Basic Information | |
---|---|
Family ID | F009182 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 322 |
Average Sequence Length | 42 residues |
Representative Sequence | FKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Number of Associated Samples | 222 |
Number of Associated Scaffolds | 322 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.93 % |
% of genes near scaffold ends (potentially truncated) | 98.45 % |
% of genes from short scaffolds (< 2000 bps) | 88.51 % |
Associated GOLD sequencing projects | 200 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.205 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.845 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.398 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.174 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 322 Family Scaffolds |
---|---|---|
PF13738 | Pyr_redox_3 | 44.10 |
PF03486 | HI0933_like | 3.11 |
PF12838 | Fer4_7 | 3.11 |
PF07992 | Pyr_redox_2 | 1.55 |
PF00890 | FAD_binding_2 | 0.93 |
PF08734 | GYD | 0.62 |
PF13237 | Fer4_10 | 0.62 |
PF16264 | SatD | 0.31 |
PF13565 | HTH_32 | 0.31 |
PF01494 | FAD_binding_3 | 0.31 |
PF13231 | PMT_2 | 0.31 |
PF09360 | zf-CDGSH | 0.31 |
PF06745 | ATPase | 0.31 |
PF00175 | NAD_binding_1 | 0.31 |
PF12713 | DUF3806 | 0.31 |
PF02195 | ParBc | 0.31 |
PF02866 | Ldh_1_C | 0.31 |
PF11750 | DUF3307 | 0.31 |
COG ID | Name | Functional Category | % Frequency in 322 Family Scaffolds |
---|---|---|---|
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 6.83 |
COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 6.21 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 3.42 |
COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 3.11 |
COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 3.11 |
COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 3.11 |
COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 3.11 |
COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 3.11 |
COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 3.11 |
COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 3.11 |
COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 3.11 |
COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 3.11 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.62 |
COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 0.31 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.31 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.20 % |
Unclassified | root | N/A | 2.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459022|GZEQPF102GSCIK | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101404114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_103661254 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300000567|JGI12270J11330_10130271 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300000955|JGI1027J12803_105574420 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300001546|JGI12659J15293_10149328 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300002911|JGI25390J43892_10042323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1088 | Open in IMG/M |
3300002917|JGI25616J43925_10279144 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300003223|JGI26343J46809_1013322 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300004080|Ga0062385_11277299 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300004092|Ga0062389_100506903 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
3300004092|Ga0062389_102963507 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300004479|Ga0062595_101727789 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005167|Ga0066672_10812346 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300005174|Ga0066680_10158332 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300005174|Ga0066680_10585085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 700 | Open in IMG/M |
3300005179|Ga0066684_10671999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 695 | Open in IMG/M |
3300005332|Ga0066388_100593826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1731 | Open in IMG/M |
3300005332|Ga0066388_107956820 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005332|Ga0066388_108407755 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300005340|Ga0070689_101980926 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005434|Ga0070709_10714159 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300005434|Ga0070709_11322213 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005435|Ga0070714_102357251 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300005436|Ga0070713_101978373 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300005445|Ga0070708_101157348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 724 | Open in IMG/M |
3300005529|Ga0070741_10731703 | Not Available | 870 | Open in IMG/M |
3300005537|Ga0070730_10144812 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
3300005537|Ga0070730_10211286 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300005540|Ga0066697_10009882 | All Organisms → cellular organisms → Bacteria | 4881 | Open in IMG/M |
3300005541|Ga0070733_10051592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2577 | Open in IMG/M |
3300005542|Ga0070732_10972104 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005553|Ga0066695_10533682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 716 | Open in IMG/M |
3300005555|Ga0066692_10818277 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005559|Ga0066700_10819056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 625 | Open in IMG/M |
3300005561|Ga0066699_10178059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1469 | Open in IMG/M |
3300005575|Ga0066702_10111826 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
3300005576|Ga0066708_10013796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3919 | Open in IMG/M |
3300005586|Ga0066691_10036180 | All Organisms → cellular organisms → Bacteria | 2581 | Open in IMG/M |
3300005602|Ga0070762_10411683 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300005610|Ga0070763_10529717 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300005712|Ga0070764_10156146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1257 | Open in IMG/M |
3300005764|Ga0066903_102250003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300005764|Ga0066903_106323082 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005764|Ga0066903_108476149 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005921|Ga0070766_10188495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1284 | Open in IMG/M |
3300005995|Ga0066790_10331582 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300006086|Ga0075019_10114914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1555 | Open in IMG/M |
3300006163|Ga0070715_10458163 | Not Available | 721 | Open in IMG/M |
3300006173|Ga0070716_100246262 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300006174|Ga0075014_100127136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1221 | Open in IMG/M |
3300006176|Ga0070765_100062016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3101 | Open in IMG/M |
3300006176|Ga0070765_101753623 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300006176|Ga0070765_101979677 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006755|Ga0079222_10998566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 719 | Open in IMG/M |
3300006755|Ga0079222_12634179 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300006796|Ga0066665_10619607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 866 | Open in IMG/M |
3300006797|Ga0066659_10358477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1133 | Open in IMG/M |
3300006800|Ga0066660_10206768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1502 | Open in IMG/M |
3300006804|Ga0079221_10861302 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300006854|Ga0075425_101215996 | Not Available | 856 | Open in IMG/M |
3300007258|Ga0099793_10019331 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
3300007258|Ga0099793_10083207 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
3300007258|Ga0099793_10143169 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
3300009038|Ga0099829_10126268 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
3300009038|Ga0099829_10279620 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300009038|Ga0099829_10457064 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300009038|Ga0099829_10970059 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300009038|Ga0099829_11686439 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300009088|Ga0099830_11245795 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300009089|Ga0099828_11484708 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300009090|Ga0099827_10557657 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300009137|Ga0066709_102595701 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300009137|Ga0066709_103509135 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300009523|Ga0116221_1365119 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300010046|Ga0126384_10596105 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300010047|Ga0126382_10833312 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300010048|Ga0126373_10908735 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300010048|Ga0126373_11233029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300010358|Ga0126370_10393246 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300010361|Ga0126378_10276597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1778 | Open in IMG/M |
3300010362|Ga0126377_11082718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
3300010376|Ga0126381_100185138 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
3300010398|Ga0126383_11649613 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300010398|Ga0126383_12579924 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300010398|Ga0126383_13374638 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010880|Ga0126350_10445417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4131 | Open in IMG/M |
3300011120|Ga0150983_13427042 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300011120|Ga0150983_15154174 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300011269|Ga0137392_10270203 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
3300011269|Ga0137392_10328760 | Not Available | 1265 | Open in IMG/M |
3300011269|Ga0137392_11229512 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300011269|Ga0137392_11361591 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300011269|Ga0137392_11362185 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300011269|Ga0137392_11498013 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300011271|Ga0137393_10827304 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300011271|Ga0137393_11620238 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300011271|Ga0137393_11763408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300012096|Ga0137389_11767190 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300012189|Ga0137388_10050147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3381 | Open in IMG/M |
3300012189|Ga0137388_10504402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1124 | Open in IMG/M |
3300012189|Ga0137388_10813825 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300012189|Ga0137388_10988337 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300012189|Ga0137388_11047363 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300012200|Ga0137382_10582720 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300012202|Ga0137363_10015066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5052 | Open in IMG/M |
3300012202|Ga0137363_10663990 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300012202|Ga0137363_11236583 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300012203|Ga0137399_10871013 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300012206|Ga0137380_10938755 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300012207|Ga0137381_11005029 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300012209|Ga0137379_10925664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 776 | Open in IMG/M |
3300012210|Ga0137378_11574670 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300012211|Ga0137377_11263445 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300012285|Ga0137370_10588441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 687 | Open in IMG/M |
3300012349|Ga0137387_10973831 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300012351|Ga0137386_10181413 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300012356|Ga0137371_10157205 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
3300012356|Ga0137371_10884204 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300012357|Ga0137384_11384702 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300012361|Ga0137360_10082444 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
3300012361|Ga0137360_10539992 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300012361|Ga0137360_11824662 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300012362|Ga0137361_10625847 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300012362|Ga0137361_11793216 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300012363|Ga0137390_10805232 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300012363|Ga0137390_10812837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 892 | Open in IMG/M |
3300012363|Ga0137390_11881892 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300012582|Ga0137358_10874896 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300012683|Ga0137398_10796282 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300012683|Ga0137398_10895457 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012917|Ga0137395_11106352 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300012918|Ga0137396_10450476 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300012918|Ga0137396_10698325 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300012918|Ga0137396_10753313 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300012922|Ga0137394_10764763 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300012924|Ga0137413_10145787 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300012925|Ga0137419_10144471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1710 | Open in IMG/M |
3300012927|Ga0137416_11731476 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300012929|Ga0137404_11296275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300012930|Ga0137407_10745556 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300012930|Ga0137407_11243591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300012958|Ga0164299_11076244 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300012971|Ga0126369_10713188 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300012971|Ga0126369_11747551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 711 | Open in IMG/M |
3300012986|Ga0164304_10393001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300013308|Ga0157375_10945142 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300014153|Ga0181527_1056917 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300014155|Ga0181524_10227504 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300014166|Ga0134079_10047212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1503 | Open in IMG/M |
3300014166|Ga0134079_10662674 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300015054|Ga0137420_1114429 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
3300015371|Ga0132258_11172067 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
3300015372|Ga0132256_101254919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
3300015374|Ga0132255_103910025 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300016357|Ga0182032_12046993 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300016371|Ga0182034_10109274 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
3300016371|Ga0182034_10685688 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300016387|Ga0182040_10709798 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300016404|Ga0182037_11561272 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300016702|Ga0181511_1170329 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300017657|Ga0134074_1141475 | Not Available | 839 | Open in IMG/M |
3300017930|Ga0187825_10173958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
3300017934|Ga0187803_10077230 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300017934|Ga0187803_10122140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1023 | Open in IMG/M |
3300017940|Ga0187853_10256331 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300017942|Ga0187808_10512913 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300017947|Ga0187785_10204118 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300017961|Ga0187778_10288688 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300018006|Ga0187804_10008547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3430 | Open in IMG/M |
3300018006|Ga0187804_10112258 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300018040|Ga0187862_10081970 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
3300018062|Ga0187784_10049780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3390 | Open in IMG/M |
3300018062|Ga0187784_10322275 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
3300018090|Ga0187770_11193689 | Not Available | 615 | Open in IMG/M |
3300018468|Ga0066662_10286195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
3300018468|Ga0066662_11322209 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300018468|Ga0066662_11446951 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300019886|Ga0193727_1115294 | Not Available | 775 | Open in IMG/M |
3300020140|Ga0179590_1162600 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300020140|Ga0179590_1163787 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300020199|Ga0179592_10342586 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300020579|Ga0210407_10017250 | All Organisms → cellular organisms → Bacteria | 5350 | Open in IMG/M |
3300020579|Ga0210407_10043128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3357 | Open in IMG/M |
3300020579|Ga0210407_10283567 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300020579|Ga0210407_11288233 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300020580|Ga0210403_10271383 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300020580|Ga0210403_11210463 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300020581|Ga0210399_10280219 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300020581|Ga0210399_10554999 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300020581|Ga0210399_10569641 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300020581|Ga0210399_11135020 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300020583|Ga0210401_10231768 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300020583|Ga0210401_10797372 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300020583|Ga0210401_10860085 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300020583|Ga0210401_11216026 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300021086|Ga0179596_10214898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
3300021088|Ga0210404_10721587 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300021168|Ga0210406_10533062 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300021168|Ga0210406_10570830 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300021168|Ga0210406_11069200 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300021170|Ga0210400_10516498 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300021170|Ga0210400_10561826 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300021171|Ga0210405_10644767 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300021171|Ga0210405_10685447 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300021171|Ga0210405_10894756 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300021171|Ga0210405_11041268 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300021181|Ga0210388_10881787 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300021402|Ga0210385_10966139 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300021405|Ga0210387_10580769 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300021405|Ga0210387_11256461 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300021406|Ga0210386_10949241 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300021406|Ga0210386_11797356 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300021407|Ga0210383_11312741 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300021420|Ga0210394_10701681 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300021420|Ga0210394_11277190 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300021475|Ga0210392_10927425 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300021475|Ga0210392_11212599 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300021478|Ga0210402_10244073 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
3300021478|Ga0210402_10927431 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300021559|Ga0210409_10026686 | All Organisms → cellular organisms → Bacteria | 5578 | Open in IMG/M |
3300021559|Ga0210409_10380713 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300021559|Ga0210409_11424037 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300021559|Ga0210409_11621702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_57_17 | 523 | Open in IMG/M |
3300021560|Ga0126371_11632403 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300022557|Ga0212123_10163622 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300022724|Ga0242665_10101777 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300023259|Ga0224551_1045154 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300024330|Ga0137417_1102243 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300025900|Ga0207710_10218696 | Not Available | 945 | Open in IMG/M |
3300025906|Ga0207699_10035705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 2830 | Open in IMG/M |
3300025961|Ga0207712_11509319 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300026294|Ga0209839_10196761 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300026304|Ga0209240_1030838 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
3300026314|Ga0209268_1108773 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300026328|Ga0209802_1308584 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300026329|Ga0209375_1010515 | All Organisms → cellular organisms → Bacteria | 5773 | Open in IMG/M |
3300026343|Ga0209159_1002601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12476 | Open in IMG/M |
3300026523|Ga0209808_1014447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3976 | Open in IMG/M |
3300026527|Ga0209059_1149208 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300026538|Ga0209056_10123247 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300026551|Ga0209648_10581616 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300026551|Ga0209648_10795501 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300026555|Ga0179593_1190480 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
3300026557|Ga0179587_10070119 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
3300026557|Ga0179587_11104704 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300026921|Ga0207860_1032000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300027376|Ga0209004_1033811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
3300027439|Ga0209332_1052310 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300027463|Ga0207627_102429 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300027512|Ga0209179_1147118 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300027565|Ga0209219_1066851 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300027567|Ga0209115_1161158 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300027671|Ga0209588_1136556 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300027671|Ga0209588_1222954 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300027701|Ga0209447_10010869 | All Organisms → cellular organisms → Bacteria | 2626 | Open in IMG/M |
3300027727|Ga0209328_10114647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 823 | Open in IMG/M |
3300027795|Ga0209139_10185805 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300027826|Ga0209060_10017022 | All Organisms → cellular organisms → Bacteria | 3919 | Open in IMG/M |
3300027855|Ga0209693_10414062 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300027855|Ga0209693_10446003 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300027875|Ga0209283_10550735 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300027875|Ga0209283_10931281 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300027884|Ga0209275_10550869 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300027889|Ga0209380_10083137 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
3300027895|Ga0209624_10876340 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300027898|Ga0209067_10093873 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300027903|Ga0209488_10686060 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300027903|Ga0209488_10981130 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300028047|Ga0209526_10000088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 50220 | Open in IMG/M |
3300028047|Ga0209526_10936762 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300028145|Ga0247663_1037238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300028747|Ga0302219_10412417 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300028808|Ga0302228_10392054 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300030494|Ga0310037_10389916 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300030730|Ga0307482_1197278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300030991|Ga0073994_12284411 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031057|Ga0170834_103822756 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
3300031128|Ga0170823_10579722 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
3300031231|Ga0170824_102930480 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300031231|Ga0170824_113725299 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300031231|Ga0170824_120931420 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300031446|Ga0170820_10103618 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300031573|Ga0310915_10689565 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300031668|Ga0318542_10004640 | All Organisms → cellular organisms → Bacteria | 4709 | Open in IMG/M |
3300031708|Ga0310686_103534551 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300031715|Ga0307476_10168880 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300031715|Ga0307476_10293381 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300031718|Ga0307474_10436283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
3300031719|Ga0306917_10834487 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300031763|Ga0318537_10402625 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300031768|Ga0318509_10075402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1777 | Open in IMG/M |
3300031820|Ga0307473_11427520 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300031823|Ga0307478_10266244 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300031823|Ga0307478_11295926 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300031880|Ga0318544_10335056 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300031910|Ga0306923_10216262 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
3300031910|Ga0306923_11787421 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300031941|Ga0310912_10494017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
3300031942|Ga0310916_11047088 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300031942|Ga0310916_11259136 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300031946|Ga0310910_10641630 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300031962|Ga0307479_10092059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2941 | Open in IMG/M |
3300031962|Ga0307479_10111796 | All Organisms → cellular organisms → Bacteria | 2658 | Open in IMG/M |
3300031962|Ga0307479_11480982 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300032035|Ga0310911_10127845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
3300032035|Ga0310911_10894546 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300032180|Ga0307471_100289479 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
3300032180|Ga0307471_100702104 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
3300032180|Ga0307471_101079052 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300032180|Ga0307471_102063380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300032205|Ga0307472_100167030 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300032205|Ga0307472_100367782 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300032205|Ga0307472_100400422 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300032261|Ga0306920_101620927 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300032782|Ga0335082_10854309 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300032783|Ga0335079_12206402 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300032828|Ga0335080_10350200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1593 | Open in IMG/M |
3300032892|Ga0335081_11162210 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300033289|Ga0310914_10397098 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300033755|Ga0371489_0481546 | Not Available | 553 | Open in IMG/M |
3300034124|Ga0370483_0366392 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.76% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.28% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.35% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.79% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.86% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.86% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.24% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.24% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.62% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.31% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.31% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.31% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.31% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.31% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.31% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.31% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.31% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.31% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.31% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459022 | Grass soil microbial communities from Rothamsted Park, UK - FA2 (control condition) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026921 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 28 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027463 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-C (SPAdes) | Environmental | Open in IMG/M |
3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FA2_07041070 | 2170459022 | Grass Soil | DAFKFRIQFKKSHVSRDELISTLREILSQLEGTASGSSNADSTAA |
INPhiseqgaiiFebDRAFT_1014041142 | 3300000364 | Soil | FRIQFKKSHVSRDELIITLREILLQLEGSSSQEDAAEQADPTAA* |
INPhiseqgaiiFebDRAFT_1036612542 | 3300000364 | Soil | KKSHVSRDELISTLREILSQLEGTASESSEADSTAA* |
JGI12270J11330_101302713 | 3300000567 | Peatlands Soil | QYEPENEAFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA* |
JGI1027J12803_1055744203 | 3300000955 | Soil | RFRMQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA* |
JGI12659J15293_101493282 | 3300001546 | Forest Soil | TFKFRIQFKKSHVSRDELITTLRGILSQLEGASDSQADSTAA* |
JGI25390J43892_100423233 | 3300002911 | Grasslands Soil | ETFKFRIQFKKSHVSRDELISTLREILAQLEGSSAADSTAA* |
JGI25616J43925_102791441 | 3300002917 | Grasslands Soil | KFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
JGI26343J46809_10133221 | 3300003223 | Bog Forest Soil | FRFRIQFKKSHVSRDELILTLREILGQLEGSSSDAADSTAA* |
Ga0062385_112772992 | 3300004080 | Bog Forest Soil | EPQNAAFKFRIQFKKSHVSRDELIHTLRDILAQLEGTSTEVSADSTAA* |
Ga0062389_1005069033 | 3300004092 | Bog Forest Soil | FEPQNDAFKFRIQFKKSHVSRDELIHTLRDILAQLEGTSTEVSADSTAA* |
Ga0062389_1029635071 | 3300004092 | Bog Forest Soil | FKFRIQFKKSHVSRDELIHTLRDILAQLEGSSVDVSADSTAA* |
Ga0062595_1017277892 | 3300004479 | Soil | NETFKFRIQFKKSHVSRDELIATLREILSQLEGSAAEADSTAA* |
Ga0066672_108123462 | 3300005167 | Soil | FKFRIQFKKSHVSRDELISTLREILRQLEGSSSEADTTAA* |
Ga0066680_101583323 | 3300005174 | Soil | FKFRIQFKKSHVSRDELISTLREILSQLEGRASESSEADSTAA* |
Ga0066680_105850853 | 3300005174 | Soil | ETFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0066684_106719991 | 3300005179 | Soil | SETFKFRIQFKKSHVSRDELISTLREILAQLEGSSAADSTAA* |
Ga0066388_1005938261 | 3300005332 | Tropical Forest Soil | FEPQNESFKFRIQFKKSHVSRDELITTLREILSQLEGSAAEADSTAA* |
Ga0066388_1079568201 | 3300005332 | Tropical Forest Soil | PPTETFKFRIQFKKSHVSRDELISTLREILSQLEEGTSEADTTAA* |
Ga0066388_1084077551 | 3300005332 | Tropical Forest Soil | DNETFKFRIQFKKSHVSRDELITTLREILAQLEGSPSEADSTAA* |
Ga0070689_1019809262 | 3300005340 | Switchgrass Rhizosphere | FKKSHVSRDELIMTLREILSQLEDSGSQDAAGDRAGWTAA* |
Ga0070709_107141593 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FRFRIQFKKSHVSRDELITTLRGILSQLEGSSSEADYTAA* |
Ga0070709_113222132 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IQFKKSHVSRDELISTLREILSQLEGTATESSAADWTAA* |
Ga0070714_1023572512 | 3300005435 | Agricultural Soil | KFRIQFKKSHVSRDELISTLREILSQLEGTASESSEADSTAA* |
Ga0070713_1019783731 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RIQFKKSHVTRDELITTLREILSQLEGSAASGSEADSTAA* |
Ga0070708_1011573483 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | FKFRIQFKKSHVSRDELIGTLREILAQLEGSSSSSDSTADSTAA* |
Ga0070741_107317032 | 3300005529 | Surface Soil | QNESFKFRIQFKKSHVSRDELIHTLREILAQLEGSSAEADSTAA* |
Ga0070730_101448123 | 3300005537 | Surface Soil | KKSHVSRDELIVTLREILSQLEGASGSEADSTAA* |
Ga0070730_102112861 | 3300005537 | Surface Soil | FKKSHVSRNELILTLREILAQLEGSSSEADSTAA* |
Ga0066697_100098829 | 3300005540 | Soil | FQFEPPSETFRFRIQFKKSHVSRDELISTLREILAQLEEGTSEADTTAA* |
Ga0070733_100515921 | 3300005541 | Surface Soil | FRIQFKKSHVSRDELIKTLRGILAQLEGSSSEEDSTAA* |
Ga0070732_109721042 | 3300005542 | Surface Soil | ETFKFRIQFKKSHVSRDELIRTLRDILAQLEGSSTEADSTAA* |
Ga0066695_105336823 | 3300005553 | Soil | KKSHVSRDELISTLREILAQLEGTSAEAADSTAA* |
Ga0066692_108182772 | 3300005555 | Soil | HFEPQNESFKFRIQFKRSHVSRNELIVTLREILAQLEGAEGSEADSTAA* |
Ga0066700_108190561 | 3300005559 | Soil | KFRIQFKKSHVSRDELISTLREILSQLEGSSAADSTAA* |
Ga0066699_101780591 | 3300005561 | Soil | FKKSHVSRDELISTLREILAQLEGSSSEADTTAA* |
Ga0066702_101118263 | 3300005575 | Soil | EPPSETFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADTTAA* |
Ga0066708_100137966 | 3300005576 | Soil | ETFRFRIQFKKSHVSRDELISTLREILAQLEGSSSEADTAA* |
Ga0066691_100361801 | 3300005586 | Soil | ETFKFRIQFKKSHVSRDELISTLREILSQLEGSSSEADSTAA* |
Ga0070762_104116831 | 3300005602 | Soil | KFRIQFKKSHVSRDELITTLRGILSQLEGASDSQADSTAA* |
Ga0070763_105297173 | 3300005610 | Soil | RIQFKKSHVSRDELITTLRGILSQLEGASDSQADSTAA* |
Ga0070764_101561463 | 3300005712 | Soil | SFRFRIQFKKSHVSRDELIVTLREILGQLEGTSSAADSTAA* |
Ga0066903_1022500031 | 3300005764 | Tropical Forest Soil | NESFKFRIQFKKSHVTRDELITTLREILSQLEDSGSQDAPGERADWTAA* |
Ga0066903_1063230821 | 3300005764 | Tropical Forest Soil | FRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA* |
Ga0066903_1084761491 | 3300005764 | Tropical Forest Soil | KKSHVSRDELIVTLREILAQLEGANGEEADSTAA* |
Ga0070766_101884951 | 3300005921 | Soil | QFKKSHVSRDELITTLRGILAQLEGSSESHADSTAA* |
Ga0066790_103315821 | 3300005995 | Soil | QNDTFKFRIQFKKSHVSRDELITTLRDILAQLEGSSSDVNADSTAA* |
Ga0075019_101149143 | 3300006086 | Watersheds | FKFRIQFKKSHVSRDELITTLREILAQLEGSSSEADSTAA* |
Ga0070715_104581632 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | FKKSHVSRDELITTLREILAQLEGSSAEADSTAA* |
Ga0070716_1002462621 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QFKKSHVSRDELITTLRGILSQLEGSSSEADYTAA* |
Ga0075014_1001271363 | 3300006174 | Watersheds | FKFRIQFKKSHVSRDELIVTLREILSQLEGSSSDTVDSTAA* |
Ga0070765_1000620161 | 3300006176 | Soil | QFKKSHVSRDELIRTLRDILAQLEGASEADSTAA* |
Ga0070765_1017536232 | 3300006176 | Soil | KKSHVSRDELITTLRGILSQLEGASDSQADSTAA* |
Ga0070765_1019796771 | 3300006176 | Soil | DEAFRFRLQFKKSHVSRDELIRTLREILAQLEGTETADSTAA* |
Ga0079222_109985663 | 3300006755 | Agricultural Soil | IQFKKSHVSRDELIVTLREILAQLEGSSSEADSTAA* |
Ga0079222_126341791 | 3300006755 | Agricultural Soil | FRIQFKKSHVSRDELISTLREILAQLEGSSAADSTAA* |
Ga0066665_106196073 | 3300006796 | Soil | FKFRIQFKKSHVSRDELISTLREILSQLEGSSAADSTAA* |
Ga0066659_103584773 | 3300006797 | Soil | EPQNETFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0066660_102067681 | 3300006800 | Soil | FEPPSETFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADTTAA* |
Ga0079221_108613021 | 3300006804 | Agricultural Soil | ETFKFRIQFKKSHVSRDELISTLREILSQLEEGTSEADTTAA* |
Ga0075425_1012159962 | 3300006854 | Populus Rhizosphere | FKFRIQFKKSHVSRDELIVTLREILAQLEGSGSESDSGDHADSTAA* |
Ga0099793_100193315 | 3300007258 | Vadose Zone Soil | FKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0099793_100832073 | 3300007258 | Vadose Zone Soil | FQFEPPAETFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0099793_101431691 | 3300007258 | Vadose Zone Soil | RIQFKKSHVSRDELISTLREILAQLERSSSEADSTAA* |
Ga0099829_101262681 | 3300009038 | Vadose Zone Soil | ETFKFRIQFKKSHVSRDELISTLREILAQLERSSSEADSTAA* |
Ga0099829_102796201 | 3300009038 | Vadose Zone Soil | KKSHVSRDELIGTLREILAQLEGPSSSEADSTAA* |
Ga0099829_104570641 | 3300009038 | Vadose Zone Soil | PPAETFKFRIQFKKSHVSRDELISTLREILAQLEGSSSQADSTAA* |
Ga0099829_109700593 | 3300009038 | Vadose Zone Soil | IFQFEPQNETFKFRIQFKKSHVSRDELITTLREILSQLEGSSSEADSTAA* |
Ga0099829_116864392 | 3300009038 | Vadose Zone Soil | EPPTETFKFRIQFKKSHVSRDELIGTLREILAQLEGSSSAADSTAA* |
Ga0099830_112457953 | 3300009088 | Vadose Zone Soil | IQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0099828_114847081 | 3300009089 | Vadose Zone Soil | SETFKFRIQFKKSHVSRDELILTLREILAQLEGSSSEADSTAA* |
Ga0099827_105576571 | 3300009090 | Vadose Zone Soil | RIQFKKSHVSRDELVTTLREILAQLEGSSSEADSTAA* |
Ga0066709_1025957011 | 3300009137 | Grasslands Soil | HCAPQNESFKIRIQFKRSHVSRNERILSLREIFAQLEGAEGSEADSTAA* |
Ga0066709_1035091351 | 3300009137 | Grasslands Soil | NDAFKFRIQFKKSHVSRDELISTLREILSQLEGTASESSEADSTAA* |
Ga0116221_13651191 | 3300009523 | Peatlands Soil | QYEPENESFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA* |
Ga0126384_105961053 | 3300010046 | Tropical Forest Soil | QNESFKFRIQFKKSHVSRNELITTLREILAQLEGAESSEVDSSAA* |
Ga0126382_108333121 | 3300010047 | Tropical Forest Soil | QFKKSHVSRDELIATLREILSQLEGSSSEADTTAA* |
Ga0126373_109087353 | 3300010048 | Tropical Forest Soil | LQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA* |
Ga0126373_112330291 | 3300010048 | Tropical Forest Soil | FEPQNESFKFRIQFKKSHVSRDELIMTLREILSQLEDSSSQDASGDHADSTAA* |
Ga0126370_103932461 | 3300010358 | Tropical Forest Soil | FKKSHVSRDELIATLREILAQLEGSSAEADTTAA* |
Ga0126378_102765971 | 3300010361 | Tropical Forest Soil | NQAFRFRLQFKKSQVSREELIRTLREILSQLEGNEASEADSTAA* |
Ga0126377_110827182 | 3300010362 | Tropical Forest Soil | KFRIQFKKSHVSRDELISTLREILSQLEGSAAEADSTAA* |
Ga0126381_1001851385 | 3300010376 | Tropical Forest Soil | DEKFKFRLQFKKSHVTRDELIRTLREILAQLEGEESSSSAA* |
Ga0126383_116496133 | 3300010398 | Tropical Forest Soil | FRIQFKKSHVSRDELIMTLRGILAQLEGTSAETADSTAA* |
Ga0126383_125799242 | 3300010398 | Tropical Forest Soil | FRIQFKKSHVSRDELIMTLREILSQLEDSGLQDASGDHADSTAA* |
Ga0126383_133746381 | 3300010398 | Tropical Forest Soil | FKFRIQFKKSHVSREELIGTLREILAQLQGSSTDTADSTAA* |
Ga0126350_104454171 | 3300010880 | Boreal Forest Soil | FKFRIQFKKSHVTRDELIVTLREILSQLEGSSSEAADSTAA* |
Ga0150983_134270421 | 3300011120 | Forest Soil | ESFKFRIQFKKSHVSRDELISTLREILTQLEGSSSEADSTAA* |
Ga0150983_151541741 | 3300011120 | Forest Soil | KFRIQFKKSHVSRDELIVTLREILSQLEGTSSEADSTAA* |
Ga0137392_102702031 | 3300011269 | Vadose Zone Soil | EPPGETFKFRIQFKKSHVSRDELISTLREILAQLERSSSEADSTAA* |
Ga0137392_103287601 | 3300011269 | Vadose Zone Soil | KKSHVSRDELISTLREILSQLEGTASQSSEADSTAA* |
Ga0137392_112295122 | 3300011269 | Vadose Zone Soil | EPENEAFRFRIQFKKSHVSRDELIGTLREILAQLEGPSSSEADSTAA* |
Ga0137392_113615911 | 3300011269 | Vadose Zone Soil | FRIQFKKSHVSRDELIGTLREILSQLEGSSTEADSTAA* |
Ga0137392_113621852 | 3300011269 | Vadose Zone Soil | FRFRIQFKKSHVSRDELIGTLRDILAQLEGPSSSEADSTAA* |
Ga0137392_114980131 | 3300011269 | Vadose Zone Soil | FKFRIQFKKSHVSRDELISTLREILSQLEGTASQSSEADSTAA* |
Ga0137393_108273041 | 3300011271 | Vadose Zone Soil | FKFRIQFKKSHVSRDELIATLREILAQLERSSSEADSTAA* |
Ga0137393_116202382 | 3300011271 | Vadose Zone Soil | AETFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0137393_117634081 | 3300011271 | Vadose Zone Soil | ESYKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0137389_117671902 | 3300012096 | Vadose Zone Soil | FQFEPESEAFKFRLQFKKSHVSRDELIRTLREILAQLEGAEETHSAA* |
Ga0137388_100501476 | 3300012189 | Vadose Zone Soil | FKFRIQFKKSHVSRDELISTLREILSQLEGSSSEADSTAA* |
Ga0137388_105044023 | 3300012189 | Vadose Zone Soil | QFEPQDETFKFRIQFKKSHVSREELITTLREILAQLEGTSSAADSTAA* |
Ga0137388_108138253 | 3300012189 | Vadose Zone Soil | FKKSHVSRDELISTLREILAQLERSSSEADSTAA* |
Ga0137388_109883371 | 3300012189 | Vadose Zone Soil | NETFKFRIQFKKSHVSRDELITTLREILSQLEGSSSEADSTAA* |
Ga0137388_110473633 | 3300012189 | Vadose Zone Soil | QFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0137382_105827203 | 3300012200 | Vadose Zone Soil | FRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0137363_100150661 | 3300012202 | Vadose Zone Soil | TFKFRIQFKKSHVSRDELISTLREILAQLEGSSSAADSTAA* |
Ga0137363_106639901 | 3300012202 | Vadose Zone Soil | RIQFKKSHVSRDELITTLREILAQLEGTSSEADSTAA* |
Ga0137363_112365832 | 3300012202 | Vadose Zone Soil | PETETFKFRIQFKKSHVSRDELIGTLREILAQLEGSSSASDSEADSTAA* |
Ga0137399_108710131 | 3300012203 | Vadose Zone Soil | FKKSHVSRDELISTLREILAQLEGSSSEADSTAA* |
Ga0137380_109387553 | 3300012206 | Vadose Zone Soil | IFQFEPPSETFKFRIQFKKSHVSRDELISTLREILAQLEEGTSEADTTAA* |
Ga0137381_110050293 | 3300012207 | Vadose Zone Soil | IQFKKSHVSRDELISTLREILAQLERSSSEADSTAA* |
Ga0137379_109256643 | 3300012209 | Vadose Zone Soil | FRIQFRKSHVSRDELISTLREILAQLEGTSAEAADSTAA* |
Ga0137378_115746702 | 3300012210 | Vadose Zone Soil | FNFEPQDETFKFRIQFRKSHVSRDELISTLREILAQLEGTSAEAADSTAA* |
Ga0137377_112634453 | 3300012211 | Vadose Zone Soil | IQFKKSHVSRAELISTLREILAQLEGSSSEADSTAA* |
Ga0137370_105884413 | 3300012285 | Vadose Zone Soil | QFKKSHVSRDELISTLREILSQLEGSSAADSTAA* |
Ga0137387_109738312 | 3300012349 | Vadose Zone Soil | SETFRFRIQFKKSHVSRDELISTLREILAQLEGSSAADSTAA* |
Ga0137386_101814133 | 3300012351 | Vadose Zone Soil | PAETFKFRIQFKKSHVSRAELISTLREILAQLEGSSSEADSTAA* |
Ga0137371_101572051 | 3300012356 | Vadose Zone Soil | FEPQDETFKFRIQFKKSHVSRDELISTLREILAQLEGTSAEAADSTAA* |
Ga0137371_108842043 | 3300012356 | Vadose Zone Soil | RIQFKKSHVSRDELISTLREILAQLEGSSAADSTAA* |
Ga0137384_113847022 | 3300012357 | Vadose Zone Soil | PQDETFKFRIQFRKSHVSRDELISTLREILAQLEGTSAEAADSTAA* |
Ga0137360_100824444 | 3300012361 | Vadose Zone Soil | RLQFKKSHVSRDELIRTLREILEQLEGADEETHSAA* |
Ga0137360_105399921 | 3300012361 | Vadose Zone Soil | TFKFRIQFKKSHVSRDELITTLREILSQLEGSSSEADSTAA* |
Ga0137360_118246621 | 3300012361 | Vadose Zone Soil | QFKKSHVSRDELITTLREILTQLEGSSSEADSTAA* |
Ga0137361_106258473 | 3300012362 | Vadose Zone Soil | FKFRIQFKKSHVSRDELISTLREILAQLERSSSEADSTAA* |
Ga0137361_117932162 | 3300012362 | Vadose Zone Soil | FRIQFKKSHVSRDELIGTLREILAQLEGSSSEADSTAA* |
Ga0137390_108052321 | 3300012363 | Vadose Zone Soil | KFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA* |
Ga0137390_108128371 | 3300012363 | Vadose Zone Soil | FRFRIQFKKSHVSRDELIGTLREILAQLEGPSSSEADSTAA* |
Ga0137390_118818922 | 3300012363 | Vadose Zone Soil | LQFKKSHVSRDELIRTLREILEQLEGAEETHSAA* |
Ga0137358_108748961 | 3300012582 | Vadose Zone Soil | QFKKSHVSRDELIRTLREILEQLEGADEETHSAA* |
Ga0137398_107962823 | 3300012683 | Vadose Zone Soil | FKKSHVSRDELIGTLREILAQLEGSSSAADSEADSTAA* |
Ga0137398_108954571 | 3300012683 | Vadose Zone Soil | PGETFKFRIQFKKSHVSRDELISTLREILAQLERSSSEADSTAA* |
Ga0137395_111063522 | 3300012917 | Vadose Zone Soil | RIQFKRSHVSRNELIVTLREILAQLEGAQSSEADSTAA* |
Ga0137396_104504762 | 3300012918 | Vadose Zone Soil | MRRKFRLQFRKSHVSRDELIRTLREILEQLEGADEETHSAA* |
Ga0137396_106983253 | 3300012918 | Vadose Zone Soil | FKFRIQFKKSHVSRDELILTLREILSQLEGSSSQADSTAA* |
Ga0137396_107533131 | 3300012918 | Vadose Zone Soil | IQFKKSHVSRDELIHTLRGILAQLEGSSSEADSTAA* |
Ga0137394_107647631 | 3300012922 | Vadose Zone Soil | VFQFEPENEAFKFRLQFKKSHVSRDELIRTLREILEQLEGADEETHSAA* |
Ga0137413_101457871 | 3300012924 | Vadose Zone Soil | SETFKFRIQFKKSHVSRDELIGTLREILAQLEGSSSASDSEADSTAA* |
Ga0137419_101444711 | 3300012925 | Vadose Zone Soil | FKKSHVSRDELITTLREILTQLEGSSSEADSTAA* |
Ga0137416_117314762 | 3300012927 | Vadose Zone Soil | FRFRIQFKKSHVSRDELIHTLRGILAQLEGSSSEADSTAA* |
Ga0137404_112962752 | 3300012929 | Vadose Zone Soil | RIQFKKSHVSRDELISTLREILSQLEGAASESSEADSTAA* |
Ga0137407_107455563 | 3300012930 | Vadose Zone Soil | KKSHVSRDELIVTLREILSQLEGSSSSEADSTAA* |
Ga0137407_112435911 | 3300012930 | Vadose Zone Soil | IQFKKSHVSRDELISTLREILSQLEGTASESSEADSTAA* |
Ga0164299_110762441 | 3300012958 | Soil | NDAFKLRIQFKKSHVSRDELITTLREILAQLEGSSAEADSTAA* |
Ga0126369_107131881 | 3300012971 | Tropical Forest Soil | EAFRFRLQFKKSHVSRDELIRTLREILEQLEGTSEADSTAA* |
Ga0126369_117475513 | 3300012971 | Tropical Forest Soil | RFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA* |
Ga0164304_103930011 | 3300012986 | Soil | PQNDAFKFRIQFKKSHVSRDELITTLREILAQLEGSSAEADSTAA* |
Ga0157375_109451421 | 3300013308 | Miscanthus Rhizosphere | ENETFRFRIQFKKSHVSRDELITTLRGILSQLEGSSSEADYTAA* |
Ga0181527_10569173 | 3300014153 | Bog | RLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA* |
Ga0181524_102275041 | 3300014155 | Bog | RLQFKKSHVSRDELIRTLREILAQLEGTGEADSTAA* |
Ga0134079_100472123 | 3300014166 | Grasslands Soil | FKKSHVSRAELISTLREILAQLEGSSSEADSTAA* |
Ga0134079_106626742 | 3300014166 | Grasslands Soil | FRIQFKKSHVSRDELISTLREILSQLEGSSAADSTAA* |
Ga0137420_11144293 | 3300015054 | Vadose Zone Soil | FQFEPPGETFRFRIQFKKSHVSRDELISTLREILAQLERSSSEADSTAA* |
Ga0132258_111720671 | 3300015371 | Arabidopsis Rhizosphere | TFKFRIQFKKSHVSRDELIVTLREILAQLEGSGSQSDSDDHADSTAA* |
Ga0132256_1012549191 | 3300015372 | Arabidopsis Rhizosphere | FEPQNESFKFRIQFKKSHVSRDELIITLREILSQLEGADSHSDSGNQADSTAA* |
Ga0132255_1039100251 | 3300015374 | Arabidopsis Rhizosphere | QNETFKFRIQFKKSHVSRDELIVTLREILAQLEGSGSQSDSGDHADSTAA* |
Ga0182032_120469931 | 3300016357 | Soil | RLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0182034_101092743 | 3300016371 | Soil | EAFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0182034_106856882 | 3300016371 | Soil | AFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0182040_107097983 | 3300016387 | Soil | ENEAFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0182037_115612721 | 3300016404 | Soil | IFQYEPENEAFRFRMQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0181511_11703292 | 3300016702 | Peatland | FHYEPENEAFRFRLQFKKSQVSRDELIRTLRDILAQLEGAEADSTAA |
Ga0134074_11414752 | 3300017657 | Grasslands Soil | FRFRIQFKKSHVSRDELISTLREILAQLEGSSSEADTAA |
Ga0187825_101739582 | 3300017930 | Freshwater Sediment | FEPVNETFKFRIQFKKSHVSRDELITTLREILSQLEGTASQDPNAEADSTAA |
Ga0187803_100772303 | 3300017934 | Freshwater Sediment | SYKFRIQFKKSHVSRDELISTLREILAQLEGSSSKADSTAA |
Ga0187803_101221402 | 3300017934 | Freshwater Sediment | FIFQYEPEDQAFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0187853_102563311 | 3300017940 | Peatland | LQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0187808_105129131 | 3300017942 | Freshwater Sediment | FKFRIQFKKSHVSRDELITTLREILAQLEGSSSEAADSTAA |
Ga0187785_102041182 | 3300017947 | Tropical Peatland | EAFRFRLQFKKSHVSRDELIRTLREILAQLEGHEADSTAA |
Ga0187778_102886881 | 3300017961 | Tropical Peatland | IQFKKSHVSRDELIVTLRGILAQLEGEGSSEADSTAA |
Ga0187804_100085471 | 3300018006 | Freshwater Sediment | EAFKFRIQFKKSHVSRDELITTLREILAQLEGSSSEAADSTAA |
Ga0187804_101122581 | 3300018006 | Freshwater Sediment | FKFRLQFKKSHVSRDELIRTLREILAQLEGSSEQADSTAA |
Ga0187862_100819704 | 3300018040 | Peatland | RFKLQFKKSHVSRDELIRTLREILAQLEGTGEADSTAA |
Ga0187784_100497805 | 3300018062 | Tropical Peatland | EAFKFRLQFKKSSVSRDELIRTLREILAQLEGSEAADSTAA |
Ga0187784_103222754 | 3300018062 | Tropical Peatland | QYEPENEAYRFRLQFKKSHVSRDELIQTLREILAQLEGTSEADSTAA |
Ga0187770_111936891 | 3300018090 | Tropical Peatland | IFQYEPENEAFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0066662_102861953 | 3300018468 | Grasslands Soil | QFKKSHVSREELIDTLRDILAQLEGNTEKADYTAA |
Ga0066662_113222091 | 3300018468 | Grasslands Soil | IFQFEPQDETFKFRIQFKKSHVSREELITTLREILAQLEGTSSAADSTAA |
Ga0066662_114469511 | 3300018468 | Grasslands Soil | QFKKSHVSRDELISTLREILSQLEGSSSEADSTAA |
Ga0193727_11152941 | 3300019886 | Soil | FKFRIQFKKSHVSRDELISTLREILSQLEGTASQSSEADSTAA |
Ga0179590_11626002 | 3300020140 | Vadose Zone Soil | FEPPNDSFKFRIQFKKSHVSRDELIVTLREILSQLEGSSSSEADSTAA |
Ga0179590_11637872 | 3300020140 | Vadose Zone Soil | FHFEPQNDAFKFRIQFKKSHVSRDELISTLREILSQLEGTASESSNADYTAA |
Ga0179592_103425861 | 3300020199 | Vadose Zone Soil | EPPGETFKFRIQFKKSHVSRDELISTLREILAQLERSSSEADSTAA |
Ga0210407_1001725010 | 3300020579 | Soil | QFKKSHVSRDELVSTLREILAQLEGSSSSEADSTAA |
Ga0210407_100431287 | 3300020579 | Soil | ETFKFRIQFKKSHVSRDELIVTLREILSQLAGSSSESVDSTAA |
Ga0210407_102835671 | 3300020579 | Soil | FVFELGPENEAFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0210407_112882332 | 3300020579 | Soil | FQFEPENEAFKFRLQFKKSHVSRDELIRTLREILEQLEGADEETHSAA |
Ga0210403_102713831 | 3300020580 | Soil | EPESEAFKFRLQFKKSHVSRDELIRTLREILDQLEGAEEETHSAA |
Ga0210403_112104632 | 3300020580 | Soil | KFRIQFKKSHVSRDELIVTLREILSQLEGSSSDTVDSTAA |
Ga0210399_102802194 | 3300020581 | Soil | PENEAFKFRLQFKKSHVSRDELIRTLREILEQLEGADEETHSAA |
Ga0210399_105549991 | 3300020581 | Soil | EPENEAFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0210399_105696411 | 3300020581 | Soil | QFEPQNETFKFRIQFKKSHVSRDELIATLREILGQLEGNSSEADSTAA |
Ga0210399_111350202 | 3300020581 | Soil | ESYKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0210401_102317684 | 3300020583 | Soil | AFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0210401_107973721 | 3300020583 | Soil | PESEAFRFRMQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0210401_108600851 | 3300020583 | Soil | KFRIQFKKSHVSRDELIGTLREILAQLEGSSSSSDSEADSTAA |
Ga0210401_112160262 | 3300020583 | Soil | QFKKSHVSRDELVATLREILAQLEGSSSSEADSTAA |
Ga0179596_102148982 | 3300021086 | Vadose Zone Soil | RIQFKKSHVSRDELISTLREILSQLEGTASQSSEADSTAA |
Ga0210404_107215871 | 3300021088 | Soil | FKFRIQFKKSHVSRDELIVTLREILSQLEGSSSSSDSEADSTAA |
Ga0210406_105330621 | 3300021168 | Soil | QFEPENEAFRFRIQFKKSHVSRDELIGTLREILAQLEGSSSEADSTAA |
Ga0210406_105708301 | 3300021168 | Soil | QFKKSHVSRDELISTLREILTQLEGSSSEADSTAA |
Ga0210406_110692002 | 3300021168 | Soil | PFVFQFEPENEAFKFRLQFKKSHVSRDELVRTLREILEQLEGAEETHSAA |
Ga0210400_105164981 | 3300021170 | Soil | PFVFQFEPEGEAFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0210400_105618261 | 3300021170 | Soil | ENDAFKFRIQFKKSHVSRDELITTLRGILAQLEGSSSEADSTAA |
Ga0210405_106447671 | 3300021171 | Soil | IQFKKSHVSRDELIVTLREILSQLEGSSSDSVDSTAA |
Ga0210405_106854471 | 3300021171 | Soil | QPFVFQFEPEGEQFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0210405_108947563 | 3300021171 | Soil | RFRIQFKKSHVSRDELIVTLREILGQLEGTSSDAADSTAA |
Ga0210405_110412682 | 3300021171 | Soil | PQNETFKFRIQFKKSHVSRDELIATLREILGQLEGSSSEADSTAA |
Ga0210388_108817873 | 3300021181 | Soil | FEPDNETFKFRIQFKKSHVSRDELITTLRGILSQLEGASDSQADSTAA |
Ga0210385_109661391 | 3300021402 | Soil | FVFQFEPEGEAFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0210387_105807691 | 3300021405 | Soil | EAFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0210387_112564611 | 3300021405 | Soil | HYEPEDEAFRFRLQFKKSHVSRDELIRTLRDILGQLEGASEADSTAA |
Ga0210386_109492411 | 3300021406 | Soil | KFRIQFKKSHVSRDELITTLRGILSQLEGSSDSQADSTAA |
Ga0210386_117973561 | 3300021406 | Soil | VFQFEPEGEAFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0210383_113127412 | 3300021407 | Soil | EDEAFRFRLQFKKSHVSRDELIRTLRDILGQLEGASEADSTAA |
Ga0210394_107016811 | 3300021420 | Soil | RIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0210394_112771902 | 3300021420 | Soil | RIQFKKSHVSRDELITTLRGILSQLEGSSSSEADSTAA |
Ga0210392_109274253 | 3300021475 | Soil | FKFRIQFKKSHVSRDELITTLRGILSQLEGSSDSQADSTAA |
Ga0210392_112125991 | 3300021475 | Soil | PAETFKFRIQFKKSHVSRDELISTLREILKQLEGSSSEADSTAA |
Ga0210402_102440735 | 3300021478 | Soil | QPFVFQFEPENEAFKFRLQFKKSHVSRDELVRTLREILEQLEGAEETHSAA |
Ga0210402_109274313 | 3300021478 | Soil | FRIQFKKSHVSRDELITTLRGILAQLEGSSSEADSTAA |
Ga0210409_100266861 | 3300021559 | Soil | EPADEAFRFRLQFKKSHVSRDELIHTLRDILSQLEGASEADSTAA |
Ga0210409_103807131 | 3300021559 | Soil | AFKFRIQFKKSHVSRDELITTLREILAQLEGSSSAADSTAA |
Ga0210409_114240372 | 3300021559 | Soil | EPENEAFKFRLQFKKSHVSRDELIRTLREILEQLEGADEETHSAA |
Ga0210409_116217021 | 3300021559 | Soil | FRLQFKKSHVSRDELIRTLREILAQLEGASEADSTAA |
Ga0126371_116324032 | 3300021560 | Tropical Forest Soil | FKFRIQFKKSHVSRDELIMTLREILSQLEDSGLQDASGDHADSTAA |
Ga0212123_101636224 | 3300022557 | Iron-Sulfur Acid Spring | QFKFRIQFKKSHVTRDELIHTLREILSQLEGDSSGSSSKADSTAA |
Ga0242665_101017771 | 3300022724 | Soil | TFKFRIQFKKSHVSRDELIATLREILGQLEGSSSEADSTAA |
Ga0224551_10451541 | 3300023259 | Soil | QFKKSHVSRDELITTLRGIMSQLEGASDSQADSTAA |
Ga0137417_11022431 | 3300024330 | Vadose Zone Soil | DVQVPRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0207710_102186962 | 3300025900 | Switchgrass Rhizosphere | TFKFRIQFKKSHVSRDELIHTLREILSQLEDSGSQDASGEQADWTAA |
Ga0207699_100357055 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TFKFRIQFKKSHVSRDELITTLRGILAQLEGASDSQADSTAA |
Ga0207712_115093191 | 3300025961 | Switchgrass Rhizosphere | HVSRDELIHTLREILSQLEDSGSQDASGEQADWTAA |
Ga0209839_101967613 | 3300026294 | Soil | QNDTFKFRIQFKKSHVSRDELITTLRDILAQLEGSSSDVNADSTAA |
Ga0209240_10308381 | 3300026304 | Grasslands Soil | EPQNESFKFRIQFKRSHVSRNELIVTLREILAQLEGAEGSEADSTAA |
Ga0209268_11087733 | 3300026314 | Soil | RFRIQFKKSHVSRDELILTLREILAQLEGTSSEADTTAA |
Ga0209802_13085841 | 3300026328 | Soil | FEPPSETFKFRIQFKKSHVSRDELISTLREILAQLEGSSAADSTAA |
Ga0209375_10105159 | 3300026329 | Soil | FRIQFKKSHVSRDELILTLREILAQLEGTSSEADTTAA |
Ga0209159_10026011 | 3300026343 | Soil | RIQFKKSHVSRDELISTLREILAQLEGSSSEADTAA |
Ga0209808_10144476 | 3300026523 | Soil | IQFKKSHVSRDELISTLREILAQLEGSSSEADTAA |
Ga0209059_11492083 | 3300026527 | Soil | KFRIQFKKSHVSRDELISTLREILAQLEGSSSEADTTAA |
Ga0209056_101232474 | 3300026538 | Soil | IQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0209648_105816161 | 3300026551 | Grasslands Soil | SKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0209648_107955011 | 3300026551 | Grasslands Soil | TFRFRIQFKKSHVSRDELISTLREILAQLERSSSEADSTAA |
Ga0179593_11904801 | 3300026555 | Vadose Zone Soil | TFKFRIQFKKSHVSRDELITTLREILTQLEGSSSEADSTAA |
Ga0179587_100701191 | 3300026557 | Vadose Zone Soil | RIQFKKSHVSRDELISTLRQILAQLEGSSSEADSTAA |
Ga0179587_111047041 | 3300026557 | Vadose Zone Soil | IQFKKSHVSRDELIVTLREILAQLEGTAAAADSTAA |
Ga0207860_10320001 | 3300026921 | Tropical Forest Soil | FIFQYEPENEAFRFRLQFKKSHVSRDELVRTLREILAQLEGHEADSTAA |
Ga0209004_10338112 | 3300027376 | Forest Soil | AFKFRIQFKKSHVSRDELILTLREILSQLEGTASESSDADSTAA |
Ga0209332_10523101 | 3300027439 | Forest Soil | FEPEDEEFKFRIQFKKSHVTRDELIHTLREILAQLEGDSSKADSTAA |
Ga0207627_1024291 | 3300027463 | Soil | EPENETFRFRIQFKKSHVSRDELIGTLREILAQLEGSSSKADSTAA |
Ga0209179_11471182 | 3300027512 | Vadose Zone Soil | PPAETFKFRIQFKKSHVSREELISTLRDILAQLEGSSSEADSTAA |
Ga0209219_10668513 | 3300027565 | Forest Soil | QFKKSHVSRDELIGTLREILGQLEGSNSKADSTAA |
Ga0209115_11611581 | 3300027567 | Forest Soil | QFAPENESFKFRIQFKKSHVSRDELILTLREILSQLEGSSSEAADSTAA |
Ga0209588_11365561 | 3300027671 | Vadose Zone Soil | IQFKKSHVSRDELISTLREILSQLEGSSSEADSTAA |
Ga0209588_12229542 | 3300027671 | Vadose Zone Soil | FRIQFKKSHVSRDELISTLREILAQLEGSSSQADSTAA |
Ga0209447_100108691 | 3300027701 | Bog Forest Soil | FKKSHVSRDELIHTLRDILAQLEGSSTEVSADSTAA |
Ga0209328_101146473 | 3300027727 | Forest Soil | FRFRIQFKKSHVSRDELIGTLREILAQLEGSNAKADSTAA |
Ga0209139_101858051 | 3300027795 | Bog Forest Soil | RLQFKKSHVSRDELIRTLREILSQLEGAGEADSTAA |
Ga0209060_100170221 | 3300027826 | Surface Soil | QNESFKFRIQFKKSHVSRDELIVTLREILSQLEGASGSEADSTAA |
Ga0209693_104140622 | 3300027855 | Soil | ENETFKFRIQFKKSHVSRVELITTLRGILSQLEGSSESQADSTAA |
Ga0209693_104460032 | 3300027855 | Soil | RFRIQFKKSHVSRDELIVTLREIIGQLEGTSSAADSTAA |
Ga0209283_105507353 | 3300027875 | Vadose Zone Soil | RFRIQFKKSHVSRDELIGTLRDILAQLEGSSSSEADSTAA |
Ga0209283_109312811 | 3300027875 | Vadose Zone Soil | QFKKSHVSRDELIGTLREILAQLEGPSSEADSTAA |
Ga0209275_105508691 | 3300027884 | Soil | RLQFKKSHVSRDELIRTLRDILAQLEGASEADSTAA |
Ga0209380_100831374 | 3300027889 | Soil | FRIQFKKSHVSRDELIVTLREILSQLEGTSSEADSTAA |
Ga0209624_108763401 | 3300027895 | Forest Soil | QFKKSHVSRDELITTLRGILSQLEGASDSQADSTAA |
Ga0209067_100938731 | 3300027898 | Watersheds | FKFRIQFKKSHVSRDELITTLREILAQLEGSSSEADSTAA |
Ga0209488_106860601 | 3300027903 | Vadose Zone Soil | FKKSHVSRDELIGTLREILAQLEGSSSASDSEADSTAA |
Ga0209488_109811301 | 3300027903 | Vadose Zone Soil | EAFRFRIQFKKSHVSRDELIGTLREILAQLEGPSSEADSTAA |
Ga0209526_100000881 | 3300028047 | Forest Soil | RPFIFHYEPEDEAFRFRLQFKKSHVSRDELIRTLRDILSQLEGSNEADSTAA |
Ga0209526_109367622 | 3300028047 | Forest Soil | EEFKFRIQFKKSHVTRDELIHTLREILAQLERDSSSKADSTAA |
Ga0247663_10372382 | 3300028145 | Soil | KFRIQFKKSHVSRDELIITLREILSQLEGADSHSDSGNQADSTAA |
Ga0302219_104124171 | 3300028747 | Palsa | FKKSHVSRDELIRTLRDILGQLEGTSTEVAADSTAA |
Ga0302228_103920541 | 3300028808 | Palsa | FRFRIQFKKSHVSRDELVETLRGILAQLEGSASAEAADSTAA |
Ga0310037_103899162 | 3300030494 | Peatlands Soil | FRFRLQFKKSHVSRDELIRTLREILAQLEGTGEADSTAA |
Ga0307482_11972781 | 3300030730 | Hardwood Forest Soil | ATEAFKFRIQFKKSHVSRDELVTTLREILAQLEGSSSAADSTAA |
Ga0073994_122844111 | 3300030991 | Soil | PAETFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0170834_1038227561 | 3300031057 | Forest Soil | QPFVFQFEPENEAFKFRLQFRKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0170823_105797221 | 3300031128 | Forest Soil | ENEAFKFRLQFRKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0170824_1029304802 | 3300031231 | Forest Soil | LFQFEPEDEEFKFRIQFKKSHVTRDELIHTLREILAQLEGDSSKADSTAA |
Ga0170824_1137252992 | 3300031231 | Forest Soil | FKKSHVSRDELITTLRGILSQLEGASSDSQADSTAA |
Ga0170824_1209314202 | 3300031231 | Forest Soil | FRIQFKKSHVSRDELIVTLRGILSQLEGTSDSQADSTAA |
Ga0170820_101036182 | 3300031446 | Forest Soil | FRIQFRKSHVSRAELIVTLREILSQLEGSSSEADSTAA |
Ga0310915_106895652 | 3300031573 | Soil | FHYEPENQAFRFRLQFKKSQVSREELIRTLREILSQLEGNEASEADSTAA |
Ga0318542_100046401 | 3300031668 | Soil | IQFKKSHVSRDELISTLREILAQLEGSSSEADTTAA |
Ga0310686_1035345513 | 3300031708 | Soil | FRIQFKKSHVSRDELIHTLRDILAQLEGTSTEASADSTAA |
Ga0307476_101688801 | 3300031715 | Hardwood Forest Soil | PENETFKFRIQFKKSHVSRDELITTLRGILSQLEGSSDSQADSTAA |
Ga0307476_102933813 | 3300031715 | Hardwood Forest Soil | EPQSETFKFRIQFKKSHVSREELITTLREILTQLEGSSTETADSTAA |
Ga0307474_104362831 | 3300031718 | Hardwood Forest Soil | HFEPQNDAFKFRIQFKKSHVSRDELISTLREILSQLEGTTTESAESSDADSTAA |
Ga0306917_108344871 | 3300031719 | Soil | YEPEDEKFKFRLQFKKSHVSRDELIRTLREILEQLEGAESSSAA |
Ga0318537_104026252 | 3300031763 | Soil | NEAFRIRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0318509_100754023 | 3300031768 | Soil | VSRDELIMTLREILSQLEDAGSQDASGDHADSTAA |
Ga0307473_114275202 | 3300031820 | Hardwood Forest Soil | FEPPAETFKFRIQFKKSHVSRDELILTLREILAQLEGSSSEADSTAA |
Ga0307478_102662441 | 3300031823 | Hardwood Forest Soil | EPPTESFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0307478_112959262 | 3300031823 | Hardwood Forest Soil | FQFEPENEAYRFRIQFKKSHVSRDELIGTLREILAQLEGSSSEADSTAA |
Ga0318544_103350561 | 3300031880 | Soil | FRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0306923_102162621 | 3300031910 | Soil | FHFEPEDQAFRFRLQFKKSHVSRDELIRTLREILAQLEGADAADSTAA |
Ga0306923_117874211 | 3300031910 | Soil | KFRLQFKKSHVSRDELIRTLREILEQLEGAESSSAA |
Ga0310912_104940172 | 3300031941 | Soil | IQFKKSHVSRDELITTLREILSQLEGSTSEADSTAA |
Ga0310916_110470882 | 3300031942 | Soil | AFRFRMQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0310916_112591361 | 3300031942 | Soil | EPENEAFRFRLQFKKSHVSRDELIRTLREILAQLEGHEADSTAA |
Ga0310910_106416302 | 3300031946 | Soil | YEPENQAFRFRLQFKKSQVSREELIRTLREILSQLEGNEASEADSTAA |
Ga0307479_100920591 | 3300031962 | Hardwood Forest Soil | FHFEPQNDAFKFRIQFKKSHVSRDELISTLREILSQLEGTASESPTADSTAA |
Ga0307479_101117965 | 3300031962 | Hardwood Forest Soil | SFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0307479_114809822 | 3300031962 | Hardwood Forest Soil | FKFRIQFKKSHVSRTELIVTLREILAQLEGAEGSEADSTAA |
Ga0310911_101278453 | 3300032035 | Soil | FQFEPPSETFRFRIQFKKSHVSRDELISTLREILAQLEGSSSEADTTAA |
Ga0310911_108945462 | 3300032035 | Soil | NEAFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0307471_1002894791 | 3300032180 | Hardwood Forest Soil | EPQNETFKFRIQFKKSHVSRDELITTLREILAQLEGSSSEADSTAA |
Ga0307471_1007021041 | 3300032180 | Hardwood Forest Soil | RFRIQFKKSHVSRDELIGTLREILAQLEGSSSKADSTAA |
Ga0307471_1010790524 | 3300032180 | Hardwood Forest Soil | ENEAFKFRLQFKKSHVSRDELIRTLREILEQLEGAEETHSAA |
Ga0307471_1020633802 | 3300032180 | Hardwood Forest Soil | AFKFRIQFKKSHVSRDELISTLREILSQLEGSSSEADSTAA |
Ga0307472_1001670301 | 3300032205 | Hardwood Forest Soil | EAFRFRMQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0307472_1003677823 | 3300032205 | Hardwood Forest Soil | EPENETFRFRIQFKKSHVSRDELITTLRGILSQLEGSSSEADYTAA |
Ga0307472_1004004223 | 3300032205 | Hardwood Forest Soil | FEPPTQTFKFRIQFKKSHVSRDELISTLREILAQLEGSSSEADSTAA |
Ga0306920_1016209273 | 3300032261 | Soil | FVFHFEPEDEKFKFRLQFKKSHVTRDELIRTLRDILAQLEGEESSSSAA |
Ga0335082_108543091 | 3300032782 | Soil | FRFRLQFKKSHVSRDELVRTLREILAQLEGNEADSTAA |
Ga0335079_122064022 | 3300032783 | Soil | ENESFRFRIQFKKSHVSRDELIVTLREILAQLEGATEADSTAA |
Ga0335080_103502003 | 3300032828 | Soil | PFVFHYEPENELFKFRLQFKKSHVSRDELIRTLREILAQLEGHEADSTAA |
Ga0335081_111622102 | 3300032892 | Soil | QYEPENEAFRFRLQFKKSHVSRDELIRTLREILAQLEGHEADSTAA |
Ga0310914_103970981 | 3300033289 | Soil | YEPEDEAFRFRLQFKKSHVSRDELIRTLREILAQLEGTSEADSTAA |
Ga0371489_0481546_444_551 | 3300033755 | Peat Soil | RLQFKKSQVSREELIRTLREILAQLEGSEADSTAA |
Ga0370483_0366392_362_499 | 3300034124 | Untreated Peat Soil | NDAFKFRIQFKKSHVSRDELIHTLRDILAQLEGSAANVNADSTAA |
⦗Top⦘ |