845	Open in IMG/M
3300032042\|Ga0318545_10002251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5139	Open in IMG/M
3300032042\|Ga0318545_10227758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	668	Open in IMG/M
3300032042\|Ga0318545_10251492	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	634	Open in IMG/M
3300032043\|Ga0318556_10087995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1559	Open in IMG/M
3300032043\|Ga0318556_10199174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1041	Open in IMG/M
3300032044\|Ga0318558_10316590	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	772	Open in IMG/M
3300032055\|Ga0318575_10249548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	895	Open in IMG/M
3300032059\|Ga0318533_10999312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	613	Open in IMG/M
3300032064\|Ga0318510_10115945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1033	Open in IMG/M
3300032065\|Ga0318513_10179572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1016	Open in IMG/M
3300032065\|Ga0318513_10427113	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	647	Open in IMG/M
3300032068\|Ga0318553_10054381	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1978	Open in IMG/M
3300032076\|Ga0306924_11153231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	841	Open in IMG/M
3300032076\|Ga0306924_12383783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	534	Open in IMG/M
3300032091\|Ga0318577_10082779	All Organisms → cellular organisms → Bacteria	1486	Open in IMG/M
3300032091\|Ga0318577_10097135	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1376	Open in IMG/M
3300032091\|Ga0318577_10385811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	669	Open in IMG/M
3300032091\|Ga0318577_10477794	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	594	Open in IMG/M
3300032091\|Ga0318577_10538441	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	556	Open in IMG/M
3300032094\|Ga0318540_10048853	All Organisms → cellular organisms → Bacteria	1894	Open in IMG/M
3300032261\|Ga0306920_100615828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1605	Open in IMG/M
3300032261\|Ga0306920_101624873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	918	Open in IMG/M
3300032261\|Ga0306920_103657558	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	565	Open in IMG/M
3300032261\|Ga0306920_103984669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	536	Open in IMG/M
3300032261\|Ga0306920_103997258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	535	Open in IMG/M
3300033289\|Ga0310914_10195664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1804	Open in IMG/M
3300033289\|Ga0310914_10215095	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1719	Open in IMG/M
3300033289\|Ga0310914_10791010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	846	Open in IMG/M
3300033289\|Ga0310914_11167510	Not Available	671	Open in IMG/M
3300033290\|Ga0318519_10245575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1034	Open in IMG/M
3300033290\|Ga0318519_10287802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	959	Open in IMG/M
3300033290\|Ga0318519_10531901	All Organisms → cellular organisms → Bacteria → Proteobacteria	710	Open in IMG/M
3300034149\|Ga0364929_0150891	All Organisms → cellular organisms → Bacteria → Proteobacteria	754	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.26%
Host-Associated	Host-Associated	7.74%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	91.02%
Plants	Host-Associated → Plants	7.74%
Aquatic	Environmental → Aquatic	1.24%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	90.40%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.19%
Sediment	Environmental → Aquatic → Sediment	1.24%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.24%
Floodplain	Environmental → Terrestrial → Floodplain	0.31%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.31%
Roots	Host-Associated → Plants → Roots	0.31%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	80.50%
Loam	Environmental → Terrestrial → Soil → Loam	9.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.33%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.86%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.24%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.24%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.31%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.31%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.31%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	57.28%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.05%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	7.12%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.86%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.86%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.24%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.24%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.31%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.31%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.31%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.31%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	35.29%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	20.12%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	9.60%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	6.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.88%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.41%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.79%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.17%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.86%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.24%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.93%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.93%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.62%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.62%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.31%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.31%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.31%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.31%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.31%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.31%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.31%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.31%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.31%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.31%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.31%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.31%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental	Open in IMG/M
3300000793	Forest soil microbial communities from Amazon forest - 2010 replicate II A001	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002910	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm	Environmental	Open in IMG/M
3300004629	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006576	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300010868	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)	Environmental	Open in IMG/M
3300011107	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012232	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012941	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018051	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028708	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152	Environmental	Open in IMG/M
3300028712	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139	Environmental	Open in IMG/M
3300028744	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367	Environmental	Open in IMG/M
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028793	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159	Environmental	Open in IMG/M
3300028796	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141	Environmental	Open in IMG/M
3300028814	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183	Environmental	Open in IMG/M
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028884	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental	Open in IMG/M
3300031549	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031640	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23	Environmental	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031723	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23	Environmental	Open in IMG/M
3300031724	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031747	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22	Environmental	Open in IMG/M
3300031763	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29	Environmental	Open in IMG/M
3300031764	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27	Environmental	Open in IMG/M
3300031765	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031792	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031794	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23	Environmental	Open in IMG/M
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental	Open in IMG/M
3300031798	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031821	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031845	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18	Environmental	Open in IMG/M
3300031859	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25	Environmental	Open in IMG/M
3300031860	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25	Environmental	Open in IMG/M
3300031879	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)	Environmental	Open in IMG/M
3300031880	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031894	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300031981	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032041	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22	Environmental	Open in IMG/M
3300032042	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26	Environmental	Open in IMG/M
3300032043	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24	Environmental	Open in IMG/M
3300032044	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20	Environmental	Open in IMG/M
3300032055	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032064	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17	Environmental	Open in IMG/M
3300032065	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20	Environmental	Open in IMG/M
3300032068	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032094	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300033289	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F009109

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign