Basic Information | |
---|---|
Family ID | F009262 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 320 |
Average Sequence Length | 44 residues |
Representative Sequence | MEQIALELARLNKTMAEILHLIQKEMKRGEELSKKYDKERNE |
Number of Associated Samples | 189 |
Number of Associated Scaffolds | 320 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 72.73 % |
% of genes near scaffold ends (potentially truncated) | 33.44 % |
% of genes from short scaffolds (< 2000 bps) | 94.06 % |
Associated GOLD sequencing projects | 168 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.375 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.125 % of family members) |
Environment Ontology (ENVO) | Unclassified (80.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.438 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 320 Family Scaffolds |
---|---|---|
PF03237 | Terminase_6N | 1.56 |
PF03104 | DNA_pol_B_exo1 | 0.31 |
PF01583 | APS_kinase | 0.31 |
COG ID | Name | Functional Category | % Frequency in 320 Family Scaffolds |
---|---|---|---|
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.31 |
COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 0.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.69 % |
Unclassified | root | N/A | 25.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035265000|ErSWdraf_F5BXKTZ02IOLZV | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 523 | Open in IMG/M |
3300000736|JGI12547J11936_1011668 | Not Available | 2255 | Open in IMG/M |
3300000736|JGI12547J11936_1086199 | Not Available | 579 | Open in IMG/M |
3300000756|JGI12421J11937_10025682 | All Organisms → Viruses → environmental samples → uncultured virus | 2145 | Open in IMG/M |
3300001282|B570J14230_10091141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 930 | Open in IMG/M |
3300002386|B570J29613_1004722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 945 | Open in IMG/M |
3300002835|B570J40625_100447984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1233 | Open in IMG/M |
3300003277|JGI25908J49247_10089559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 750 | Open in IMG/M |
3300003277|JGI25908J49247_10130744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 591 | Open in IMG/M |
3300003277|JGI25908J49247_10162378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 519 | Open in IMG/M |
3300003388|JGI25910J50241_10186593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 526 | Open in IMG/M |
3300003394|JGI25907J50239_1061220 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300003394|JGI25907J50239_1113059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 528 | Open in IMG/M |
3300003395|JGI25917J50250_1082111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 671 | Open in IMG/M |
3300003404|JGI25920J50251_10031989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1557 | Open in IMG/M |
3300003412|JGI25912J50252_10090893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 750 | Open in IMG/M |
3300003412|JGI25912J50252_10142041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 555 | Open in IMG/M |
3300003499|JGI25930J51415_1070955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 583 | Open in IMG/M |
3300004481|Ga0069718_10109387 | Not Available | 629 | Open in IMG/M |
3300004789|Ga0007752_11202581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 713 | Open in IMG/M |
3300005517|Ga0070374_10379111 | Not Available | 712 | Open in IMG/M |
3300005517|Ga0070374_10540071 | Not Available | 580 | Open in IMG/M |
3300005517|Ga0070374_10690472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 504 | Open in IMG/M |
3300005580|Ga0049083_10108589 | Not Available | 959 | Open in IMG/M |
3300005580|Ga0049083_10168252 | All Organisms → Viruses | 749 | Open in IMG/M |
3300005580|Ga0049083_10268170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 573 | Open in IMG/M |
3300005581|Ga0049081_10155765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 834 | Open in IMG/M |
3300005581|Ga0049081_10207612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 700 | Open in IMG/M |
3300005581|Ga0049081_10279417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 579 | Open in IMG/M |
3300005581|Ga0049081_10292848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 562 | Open in IMG/M |
3300005581|Ga0049081_10311581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 540 | Open in IMG/M |
3300005582|Ga0049080_10110630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 931 | Open in IMG/M |
3300005582|Ga0049080_10198389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 663 | Open in IMG/M |
3300005584|Ga0049082_10187907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 709 | Open in IMG/M |
3300005584|Ga0049082_10212832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 659 | Open in IMG/M |
3300005943|Ga0073926_10035731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 938 | Open in IMG/M |
3300006030|Ga0075470_10212512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 552 | Open in IMG/M |
3300006484|Ga0070744_10246444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 505 | Open in IMG/M |
3300006639|Ga0079301_1107622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 849 | Open in IMG/M |
3300006805|Ga0075464_10083891 | Not Available | 1812 | Open in IMG/M |
3300006805|Ga0075464_10610235 | All Organisms → Viruses | 672 | Open in IMG/M |
3300006805|Ga0075464_10833057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 574 | Open in IMG/M |
3300006805|Ga0075464_11061570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 510 | Open in IMG/M |
3300006875|Ga0075473_10133380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 993 | Open in IMG/M |
3300007162|Ga0079300_10017373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 2608 | Open in IMG/M |
3300007541|Ga0099848_1335541 | Not Available | 512 | Open in IMG/M |
3300007559|Ga0102828_1133634 | Not Available | 616 | Open in IMG/M |
3300007670|Ga0102862_1158824 | Not Available | 580 | Open in IMG/M |
3300007734|Ga0104986_1080 | All Organisms → cellular organisms → Bacteria | 10586 | Open in IMG/M |
3300008114|Ga0114347_1101317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1113 | Open in IMG/M |
3300008117|Ga0114351_1064729 | Not Available | 2233 | Open in IMG/M |
3300008117|Ga0114351_1242993 | Not Available | 900 | Open in IMG/M |
3300008120|Ga0114355_1080777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1343 | Open in IMG/M |
3300008259|Ga0114841_1030879 | All Organisms → cellular organisms → Bacteria | 5302 | Open in IMG/M |
3300008261|Ga0114336_1355304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 524 | Open in IMG/M |
3300008266|Ga0114363_1170228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 702 | Open in IMG/M |
3300008267|Ga0114364_1157739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 614 | Open in IMG/M |
3300008448|Ga0114876_1173028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 762 | Open in IMG/M |
3300008448|Ga0114876_1178398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 743 | Open in IMG/M |
3300008450|Ga0114880_1147828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 849 | Open in IMG/M |
3300008450|Ga0114880_1184304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 717 | Open in IMG/M |
3300009026|Ga0102829_1099253 | Not Available | 908 | Open in IMG/M |
3300009068|Ga0114973_10066721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2089 | Open in IMG/M |
3300009068|Ga0114973_10380057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 742 | Open in IMG/M |
3300009068|Ga0114973_10394679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 725 | Open in IMG/M |
3300009068|Ga0114973_10441527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 678 | Open in IMG/M |
3300009074|Ga0115549_1108154 | Not Available | 926 | Open in IMG/M |
3300009146|Ga0105091_10090780 | Not Available | 1392 | Open in IMG/M |
3300009152|Ga0114980_10646773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 595 | Open in IMG/M |
3300009155|Ga0114968_10294021 | Not Available | 910 | Open in IMG/M |
3300009155|Ga0114968_10688237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 536 | Open in IMG/M |
3300009155|Ga0114968_10702963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 529 | Open in IMG/M |
3300009155|Ga0114968_10769777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 501 | Open in IMG/M |
3300009159|Ga0114978_10776031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 542 | Open in IMG/M |
3300009159|Ga0114978_10796073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 533 | Open in IMG/M |
3300009159|Ga0114978_10834360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 518 | Open in IMG/M |
3300009161|Ga0114966_10260348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1066 | Open in IMG/M |
3300009161|Ga0114966_10620229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 601 | Open in IMG/M |
3300009161|Ga0114966_10649506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 583 | Open in IMG/M |
3300009164|Ga0114975_10684930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 542 | Open in IMG/M |
3300009181|Ga0114969_10592830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 608 | Open in IMG/M |
3300009181|Ga0114969_10788684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 504 | Open in IMG/M |
3300009183|Ga0114974_10560318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 634 | Open in IMG/M |
3300009183|Ga0114974_10762699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 521 | Open in IMG/M |
3300009185|Ga0114971_10687254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 560 | Open in IMG/M |
3300009185|Ga0114971_10826341 | All Organisms → Viruses | 501 | Open in IMG/M |
3300009187|Ga0114972_10280613 | Not Available | 994 | Open in IMG/M |
3300009187|Ga0114972_10796750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 518 | Open in IMG/M |
3300009187|Ga0114972_10812570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 512 | Open in IMG/M |
3300009433|Ga0115545_1140773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 847 | Open in IMG/M |
3300010157|Ga0114964_10069105 | Not Available | 1800 | Open in IMG/M |
3300010160|Ga0114967_10260157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 906 | Open in IMG/M |
3300010160|Ga0114967_10443744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 641 | Open in IMG/M |
3300010160|Ga0114967_10546350 | Not Available | 561 | Open in IMG/M |
3300010160|Ga0114967_10581667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 539 | Open in IMG/M |
3300010160|Ga0114967_10632977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 512 | Open in IMG/M |
3300010354|Ga0129333_10212953 | Not Available | 1754 | Open in IMG/M |
3300011011|Ga0139556_1044003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 660 | Open in IMG/M |
3300011113|Ga0151517_1407 | All Organisms → cellular organisms → Bacteria | 16262 | Open in IMG/M |
3300011268|Ga0151620_1142795 | Not Available | 738 | Open in IMG/M |
3300011268|Ga0151620_1247286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 530 | Open in IMG/M |
3300012012|Ga0153799_1078479 | Not Available | 593 | Open in IMG/M |
3300012012|Ga0153799_1094306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 534 | Open in IMG/M |
3300012012|Ga0153799_1104900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 501 | Open in IMG/M |
3300012017|Ga0153801_1078457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 581 | Open in IMG/M |
3300012017|Ga0153801_1080074 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 575 | Open in IMG/M |
3300012663|Ga0157203_1014941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1202 | Open in IMG/M |
3300013004|Ga0164293_10341223 | Not Available | 1025 | Open in IMG/M |
3300013004|Ga0164293_10542630 | Not Available | 762 | Open in IMG/M |
3300013004|Ga0164293_10803003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 596 | Open in IMG/M |
3300013004|Ga0164293_10833238 | Not Available | 583 | Open in IMG/M |
3300013004|Ga0164293_10889133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 561 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10653231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 559 | Open in IMG/M |
3300013295|Ga0170791_10327619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 555 | Open in IMG/M |
3300013372|Ga0177922_10181746 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300013372|Ga0177922_10838518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 503 | Open in IMG/M |
3300014811|Ga0119960_1072913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 605 | Open in IMG/M |
3300015050|Ga0181338_1016858 | Not Available | 1158 | Open in IMG/M |
3300015050|Ga0181338_1033764 | Not Available | 774 | Open in IMG/M |
3300015050|Ga0181338_1068866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 504 | Open in IMG/M |
3300015050|Ga0181338_1069790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 500 | Open in IMG/M |
3300017699|Ga0181345_100632 | Not Available | 1403 | Open in IMG/M |
3300017700|Ga0181339_1023902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 680 | Open in IMG/M |
3300017701|Ga0181364_1015817 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
3300017701|Ga0181364_1036553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 789 | Open in IMG/M |
3300017701|Ga0181364_1040331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 745 | Open in IMG/M |
3300017701|Ga0181364_1062027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 577 | Open in IMG/M |
3300017707|Ga0181363_1053903 | Not Available | 716 | Open in IMG/M |
3300017716|Ga0181350_1158542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 525 | Open in IMG/M |
3300017723|Ga0181362_1111714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 538 | Open in IMG/M |
3300017723|Ga0181362_1121670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 511 | Open in IMG/M |
3300017754|Ga0181344_1099193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 847 | Open in IMG/M |
3300017754|Ga0181344_1100886 | Not Available | 838 | Open in IMG/M |
3300017754|Ga0181344_1146903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 673 | Open in IMG/M |
3300017754|Ga0181344_1150212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 665 | Open in IMG/M |
3300017761|Ga0181356_1197377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 598 | Open in IMG/M |
3300017761|Ga0181356_1209999 | Not Available | 572 | Open in IMG/M |
3300017766|Ga0181343_1069051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1022 | Open in IMG/M |
3300017774|Ga0181358_1249120 | Not Available | 559 | Open in IMG/M |
3300017774|Ga0181358_1256046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 549 | Open in IMG/M |
3300017777|Ga0181357_1255888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 607 | Open in IMG/M |
3300017777|Ga0181357_1268590 | Not Available | 588 | Open in IMG/M |
3300017780|Ga0181346_1291872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 556 | Open in IMG/M |
3300017784|Ga0181348_1182640 | Not Available | 764 | Open in IMG/M |
3300017784|Ga0181348_1303041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 534 | Open in IMG/M |
3300017788|Ga0169931_10297982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1270 | Open in IMG/M |
3300018868|Ga0187844_10417228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 549 | Open in IMG/M |
3300019093|Ga0187843_10410485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 544 | Open in IMG/M |
3300019781|Ga0181360_122043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 514 | Open in IMG/M |
3300019783|Ga0181361_109842 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 743 | Open in IMG/M |
3300019783|Ga0181361_114542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 619 | Open in IMG/M |
3300019784|Ga0181359_1066849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1366 | Open in IMG/M |
3300019784|Ga0181359_1095143 | Not Available | 1099 | Open in IMG/M |
3300019784|Ga0181359_1135457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 863 | Open in IMG/M |
3300019784|Ga0181359_1173987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 717 | Open in IMG/M |
3300019784|Ga0181359_1182584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 691 | Open in IMG/M |
3300019784|Ga0181359_1188877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 673 | Open in IMG/M |
3300019784|Ga0181359_1192920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 662 | Open in IMG/M |
3300019784|Ga0181359_1194079 | Not Available | 659 | Open in IMG/M |
3300019784|Ga0181359_1220659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 596 | Open in IMG/M |
3300019784|Ga0181359_1226227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 584 | Open in IMG/M |
3300019784|Ga0181359_1229644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 577 | Open in IMG/M |
3300019784|Ga0181359_1231282 | Not Available | 574 | Open in IMG/M |
3300019784|Ga0181359_1233731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 569 | Open in IMG/M |
3300019784|Ga0181359_1240252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 556 | Open in IMG/M |
3300019784|Ga0181359_1251618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 535 | Open in IMG/M |
3300020074|Ga0194113_11128028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 516 | Open in IMG/M |
3300020109|Ga0194112_10757695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 641 | Open in IMG/M |
3300020141|Ga0211732_1128908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 635 | Open in IMG/M |
3300020141|Ga0211732_1519167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
3300020151|Ga0211736_11031461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 630 | Open in IMG/M |
3300020151|Ga0211736_11031505 | Not Available | 1471 | Open in IMG/M |
3300020159|Ga0211734_10712781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 574 | Open in IMG/M |
3300020160|Ga0211733_10005024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1715 | Open in IMG/M |
3300020160|Ga0211733_10760465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 731 | Open in IMG/M |
3300020161|Ga0211726_10883161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 544 | Open in IMG/M |
3300020162|Ga0211735_11419757 | Not Available | 1215 | Open in IMG/M |
3300020167|Ga0194035_1084406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1047 | Open in IMG/M |
3300020172|Ga0211729_10324318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 725 | Open in IMG/M |
3300020172|Ga0211729_11488247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 520 | Open in IMG/M |
3300020205|Ga0211731_11334771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 690 | Open in IMG/M |
3300020205|Ga0211731_11379556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1670 | Open in IMG/M |
3300020493|Ga0208591_1039018 | All Organisms → Viruses | 537 | Open in IMG/M |
3300020506|Ga0208091_1033700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 568 | Open in IMG/M |
3300020513|Ga0208090_1028219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 780 | Open in IMG/M |
3300020530|Ga0208235_1011955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1105 | Open in IMG/M |
3300020530|Ga0208235_1017024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 901 | Open in IMG/M |
3300020550|Ga0208600_1056945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 578 | Open in IMG/M |
3300020551|Ga0208360_1006578 | All Organisms → Viruses → environmental samples → uncultured virus | 1760 | Open in IMG/M |
3300020573|Ga0208485_1073693 | Not Available | 566 | Open in IMG/M |
3300021141|Ga0214163_1033434 | All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae | 1444 | Open in IMG/M |
3300021961|Ga0222714_10555004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 581 | Open in IMG/M |
3300021962|Ga0222713_10162751 | Not Available | 1527 | Open in IMG/M |
3300021963|Ga0222712_10470618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 749 | Open in IMG/M |
3300022179|Ga0181353_1045426 | Not Available | 1157 | Open in IMG/M |
3300022179|Ga0181353_1097820 | Not Available | 724 | Open in IMG/M |
3300022179|Ga0181353_1165827 | Not Available | 500 | Open in IMG/M |
3300022190|Ga0181354_1102844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 929 | Open in IMG/M |
3300022190|Ga0181354_1117099 | Not Available | 858 | Open in IMG/M |
3300022190|Ga0181354_1134691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 784 | Open in IMG/M |
3300022190|Ga0181354_1150169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 729 | Open in IMG/M |
3300022190|Ga0181354_1161042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 695 | Open in IMG/M |
3300022190|Ga0181354_1177530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 649 | Open in IMG/M |
3300022190|Ga0181354_1180720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 641 | Open in IMG/M |
3300022190|Ga0181354_1199735 | Not Available | 596 | Open in IMG/M |
3300022190|Ga0181354_1204630 | Not Available | 586 | Open in IMG/M |
3300022190|Ga0181354_1218558 | Not Available | 558 | Open in IMG/M |
3300022190|Ga0181354_1232324 | Not Available | 534 | Open in IMG/M |
3300022407|Ga0181351_1101570 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
3300022407|Ga0181351_1161558 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 794 | Open in IMG/M |
3300022407|Ga0181351_1179446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 730 | Open in IMG/M |
3300022407|Ga0181351_1205955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 652 | Open in IMG/M |
3300022407|Ga0181351_1243130 | Not Available | 566 | Open in IMG/M |
3300022407|Ga0181351_1260476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 533 | Open in IMG/M |
3300022407|Ga0181351_1279332 | Not Available | 502 | Open in IMG/M |
3300022752|Ga0214917_10000354 | Not Available | 59754 | Open in IMG/M |
3300022752|Ga0214917_10019517 | Not Available | 5628 | Open in IMG/M |
3300024276|Ga0255205_1050367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 618 | Open in IMG/M |
3300024490|Ga0255185_1062230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 509 | Open in IMG/M |
3300025896|Ga0208916_10060166 | Not Available | 1570 | Open in IMG/M |
3300025896|Ga0208916_10373593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
3300027144|Ga0255102_1014311 | Not Available | 1464 | Open in IMG/M |
3300027147|Ga0255113_1071648 | Not Available | 635 | Open in IMG/M |
3300027149|Ga0255108_1048575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 797 | Open in IMG/M |
3300027154|Ga0255111_1073316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 646 | Open in IMG/M |
3300027375|Ga0255137_1063773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 662 | Open in IMG/M |
3300027499|Ga0208788_1033491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1489 | Open in IMG/M |
3300027518|Ga0208787_1039764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1379 | Open in IMG/M |
3300027586|Ga0208966_1144537 | Not Available | 632 | Open in IMG/M |
3300027586|Ga0208966_1176257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 556 | Open in IMG/M |
3300027608|Ga0208974_1036099 | Not Available | 1471 | Open in IMG/M |
3300027608|Ga0208974_1074350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
3300027608|Ga0208974_1104658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 752 | Open in IMG/M |
3300027608|Ga0208974_1114734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 708 | Open in IMG/M |
3300027659|Ga0208975_1056552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1194 | Open in IMG/M |
3300027659|Ga0208975_1195902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 542 | Open in IMG/M |
3300027689|Ga0209551_1018209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2388 | Open in IMG/M |
3300027697|Ga0209033_1042154 | Not Available | 1682 | Open in IMG/M |
3300027707|Ga0209443_1203357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 695 | Open in IMG/M |
3300027720|Ga0209617_10234356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 699 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1043277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 2710 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1333464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 523 | Open in IMG/M |
(restricted) 3300027730|Ga0247833_1107034 | Not Available | 1220 | Open in IMG/M |
3300027734|Ga0209087_1019282 | All Organisms → Viruses | 3367 | Open in IMG/M |
3300027734|Ga0209087_1277434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 608 | Open in IMG/M |
3300027736|Ga0209190_1088002 | Not Available | 1461 | Open in IMG/M |
3300027736|Ga0209190_1389995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 504 | Open in IMG/M |
3300027744|Ga0209355_1100281 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1309 | Open in IMG/M |
3300027746|Ga0209597_1182432 | Not Available | 873 | Open in IMG/M |
3300027746|Ga0209597_1332681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 573 | Open in IMG/M |
3300027754|Ga0209596_1053477 | Not Available | 2097 | Open in IMG/M |
3300027754|Ga0209596_1060569 | Not Available | 1928 | Open in IMG/M |
3300027754|Ga0209596_1127198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1162 | Open in IMG/M |
3300027754|Ga0209596_1300073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 639 | Open in IMG/M |
3300027754|Ga0209596_1314337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 618 | Open in IMG/M |
3300027759|Ga0209296_1077195 | Not Available | 1651 | Open in IMG/M |
3300027759|Ga0209296_1191158 | Not Available | 885 | Open in IMG/M |
3300027760|Ga0209598_10053966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 2053 | Open in IMG/M |
3300027770|Ga0209086_10060193 | Not Available | 2086 | Open in IMG/M |
3300027770|Ga0209086_10355013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 605 | Open in IMG/M |
3300027785|Ga0209246_10147973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 923 | Open in IMG/M |
3300027797|Ga0209107_10242772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 869 | Open in IMG/M |
3300027804|Ga0209358_10196676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1046 | Open in IMG/M |
3300027816|Ga0209990_10356633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 644 | Open in IMG/M |
3300027892|Ga0209550_10286152 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
3300027963|Ga0209400_1155874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 990 | Open in IMG/M |
3300027969|Ga0209191_1074588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1494 | Open in IMG/M |
3300027969|Ga0209191_1228981 | Not Available | 718 | Open in IMG/M |
3300027971|Ga0209401_1125043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1031 | Open in IMG/M |
3300027971|Ga0209401_1164097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 857 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1147082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 958 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1259968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 619 | Open in IMG/M |
3300028025|Ga0247723_1001818 | Not Available | 12065 | Open in IMG/M |
3300028025|Ga0247723_1100599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
(restricted) 3300028044|Ga0247838_1286647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 542 | Open in IMG/M |
3300028298|Ga0268280_1201462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 506 | Open in IMG/M |
(restricted) 3300028553|Ga0247839_1329813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 562 | Open in IMG/M |
(restricted) 3300028557|Ga0247832_1289779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 532 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1106872 | Not Available | 1260 | Open in IMG/M |
(restricted) 3300028571|Ga0247844_1167453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 872 | Open in IMG/M |
(restricted) 3300029268|Ga0247842_10271436 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 919 | Open in IMG/M |
3300029930|Ga0119944_1025889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 775 | Open in IMG/M |
3300031772|Ga0315288_11736938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 501 | Open in IMG/M |
3300031786|Ga0315908_11080214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 643 | Open in IMG/M |
3300032046|Ga0315289_11179177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 620 | Open in IMG/M |
3300032046|Ga0315289_11496699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 515 | Open in IMG/M |
3300032050|Ga0315906_10294007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1467 | Open in IMG/M |
3300032050|Ga0315906_10829359 | Not Available | 720 | Open in IMG/M |
3300032092|Ga0315905_11335807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 574 | Open in IMG/M |
3300032116|Ga0315903_10861512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 653 | Open in IMG/M |
3300032156|Ga0315295_12035283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 538 | Open in IMG/M |
3300032173|Ga0315268_12329320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 549 | Open in IMG/M |
3300033981|Ga0334982_0358056 | Not Available | 672 | Open in IMG/M |
3300033994|Ga0334996_0131423 | All Organisms → Viruses → environmental samples → uncultured virus | 1417 | Open in IMG/M |
3300033994|Ga0334996_0266553 | Not Available | 872 | Open in IMG/M |
3300033994|Ga0334996_0529412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 521 | Open in IMG/M |
3300033996|Ga0334979_0141540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1462 | Open in IMG/M |
3300033996|Ga0334979_0595776 | Not Available | 587 | Open in IMG/M |
3300034019|Ga0334998_0251278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1072 | Open in IMG/M |
3300034061|Ga0334987_0198960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1412 | Open in IMG/M |
3300034062|Ga0334995_0268318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1137 | Open in IMG/M |
3300034062|Ga0334995_0730816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 552 | Open in IMG/M |
3300034063|Ga0335000_0313137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
3300034073|Ga0310130_0004775 | All Organisms → cellular organisms → Bacteria | 5452 | Open in IMG/M |
3300034095|Ga0335022_0137911 | Not Available | 1521 | Open in IMG/M |
3300034101|Ga0335027_0253066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 1216 | Open in IMG/M |
3300034101|Ga0335027_0733721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 581 | Open in IMG/M |
3300034102|Ga0335029_0124696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1790 | Open in IMG/M |
3300034103|Ga0335030_0157805 | Not Available | 1610 | Open in IMG/M |
3300034106|Ga0335036_0676975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 614 | Open in IMG/M |
3300034111|Ga0335063_0444818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 644 | Open in IMG/M |
3300034116|Ga0335068_0204266 | Not Available | 1034 | Open in IMG/M |
3300034117|Ga0335033_0097060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1708 | Open in IMG/M |
3300034118|Ga0335053_0571028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
3300034120|Ga0335056_0431268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 705 | Open in IMG/M |
3300034122|Ga0335060_0417106 | Not Available | 707 | Open in IMG/M |
3300034168|Ga0335061_0621980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 541 | Open in IMG/M |
3300034200|Ga0335065_0439029 | Not Available | 793 | Open in IMG/M |
3300034356|Ga0335048_0525187 | Not Available | 562 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.12% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.25% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.37% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.12% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.25% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.44% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.81% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.19% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.50% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.56% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.56% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.88% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.25% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.94% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.94% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.94% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.94% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.31% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.31% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.31% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.31% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.31% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.31% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.31% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.31% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.31% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.62% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.62% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.62% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.62% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002386 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020513 | Freshwater microbial communities from Lake Mendota, WI - 20JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024276 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027149 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h | Environmental | Open in IMG/M |
3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027375 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
3300028298 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_40m | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ErSWdraft_64260 | 2035265000 | Freshwater | MEQIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNE |
JGI12547J11936_10116685 | 3300000736 | Freshwater And Sediment | MEQIALELARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARNE* |
JGI12547J11936_10861992 | 3300000736 | Freshwater And Sediment | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNE* |
JGI12421J11937_100256824 | 3300000756 | Freshwater And Sediment | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYEKE |
B570J14230_100911415 | 3300001282 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNEKD* |
B570J29613_10047223 | 3300002386 | Freshwater | IAKELSKLNATMAEILYLIQKEMKKSEELSKKWDKERNE* |
B570J40625_1004479841 | 3300002835 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYDEERKKD* |
JGI25908J49247_100895593 | 3300003277 | Freshwater Lake | MEQIALEIARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARNE* |
JGI25908J49247_101307441 | 3300003277 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKRGEELSKKYDKERNE* |
JGI25908J49247_101623782 | 3300003277 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLERE |
JGI25910J50241_101865931 | 3300003388 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYDEERKKD*A* |
JGI25907J50239_10612201 | 3300003394 | Freshwater Lake | MEQIALELARLNKTMADILHLIQLEMKRGEELAKKYNLEREKND* |
JGI25907J50239_11130591 | 3300003394 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNES |
JGI25917J50250_10821111 | 3300003395 | Freshwater Lake | PTGVTMEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYEKERNE* |
JGI25920J50251_100319892 | 3300003404 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNES* |
JGI25912J50252_100908933 | 3300003412 | Freshwater Lake | MEQIALELARLNKTMADILHLIQLEMKKSEELSKKWEKXRNE* |
JGI25912J50252_101420411 | 3300003412 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQLEMKRGEELAKKYEKERNE* |
JGI25930J51415_10709551 | 3300003499 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKERNE* |
Ga0069718_101093871 | 3300004481 | Sediment | MEKIAIEIARLNKTLTEILILIQKEMKRSEEISKQYEKERKERNE* |
Ga0007752_112025814 | 3300004789 | Freshwater Lake | VTMEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKERNES* |
Ga0070374_103791111 | 3300005517 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWDKERNE* |
Ga0070374_105400712 | 3300005517 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKK |
Ga0070374_106904721 | 3300005517 | Freshwater Lake | NNERYNMDKIALELARLNATMAEILYLIQKEMKKSEELSKKWEKERNENNN* |
Ga0049083_101085893 | 3300005580 | Freshwater Lentic | MEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNE* |
Ga0049083_101682521 | 3300005580 | Freshwater Lentic | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYEKERNE* |
Ga0049083_102681702 | 3300005580 | Freshwater Lentic | MEQIALELARLNKTMADILHLIQLEMKKSEELSKKWEKERNE* |
Ga0049081_101557652 | 3300005581 | Freshwater Lentic | MEQIALELARLNKTMAEILHLIQKEMKKSEELSKKWEKERNEKN* |
Ga0049081_102076121 | 3300005581 | Freshwater Lentic | QIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKNENNN* |
Ga0049081_102794173 | 3300005581 | Freshwater Lentic | MEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNESNN* |
Ga0049081_102928482 | 3300005581 | Freshwater Lentic | MEQIALEIARLNKTLTEILILIQKEMKQSDELRRKYDLEREKNEKD* |
Ga0049081_103115812 | 3300005581 | Freshwater Lentic | MEQIALELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE* |
Ga0049080_101106301 | 3300005582 | Freshwater Lentic | MEQIAKELSKLNATMAEILYLIQKEMKRGEELAKKYEKERNESNN* |
Ga0049080_101983893 | 3300005582 | Freshwater Lentic | NKTMAEILHLIQKEMKQSDELRRKYDLEREKNENNN* |
Ga0049082_101879071 | 3300005584 | Freshwater Lentic | GYINNERYNMEQIALELARLNKTMAEILHLIQKEMKRGEELSKKYDEERKKD* |
Ga0049082_102128321 | 3300005584 | Freshwater Lentic | MDQIAIELARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARNE* |
Ga0073926_100357312 | 3300005943 | Sand | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKND* |
Ga0075470_102125122 | 3300006030 | Aqueous | MDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE* |
Ga0070744_102464442 | 3300006484 | Estuarine | MEQIALELARLNKTMAEILHLIQKEMKKSEELSKKWEKERNENNN* |
Ga0079301_11076221 | 3300006639 | Deep Subsurface | MDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNE* |
Ga0075464_100838913 | 3300006805 | Aqueous | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNE* |
Ga0075464_106102351 | 3300006805 | Aqueous | MEQIALEIARLNKTLTEILILIQKEMKRSEELSKKWEKERNE* |
Ga0075464_108330571 | 3300006805 | Aqueous | LEIARLNKTMAEILHLIQKEMKRSEELSKKWEKERNE* |
Ga0075464_110615701 | 3300006805 | Aqueous | NMEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKND* |
Ga0075473_101333801 | 3300006875 | Aqueous | MEQIALELARLNKTMAEILHLIQKEMKRSEELSKKWEKE |
Ga0079300_100173732 | 3300007162 | Deep Subsurface | MEQIALELKRLNATMAEILYLIQKEMKKSEELSKKWEKERNE* |
Ga0099848_13355411 | 3300007541 | Aqueous | MEKIALEIARLNKTLTEILILIQKEMKRGEELSKKWEK |
Ga0102828_11336341 | 3300007559 | Estuarine | MEQIAKELSKLNATMAEILYLIQKEMKRSEELSKKYDLEREKND* |
Ga0102862_11588241 | 3300007670 | Estuarine | RYNMEQIALEIARLNKTITEILILIQKEMKRSEELSKKWEKERNE* |
Ga0104986_108011 | 3300007734 | Freshwater | MEQIALEIARLNKTLTEILILIQKEMKRSEELSKKWEKERNES* |
Ga0114347_11013172 | 3300008114 | Freshwater, Plankton | MEKIALEIARLNKTLTEILILIQKEMKRGEELSKKWEKERNES* |
Ga0114351_10647292 | 3300008117 | Freshwater, Plankton | MEKIALEIARLNKTLTEILILIQKEMKRGEELSKKWEKERNE* |
Ga0114351_12429932 | 3300008117 | Freshwater, Plankton | MDKIAIELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE* |
Ga0114355_10807773 | 3300008120 | Freshwater, Plankton | MEEIALELKRLNKIMAEILHLIQKEMKRGEELSKKWEKERNE* |
Ga0114841_10308793 | 3300008259 | Freshwater, Plankton | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKERNES* |
Ga0114336_13553042 | 3300008261 | Freshwater, Plankton | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEKEKND* |
Ga0114363_11702281 | 3300008266 | Freshwater, Plankton | MEQIALELARLNKTMAEILHLIQKEMKRGEELSKKYDKERNE* |
Ga0114364_11577392 | 3300008267 | Freshwater, Plankton | MEQIALELARLNKTMADILHLIQLEMKRGEELAKKYEKERNE* |
Ga0114876_11730283 | 3300008448 | Freshwater Lake | TMEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYEKERNE* |
Ga0114876_11783981 | 3300008448 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNES* |
Ga0114880_11478281 | 3300008450 | Freshwater Lake | MDKIALELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE* |
Ga0114880_11843042 | 3300008450 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYDEERKKD* |
Ga0102829_10992531 | 3300009026 | Estuarine | MEQIAIELARLNKTMAEILHLIQKEMKRGEELSKKWEKERNES* |
Ga0114973_100667211 | 3300009068 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYDEERKKN* |
Ga0114973_103800571 | 3300009068 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRGEELSKKYDKERNE* |
Ga0114973_103946792 | 3300009068 | Freshwater Lake | MDKIAIEIARLNKTLTEILILIQKEMKQSDELRRKYDLEREKND* |
Ga0114973_104415273 | 3300009068 | Freshwater Lake | MEQIALEIARLNKTMAEILHLIQKEMKRSEELSKKWEKERNE* |
Ga0115549_11081541 | 3300009074 | Pelagic Marine | RYNMDKIAIELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE* |
Ga0105091_100907804 | 3300009146 | Freshwater Sediment | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYDKERNE* |
Ga0114980_106467732 | 3300009152 | Freshwater Lake | MDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNEKN* |
Ga0114968_102940211 | 3300009155 | Freshwater Lake | IGYINNERYNMEQIALELARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARNE* |
Ga0114968_106882371 | 3300009155 | Freshwater Lake | MEQIAIELARLNKTMAEILHLIQKEMKRSEELSKKWEKERNE* |
Ga0114968_107029631 | 3300009155 | Freshwater Lake | MEQIALEIARLNKTITEILILIQKEMKRSEELSKKWEKERNE* |
Ga0114968_107697773 | 3300009155 | Freshwater Lake | IGYINNERYNMEQIALELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE* |
Ga0114978_107760312 | 3300009159 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE* |
Ga0114978_107960731 | 3300009159 | Freshwater Lake | MDKIAIELARLNKTMAEILHLIQKEMKRSEEISKQYEK |
Ga0114978_108343602 | 3300009159 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRGEEISKQYEKERKARNE* |
Ga0114966_102603483 | 3300009161 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE* |
Ga0114966_106202291 | 3300009161 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKRGEELAKKYDEERKKD* |
Ga0114966_106495061 | 3300009161 | Freshwater Lake | TMEQIAIELARLNKTMAEILHLIQKEMKRSEELSKKWEKERNE* |
Ga0114975_106849303 | 3300009164 | Freshwater Lake | IGYINNERYNMEQIALEIARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE* |
Ga0114969_105928301 | 3300009181 | Freshwater Lake | NNERYNMEQIALELARLNKTMAEILHLIQKEMKRSEELSKKWEKERNETN* |
Ga0114969_107886842 | 3300009181 | Freshwater Lake | MDKIAIEIARLNKTLTEILILIQKEMKQSDELRRKYDLEKEKND* |
Ga0114974_105603183 | 3300009183 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRGEELSKKYDEERKKD* |
Ga0114974_107626991 | 3300009183 | Freshwater Lake | NERYNMDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNEKN* |
Ga0114971_106872541 | 3300009185 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARN |
Ga0114971_108263411 | 3300009185 | Freshwater Lake | LEIARLNKTITEILILIQKEMKRSEELSKKWEKERNE* |
Ga0114972_102806131 | 3300009187 | Freshwater Lake | ERYNMEQIALELARLNKTMAEILHLIQKEMKRSEELSKKWEKERNE* |
Ga0114972_107967501 | 3300009187 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKRSEELSKKWE |
Ga0114972_108125701 | 3300009187 | Freshwater Lake | MEQIALEIARLNKTMAEILHLIQKEMKRGEELAKKYDKERNEKN* |
Ga0115545_11407733 | 3300009433 | Pelagic Marine | MDKIAIELARLNKTMAEILHLIQKEMKRSEELSKKYDLEREKND* |
Ga0114964_100691054 | 3300010157 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKRSEELSKKWEKERNE* |
Ga0114967_102601571 | 3300010160 | Freshwater Lake | MEQIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDLERKIND* |
Ga0114967_104437441 | 3300010160 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKKSEELSKKWEKERNE* |
Ga0114967_105463501 | 3300010160 | Freshwater Lake | MEKIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKND* |
Ga0114967_105816671 | 3300010160 | Freshwater Lake | MEQIALEIARLNKTMAEILHLIQKEMKRSEELSKQYEKERKAR |
Ga0114967_106329771 | 3300010160 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNEKN* |
Ga0129333_102129535 | 3300010354 | Freshwater To Marine Saline Gradient | MNEIALEIARLNKTLTEILILIQKEMKRSEELSKKWEKERNE* |
Ga0139556_10440031 | 3300011011 | Freshwater | IAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNE* |
Ga0151517_140713 | 3300011113 | Freshwater | MEQIALELARLNKTMAEILLLIQKEMKRSEELSKKWEKERNE* |
Ga0151620_11427951 | 3300011268 | Freshwater | MEQIALEIARLNKTLTEILILIQKEMKRSEDYAKELKEKYDKE* |
Ga0151620_12472861 | 3300011268 | Freshwater | MEQIAIELARLNKTMAEILHLIQKEMKRSEELSKKWEKERNES* |
Ga0153799_10784792 | 3300012012 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNES* |
Ga0153799_10943063 | 3300012012 | Freshwater | AKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNE* |
Ga0153799_11049001 | 3300012012 | Freshwater | LELARLNKTMAEILHLIQKEMKQSDELRRKYDLEKEKEKK* |
Ga0153801_10784571 | 3300012017 | Freshwater | IAKELSKLNATMAEILYLIQKEMKRGEELSKKYEKERNE* |
Ga0153801_10800743 | 3300012017 | Freshwater | IGYINNERYNMEEIALELKRLNKTMAEILHLIQKEMKKSEELSKKWEKERND* |
Ga0157203_10149411 | 3300012663 | Freshwater | MEQIALEIARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNE* |
Ga0164293_103412231 | 3300013004 | Freshwater | YNMEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKNEKD* |
Ga0164293_105426301 | 3300013004 | Freshwater | GYINNERYNMDKIALELARLNATMAEILYLIQKEMKRGEELAKKYEKERNE* |
Ga0164293_108030033 | 3300013004 | Freshwater | GYINNERYNMDKIALELARLNATMAEILYLIQKEMKRGEELAKKYDEERKKD* |
Ga0164293_108332381 | 3300013004 | Freshwater | NLERYNMDKIALELARLNKTMAEILHLMQKEMKRGEELSKKYDKERNE* |
Ga0164293_108891333 | 3300013004 | Freshwater | MDKIALEIARLNKTITEILILIQKEMKRSEEISKQYEKERKERNE* |
(restricted) Ga0172367_106532311 | 3300013126 | Freshwater | MKQIQIAFQLSKLNETMAEILRLIQKEMKKSEELSKKWEEERNEKDK* |
Ga0170791_103276191 | 3300013295 | Freshwater | MEQIAKEMSKLNATMAEILYLIQKEMKRGEELSKKYDEERKKN* |
Ga0177922_101817464 | 3300013372 | Freshwater | MEEIALELKRLNKTMAEILHLIQKEMKKSEELSKKWEKERND* |
Ga0177922_108385181 | 3300013372 | Freshwater | MEQIAIELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNE* |
Ga0119960_10729131 | 3300014811 | Aquatic | MDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKKRS* |
Ga0181338_10168582 | 3300015050 | Freshwater Lake | MVDDMEKIAKELTSLNKTMAEILYLIQKEMKQSDELRRKYDLEREKERNES* |
Ga0181338_10337641 | 3300015050 | Freshwater Lake | MEQKALELARLNKTMADILHLIQLEMKRGEELAKKYEKERNE* |
Ga0181338_10688661 | 3300015050 | Freshwater Lake | NNERYNMEQIALELARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARNE* |
Ga0181338_10697901 | 3300015050 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKKSEELSKKWEKERNENNN* |
Ga0181345_1006322 | 3300017699 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKQSDELRRKYDLEKEKND |
Ga0181339_10239023 | 3300017700 | Freshwater Lake | DNKGYINNERYNMEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE |
Ga0181364_10158172 | 3300017701 | Freshwater Lake | MVDDMEKIAKELTSLNKTMAEILYLIQKEMKQSDELRRKYDLEREKERNER |
Ga0181364_10365532 | 3300017701 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKRGEELSKKYDKERNE |
Ga0181364_10403311 | 3300017701 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKESDELRRKYDLEREKNENNN |
Ga0181364_10620271 | 3300017701 | Freshwater Lake | MELIALELARLNKTMADILHLIQLEMKRGEELAKKYNLEREKND |
Ga0181363_10539031 | 3300017707 | Freshwater Lake | QIAIEIAIINKTMAERLHLIQKEMKRSEEISKQYEKERWKCL |
Ga0181350_11585422 | 3300017716 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRGEELSKKYDEERKKDXA |
Ga0181362_11117141 | 3300017723 | Freshwater Lake | MEQIALELERLIITISYILHLIQLEIKRGEELDKKYEKERNE |
Ga0181362_11216701 | 3300017723 | Freshwater Lake | IAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNE |
Ga0181344_10991931 | 3300017754 | Freshwater Lake | RKITNRSDYEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKKE |
Ga0181344_11008863 | 3300017754 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKKEN |
Ga0181344_11469031 | 3300017754 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKQSDELRRKYDLEREKEKK |
Ga0181344_11502121 | 3300017754 | Freshwater Lake | NERYNMEQIALELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKERNE |
Ga0181356_11973773 | 3300017761 | Freshwater Lake | QIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNEKN |
Ga0181356_12099991 | 3300017761 | Freshwater Lake | MEPIEKELSKLNATMAEILYLIQKEMKKSEELSKKWDKERNE |
Ga0181343_10690511 | 3300017766 | Freshwater Lake | EQIALELARLNKTMAEILHLIQKEMKRSEELSKKYDLEREKND |
Ga0181358_12491202 | 3300017774 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEK |
Ga0181358_12560461 | 3300017774 | Freshwater Lake | MEQIALEIARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKEKK |
Ga0181357_12558881 | 3300017777 | Freshwater Lake | MEQITKELSKLNATMAEILYLIQKEMKRSEELSKKYDLEREKND |
Ga0181357_12685902 | 3300017777 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYDEER |
Ga0181346_12918722 | 3300017780 | Freshwater Lake | LARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNESYN |
Ga0181348_11826401 | 3300017784 | Freshwater Lake | MEQIAKELSKLNATTAEILYLIQKEMKRGEELSKKYEKERNE |
Ga0181348_13030413 | 3300017784 | Freshwater Lake | EQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNEKN |
Ga0169931_102979823 | 3300017788 | Freshwater | MEQIALELKRLNATMADILYLIQKEMKKSEEYAKSLKEKYDKE |
Ga0187844_104172281 | 3300018868 | Freshwater | MEQIALELARLNKTMVEILHLIQKEMKQSDELRRKYDLEREKERNES |
Ga0187843_104104852 | 3300019093 | Freshwater | MDKIALELARLNATMAEILYLIQKEMKQSDELRRKYDLEREKESNE |
Ga0181360_1220431 | 3300019781 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYEKERNE |
Ga0181361_1098423 | 3300019783 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKND |
Ga0181361_1145423 | 3300019783 | Freshwater Lake | MEQIALELARLNKTMADILHLIQLEMKKSEELSKKWEKERNE |
Ga0181359_10668492 | 3300019784 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYDEERKKDXA |
Ga0181359_10951431 | 3300019784 | Freshwater Lake | MDQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEKEKND |
Ga0181359_11354571 | 3300019784 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWDKERNE |
Ga0181359_11739871 | 3300019784 | Freshwater Lake | MEQIALELARLNKTMADILHLIQLEMKRGEELAKKYNLEREKND |
Ga0181359_11825841 | 3300019784 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKKSEELSKKWEKERNE |
Ga0181359_11888772 | 3300019784 | Freshwater Lake | DKIALELARLNATMAEILYLIQKEMKRGEELAKKYDKERNEKD |
Ga0181359_11929203 | 3300019784 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKERNE |
Ga0181359_11940793 | 3300019784 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRGEEISKQYEKERKERNE |
Ga0181359_12206591 | 3300019784 | Freshwater Lake | KELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNEKN |
Ga0181359_12262273 | 3300019784 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKNENNN |
Ga0181359_12296441 | 3300019784 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKQSDELRRKYDLEREKERNES |
Ga0181359_12312823 | 3300019784 | Freshwater Lake | NNERYNMDQIAIELARLNKTMAEILHLIQKEMKRGEELSKKYDKERNE |
Ga0181359_12337313 | 3300019784 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKKSEELSKKWEKERNENNN |
Ga0181359_12402522 | 3300019784 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKNENNN |
Ga0181359_12516183 | 3300019784 | Freshwater Lake | ALELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE |
Ga0194113_111280281 | 3300020074 | Freshwater Lake | MKQLQIAFQLSKLNETMAEILRLIQKEMKKSEELSKKWEEERNEKN |
Ga0194112_107576951 | 3300020109 | Freshwater Lake | MEEIALELKKLNATMADILYLIQKEMKKSEELSKKWEKERNE |
Ga0211732_11289081 | 3300020141 | Freshwater | MEQIALELARLNKTMAEILHLIQKEMKRSEELSKQYEK |
Ga0211732_15191674 | 3300020141 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNEKNE |
Ga0211736_110314614 | 3300020151 | Freshwater | DNIGDINNERYNMDKIAIELARLNKTMAEILHLIQKEMKRSEELSKKYDLEREKND |
Ga0211736_110315051 | 3300020151 | Freshwater | DNIGDINNERYNMDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNE |
Ga0211734_107127811 | 3300020159 | Freshwater | MEQIALELARLNKTMAEILHLIQKEMKRSEELSKQY |
Ga0211733_100050242 | 3300020160 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKRGEELAKKYDKERNE |
Ga0211733_107604652 | 3300020160 | Freshwater | MEQIALELARLNKTMAEILHLIQKEMKRSEELSKKYDLEREKND |
Ga0211726_108831611 | 3300020161 | Freshwater | MEQIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKE |
Ga0211735_114197571 | 3300020162 | Freshwater | YNMEQIAIELARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARNE |
Ga0194035_10844063 | 3300020167 | Anoxic Zone Freshwater | MEQIAIELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNE |
Ga0211729_103243182 | 3300020172 | Freshwater | MDKIALELARLNKTLTEILILIQKEMKRGEELAKKYDKERNE |
Ga0211729_114882471 | 3300020172 | Freshwater | PTGVTMEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNES |
Ga0211731_113347712 | 3300020205 | Freshwater | MEQIALELARLNATMAEILYLIQKEMKRGEELAKKYDKERNE |
Ga0211731_113795562 | 3300020205 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNES |
Ga0208591_10390183 | 3300020493 | Freshwater | TMEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYEKERNE |
Ga0208091_10337002 | 3300020506 | Freshwater | MDKIAIELARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARNE |
Ga0208090_10282193 | 3300020513 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKRGEELAKKYEKERNE |
Ga0208235_10119554 | 3300020530 | Freshwater | ELARLNATMAEILYLIQKEMKRGEELAKKYDKERNE |
Ga0208235_10170243 | 3300020530 | Freshwater | MDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE |
Ga0208600_10569452 | 3300020550 | Freshwater | MEQIALEIARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE |
Ga0208360_10065783 | 3300020551 | Freshwater | MDKIALELARLNATMAEILYLIQKEMKRGEELSKKYDEERKKD |
Ga0208231_10224781 | 3300020557 | Freshwater | SKLNATMAEILYLIQKEMKRGEELSKKYDEERKKD |
Ga0208485_10736933 | 3300020573 | Freshwater | AKELSKLNATMAEILYLIQKEMKRGEELSKKYEKERNE |
Ga0214163_10334342 | 3300021141 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYDEERKKDXT |
Ga0222714_105550042 | 3300021961 | Estuarine Water | MEQIAIELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE |
Ga0222713_101627512 | 3300021962 | Estuarine Water | MEQIALEIARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNES |
Ga0222712_104706181 | 3300021963 | Estuarine Water | KNNQQGVTMEQIALEIARLNKTLTEILILIQKEMKRGEELSKKYEKERNE |
Ga0181353_10454264 | 3300022179 | Freshwater Lake | MVNLERYNMDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDEERKKD |
Ga0181353_10978202 | 3300022179 | Freshwater Lake | VYSINNVVDDMEKIAKELSKLNATMAEILYLIQKEMKQSDELRRKYNLEREKERNES |
Ga0181353_11658271 | 3300022179 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNEKD |
Ga0181354_11028441 | 3300022190 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKKSEELSKKWEKERNEKN |
Ga0181354_11170991 | 3300022190 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNES |
Ga0181354_11346911 | 3300022190 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEIKQSDELRRKYDLEREKERNES |
Ga0181354_11501691 | 3300022190 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQLEMKKSEELSKKWEKERNENNN |
Ga0181354_11610422 | 3300022190 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKNE |
Ga0181354_11775302 | 3300022190 | Freshwater Lake | MEQIAIELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE |
Ga0181354_11807201 | 3300022190 | Freshwater Lake | ELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKERNES |
Ga0181354_11997351 | 3300022190 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREISSP |
Ga0181354_12046301 | 3300022190 | Freshwater Lake | NIGYINNERYNMDQIAIELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE |
Ga0181354_12185581 | 3300022190 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERN |
Ga0181354_12323241 | 3300022190 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWDKE |
Ga0181351_11015701 | 3300022407 | Freshwater Lake | MVDDMEKIAKELTSLNKTMAEILYLIQKEMKQSDELRRKYDLEREKE |
Ga0181351_11615581 | 3300022407 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEKEKND |
Ga0181351_11794461 | 3300022407 | Freshwater Lake | TKLNATMAEILYLIQKEMKKSEELSKKWEKERNES |
Ga0181351_12059553 | 3300022407 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYDEERKKD |
Ga0181351_12431303 | 3300022407 | Freshwater Lake | MEQVALEIARLNKTLTEILILIQKEMKQSDELRRKYDLEREKNENNN |
Ga0181351_12604762 | 3300022407 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYKKERNE |
Ga0181351_12793321 | 3300022407 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKN |
Ga0214917_1000035434 | 3300022752 | Freshwater | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKEKK |
Ga0214917_100195177 | 3300022752 | Freshwater | MEQIALELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE |
Ga0255205_10503673 | 3300024276 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNE |
Ga0255185_10622303 | 3300024490 | Freshwater | MNEIALEIARLNKTLTEILILIQKEMKRSEELSKKWEKERNES |
Ga0208916_100601661 | 3300025896 | Aqueous | MDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNE |
Ga0208916_103735934 | 3300025896 | Aqueous | NMEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKND |
Ga0255102_10143111 | 3300027144 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKY |
Ga0255113_10716481 | 3300027147 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWE |
Ga0255108_10485751 | 3300027149 | Freshwater | MEQITKELSKLNATMAEILYLIQKEMKKSEELSKKWDKERNE |
Ga0255111_10733161 | 3300027154 | Freshwater | YNMEQIALEIARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNES |
Ga0255137_10637731 | 3300027375 | Freshwater | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREK |
Ga0208788_10334913 | 3300027499 | Deep Subsurface | TGVTMEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYEKERNE |
Ga0208787_10397643 | 3300027518 | Deep Subsurface | MEQIALELKRLNATMAEILYLIQKEMKKSEELSKKWEKERNE |
Ga0208966_11445373 | 3300027586 | Freshwater Lentic | MEQIALELARLNKTMADILHLIQLEMKRGEELAKKYEKERNE |
Ga0208966_11762573 | 3300027586 | Freshwater Lentic | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWKKERNE |
Ga0208974_10360993 | 3300027608 | Freshwater Lentic | MVDDMEKIAKELTSLNKTMAEILYLIQKEMKQSDELRRKYDLEREKERNES |
Ga0208974_10743501 | 3300027608 | Freshwater Lentic | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKNDE |
Ga0208974_11046583 | 3300027608 | Freshwater Lentic | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKERNES |
Ga0208974_11147341 | 3300027608 | Freshwater Lentic | MEQIALEIARLNKTMAEILHLIQKEMKRSEEISKQYEKERKARNE |
Ga0208975_10565521 | 3300027659 | Freshwater Lentic | MEQIALEIARLNKTMAEILHLIQKEMKQSDELRRKYDLERE |
Ga0208975_11959023 | 3300027659 | Freshwater Lentic | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYDEERKKD |
Ga0209551_10182092 | 3300027689 | Freshwater Lake | MEQITKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNE |
Ga0209033_10421542 | 3300027697 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYNLEREKERNES |
Ga0209443_12033572 | 3300027707 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRGEELSKKYDKERNE |
Ga0209617_102343564 | 3300027720 | Freshwater And Sediment | AKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKNDE |
(restricted) Ga0247836_10432774 | 3300027728 | Freshwater | MEQIALELKRLNATMAEILYLIQKEMKKSEDYAKSLKEKYDKE |
(restricted) Ga0247836_13334642 | 3300027728 | Freshwater | MEEIALELKRLNKTMAEILHLIQKEMKKSEELSKKWEKERNEKN |
(restricted) Ga0247833_11070342 | 3300027730 | Freshwater | MEQIALELARLNKTMAEILFLIQKEMKKSEELSKKWEKERNAKED |
Ga0209087_10192822 | 3300027734 | Freshwater Lake | MDKIAIELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE |
Ga0209087_12774341 | 3300027734 | Freshwater Lake | GYINNERYNMDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNEKN |
Ga0209190_10880023 | 3300027736 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNE |
Ga0209190_13899951 | 3300027736 | Freshwater Lake | NNERYNMEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNEKN |
Ga0209355_11002811 | 3300027744 | Freshwater Lake | TGVTMEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKND |
Ga0209597_11824323 | 3300027746 | Freshwater Lake | NMEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNE |
Ga0209597_13326811 | 3300027746 | Freshwater Lake | MEQIALEIARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKERNE |
Ga0209596_10534772 | 3300027754 | Freshwater Lake | MEQIALELARLNKTMAEILHLIQKEMKKSEELSKKWEKERNEKN |
Ga0209596_10605692 | 3300027754 | Freshwater Lake | MEQIAIELARLNKTMAEILHLIQKEMKRSEELSKKWEKERNE |
Ga0209596_11271982 | 3300027754 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRSEELSKKWEKERNETN |
Ga0209596_13000733 | 3300027754 | Freshwater Lake | MEQIALEIARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE |
Ga0209596_13143371 | 3300027754 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKRGEELAKKYDEERKKD |
Ga0209296_10771954 | 3300027759 | Freshwater Lake | MDKIALEIARLNKTITEILILIQKEMKRSEEISKQYEKERKERNE |
Ga0209296_11911581 | 3300027759 | Freshwater Lake | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYDKERNE |
Ga0209598_100539661 | 3300027760 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYDEERKKN |
Ga0209086_100601932 | 3300027770 | Freshwater Lake | MEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYDLERKIND |
Ga0209086_103550134 | 3300027770 | Freshwater Lake | GYINDERYNMEQIALEIARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE |
Ga0209246_101479734 | 3300027785 | Freshwater Lake | MDQIAIELARLNKTMAEILHLIQKEMKRGEELSKKYDEERKKD |
Ga0209107_102427723 | 3300027797 | Freshwater And Sediment | MEQIALELARLNKTMAEILHLIQKEMKQSDELRRKYDLEREKEKKRNEMY |
Ga0209358_101966765 | 3300027804 | Freshwater Lake | MEQIALELARLNKTMAEILILIQKEMKRSEELSKKYDLEREKND |
Ga0209990_103566331 | 3300027816 | Freshwater Lake | MEQITKELSKLNATMAEILYLIQKEMKQSDELRRKYDLEREKERNES |
Ga0209550_102861522 | 3300027892 | Freshwater Lake | MVDDMEKIAKELTSLNKTMAEILYLIQKEMKQSDELRRKYDLEREKERN |
Ga0209400_11558742 | 3300027963 | Freshwater Lake | MEQIAIELARLNKTMAEILHLIQKEMKRGEELSKKYEKERNE |
Ga0209191_10745882 | 3300027969 | Freshwater Lake | MDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYD |
Ga0209191_12289814 | 3300027969 | Freshwater Lake | MDKIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNEKN |
Ga0209401_11250431 | 3300027971 | Freshwater Lake | PTGVTMEQIAKELSKLNATMAEILYLIQKEMKRGEELSKKYDLERKIND |
Ga0209401_11640971 | 3300027971 | Freshwater Lake | MEQIALEIARLNKTMAEILHLIQKEMKRSEELSKKWEKERNETN |
(restricted) Ga0247834_11470822 | 3300027977 | Freshwater | MEEIALELKRLNKTMAEILHLIQKEMKKSEELSKKWEKEKNES |
(restricted) Ga0247834_12599682 | 3300027977 | Freshwater | MEEIALELKRLNKTMAEILFLIQKEMKKSEELSKKWEKERNES |
Ga0247723_10018188 | 3300028025 | Deep Subsurface Sediment | MDKIAIEIARLNKTLTEILILIQKEMKRSEEISKQYEKERKERNE |
Ga0247723_11005994 | 3300028025 | Deep Subsurface Sediment | MVNLERYNMDKIALELARLNKTMAEILHLIQKEMKRGEELSKKYEKEKNKD |
(restricted) Ga0247838_12866471 | 3300028044 | Freshwater | ELKRLNKTMAEILFLIQKEMKKSEELSKKWEKEKNE |
Ga0268280_12014621 | 3300028298 | Saline Water | MEQIAIELARLNKTMAEILHLIQKEMKRGEELSKKWEKERNES |
(restricted) Ga0247839_13298131 | 3300028553 | Freshwater | IALELKRLNKTMAEILFLIQKEMKKSEELSKKWEKERNES |
(restricted) Ga0247832_12897791 | 3300028557 | Freshwater | MEEIALELKRLNKTMAEILFLIQKEMKKSEELSKKWEKERNEKNND |
(restricted) Ga0247844_11068724 | 3300028571 | Freshwater | MEEIALELKRLNKTMAEILFLIQKEMKKSEELSKKWEKEKNES |
(restricted) Ga0247844_11674531 | 3300028571 | Freshwater | MEEIALELKRLNKTMAEILHLIQKEMKKSEELSKKWEKERNES |
(restricted) Ga0247842_102714361 | 3300029268 | Freshwater | MEEIALELKRLNKTMVEILFLIQKEMKKSEELSKKWEKERND |
Ga0119944_10258892 | 3300029930 | Aquatic | MEQIALEIARLNKTLTEILILIQKEMKRSEDYAKELKEKYDKE |
Ga0315288_117369381 | 3300031772 | Sediment | YNMDKIALELARLNATMAEILYLIQKEMKRGEELSKKYDKERNE |
Ga0315908_110802141 | 3300031786 | Freshwater | MEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE |
Ga0315289_111791772 | 3300032046 | Sediment | MDKIALELARLNATMAEILYLIQKEMKQSDELRRKYDLEREKERNE |
Ga0315289_114966991 | 3300032046 | Sediment | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYDEERKKNXT |
Ga0315906_102940072 | 3300032050 | Freshwater | MEKIALEIARLNKTLTEILILIQKEMKRGEELSKKWEKERNE |
Ga0315906_108293592 | 3300032050 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKQSDELRRKYD |
Ga0315905_113358072 | 3300032092 | Freshwater | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYEKERNE |
Ga0315903_108615123 | 3300032116 | Freshwater | TERYNMEQIALELARLNKTMAEILHLIQKEMKKSEELSKKWEKERNEKN |
Ga0315295_120352833 | 3300032156 | Sediment | KIALELARLNATMAEILYLIQKEMKKSEELSKKWEKERNEKN |
Ga0315268_123293201 | 3300032173 | Sediment | MEQIAKELSKLNATMAEILYLIQKEMRRSEELSKKYDLERKIND |
Ga0334982_0358056_555_671 | 3300033981 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKRGEELAKKYDEE |
Ga0334996_0131423_2_133 | 3300033994 | Freshwater | MDKIAIEIARLNKTLTEILILIQKEMKRSEEISKQYEKERKERN |
Ga0334996_0266553_63_203 | 3300033994 | Freshwater | MDKIAIEIARLNKTLTEILILIQKEMKQSDELRRKYDLEREKNEKD |
Ga0334996_0529412_1_117 | 3300033994 | Freshwater | MEQIAIELARLNKTMAEILHLIQKEMKRGEELAKKYEKE |
Ga0334979_0141540_107_238 | 3300033996 | Freshwater | MDKIALELARLNATMAEILYLIQKEMKRGEELSKKYDEERKKN |
Ga0334979_0595776_1_126 | 3300033996 | Freshwater | EQIAKELSKLNATMAEILYLIQKEMKKNEELSKKWEKERNE |
Ga0334998_0251278_949_1071 | 3300034019 | Freshwater | KIAIELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNE |
Ga0334987_0198960_697_828 | 3300034061 | Freshwater | MEQIALELARLNKTMAEILYLIQKEMKRGEELSKKYDEERKKD |
Ga0334995_0268318_2_112 | 3300034062 | Freshwater | ELARLNKTMAEILHLIQKEMKRGEELAKKYEKERNE |
Ga0334995_0730816_170_301 | 3300034062 | Freshwater | MEQIALELARLNKTMAEILHLIQIEMKRGEELSKKWEKERNES |
Ga0335000_0313137_771_902 | 3300034063 | Freshwater | MEQIAIELARLNKTMAEILHLIQKEMKRGEELSKKYEKEKNKD |
Ga0310130_0004775_2909_3037 | 3300034073 | Fracking Water | MEQIALELKRLNATMAEILYLIQKEMRRSEELSKKYEKERNE |
Ga0335022_0137911_568_705 | 3300034095 | Freshwater | MDKIALELARLNATMAEILYLIQKEMKRGEELAKKYEKERNENNN |
Ga0335027_0253066_895_1029 | 3300034101 | Freshwater | MDKIALELARLNATMAEILYLIQKEMKQSDELRKKYDLEREKND |
Ga0335027_0733721_181_318 | 3300034101 | Freshwater | MDKIALELARLNKTMAEILHLIQKEMKRSEELSKQYEKERKARNE |
Ga0335029_0124696_438_572 | 3300034102 | Freshwater | MEQIALELARLNKTMAEILHLIQKEMKRGEELAKKYDKERNEKD |
Ga0335030_0157805_684_818 | 3300034103 | Freshwater | MEQIAKELSKLNATMAEILYLIQKEMKKSEELSKKWEKERNEKN |
Ga0335036_0676975_470_598 | 3300034106 | Freshwater | MDKIALELARLNATMAEILYLIQKEMKRSEELSKKYEKERNE |
Ga0335063_0444818_347_484 | 3300034111 | Freshwater | MDKIALEIARLNKTITEILILIQKEMKRSEEISKQYEKERKARNE |
Ga0335068_0204266_54_206 | 3300034116 | Freshwater | MERYNMDKIAIEIARLNKTLTEILILIQKEMKRSEEISKQYEKERKERNE |
Ga0335033_0097060_47_184 | 3300034117 | Freshwater | MDKIAIELARLNKTMTEILHLIQKEMKRSEEISKQYEKERKARNE |
Ga0335053_0571028_1_111 | 3300034118 | Freshwater | LSKLNATMAEILYLIQKEMKRGEELSKKYDEERKKD |
Ga0335056_0431268_2_145 | 3300034120 | Freshwater | DKIALELARLNATMAEILYLIQKEMKQSDELRRKYDLEREKERNEKN |
Ga0335060_0417106_597_707 | 3300034122 | Freshwater | MDKIALELARLNATMAEILYLIQKEMKRGEELSKKYD |
Ga0335061_0621980_1_120 | 3300034168 | Freshwater | ALELARLNATMAEILYLIQKEMKRGEELSKKYDEERKKD |
Ga0335065_0439029_668_793 | 3300034200 | Freshwater | DKIALELARLNATMAEILYLIQKEMKRGEELAKKYDKERNE |
Ga0335048_0525187_63_191 | 3300034356 | Freshwater | MDKIAIELARLNKTMTEILHLIQKEMKRGEELAKKYDKERNE |
⦗Top⦘ |