Basic Information | |
---|---|
Family ID | F009440 |
Family Type | Metagenome |
Number of Sequences | 318 |
Average Sequence Length | 41 residues |
Representative Sequence | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Number of Associated Samples | 171 |
Number of Associated Scaffolds | 318 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 64.87 % |
% of genes near scaffold ends (potentially truncated) | 32.08 % |
% of genes from short scaffolds (< 2000 bps) | 83.65 % |
Associated GOLD sequencing projects | 125 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (65.094 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (34.591 % of family members) |
Environment Ontology (ENVO) | Unclassified (90.566 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.541 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 318 Family Scaffolds |
---|---|---|
PF03237 | Terminase_6N | 1.26 |
PF13730 | HTH_36 | 0.63 |
PF05869 | Dam | 0.63 |
PF16190 | E1_FCCH | 0.31 |
PF01555 | N6_N4_Mtase | 0.31 |
PF05063 | MT-A70 | 0.31 |
PF04404 | ERF | 0.31 |
PF00271 | Helicase_C | 0.31 |
PF12236 | Head-tail_con | 0.31 |
COG ID | Name | Functional Category | % Frequency in 318 Family Scaffolds |
---|---|---|---|
COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 0.63 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.31 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.31 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.39 % |
Unclassified | root | N/A | 17.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2019105005|PelMarPul_NODE_8799_len_4261_cov_16_710161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4287 | Open in IMG/M |
3300000101|DelMOSum2010_c10072785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1570 | Open in IMG/M |
3300000101|DelMOSum2010_c10125320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1000 | Open in IMG/M |
3300000101|DelMOSum2010_c10264652 | Not Available | 533 | Open in IMG/M |
3300000115|DelMOSum2011_c10133220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 760 | Open in IMG/M |
3300000115|DelMOSum2011_c10157975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 666 | Open in IMG/M |
3300000115|DelMOSum2011_c10187268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 585 | Open in IMG/M |
3300000115|DelMOSum2011_c10189604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 580 | Open in IMG/M |
3300000115|DelMOSum2011_c10197687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 562 | Open in IMG/M |
3300000115|DelMOSum2011_c10209525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 538 | Open in IMG/M |
3300000115|DelMOSum2011_c10219606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 519 | Open in IMG/M |
3300000115|DelMOSum2011_c10227148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 506 | Open in IMG/M |
3300000116|DelMOSpr2010_c10043575 | All Organisms → cellular organisms → Bacteria | 2006 | Open in IMG/M |
3300000116|DelMOSpr2010_c10096665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1124 | Open in IMG/M |
3300000116|DelMOSpr2010_c10121290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 943 | Open in IMG/M |
3300000116|DelMOSpr2010_c10123417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 930 | Open in IMG/M |
3300000116|DelMOSpr2010_c10126507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 913 | Open in IMG/M |
3300000116|DelMOSpr2010_c10155129 | Not Available | 779 | Open in IMG/M |
3300000116|DelMOSpr2010_c10168622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 731 | Open in IMG/M |
3300000116|DelMOSpr2010_c10171675 | Not Available | 720 | Open in IMG/M |
3300000116|DelMOSpr2010_c10175425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 708 | Open in IMG/M |
3300000116|DelMOSpr2010_c10206914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 625 | Open in IMG/M |
3300000116|DelMOSpr2010_c10219475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 597 | Open in IMG/M |
3300000116|DelMOSpr2010_c10238562 | Not Available | 560 | Open in IMG/M |
3300000117|DelMOWin2010_c10054731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1727 | Open in IMG/M |
3300000117|DelMOWin2010_c10074481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1351 | Open in IMG/M |
3300000117|DelMOWin2010_c10076527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1323 | Open in IMG/M |
3300000117|DelMOWin2010_c10143140 | Not Available | 800 | Open in IMG/M |
3300000117|DelMOWin2010_c10195092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 627 | Open in IMG/M |
3300000117|DelMOWin2010_c10221742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 569 | Open in IMG/M |
3300001355|JGI20158J14315_10023430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3068 | Open in IMG/M |
3300001450|JGI24006J15134_10018181 | Not Available | 3281 | Open in IMG/M |
3300001450|JGI24006J15134_10092422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1104 | Open in IMG/M |
3300001460|JGI24003J15210_10034796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth | 1806 | Open in IMG/M |
3300001460|JGI24003J15210_10093809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 875 | Open in IMG/M |
3300001472|JGI24004J15324_10026827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth | 1904 | Open in IMG/M |
3300001472|JGI24004J15324_10040119 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
3300001472|JGI24004J15324_10091934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 797 | Open in IMG/M |
3300001472|JGI24004J15324_10105087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 718 | Open in IMG/M |
3300001472|JGI24004J15324_10113219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 677 | Open in IMG/M |
3300001472|JGI24004J15324_10128080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 613 | Open in IMG/M |
3300001472|JGI24004J15324_10139246 | Not Available | 573 | Open in IMG/M |
3300001589|JGI24005J15628_10088983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1065 | Open in IMG/M |
3300001589|JGI24005J15628_10096442 | Not Available | 1003 | Open in IMG/M |
3300001589|JGI24005J15628_10102262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 960 | Open in IMG/M |
3300002483|JGI25132J35274_1123659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 516 | Open in IMG/M |
3300002488|JGI25128J35275_1001189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7875 | Open in IMG/M |
3300006025|Ga0075474_10036320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1712 | Open in IMG/M |
3300006026|Ga0075478_10040234 | All Organisms → Viruses → Predicted Viral | 1546 | Open in IMG/M |
3300006026|Ga0075478_10073857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1101 | Open in IMG/M |
3300006026|Ga0075478_10081185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 1044 | Open in IMG/M |
3300006026|Ga0075478_10215432 | Not Available | 583 | Open in IMG/M |
3300006027|Ga0075462_10067037 | Not Available | 1131 | Open in IMG/M |
3300006027|Ga0075462_10164386 | Not Available | 675 | Open in IMG/M |
3300006029|Ga0075466_1060141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1097 | Open in IMG/M |
3300006029|Ga0075466_1109371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 742 | Open in IMG/M |
3300006029|Ga0075466_1113243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 725 | Open in IMG/M |
3300006735|Ga0098038_1015155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 2977 | Open in IMG/M |
3300006735|Ga0098038_1017345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2770 | Open in IMG/M |
3300006735|Ga0098038_1035152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1857 | Open in IMG/M |
3300006735|Ga0098038_1038610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1758 | Open in IMG/M |
3300006735|Ga0098038_1052446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1470 | Open in IMG/M |
3300006735|Ga0098038_1140458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 810 | Open in IMG/M |
3300006735|Ga0098038_1191845 | Not Available | 664 | Open in IMG/M |
3300006737|Ga0098037_1041290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1679 | Open in IMG/M |
3300006737|Ga0098037_1141885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 810 | Open in IMG/M |
3300006737|Ga0098037_1146790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 793 | Open in IMG/M |
3300006737|Ga0098037_1158165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 758 | Open in IMG/M |
3300006737|Ga0098037_1189212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 677 | Open in IMG/M |
3300006749|Ga0098042_1151774 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300006749|Ga0098042_1153184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 564 | Open in IMG/M |
3300006802|Ga0070749_10078944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1968 | Open in IMG/M |
3300006802|Ga0070749_10241604 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1025 | Open in IMG/M |
3300006802|Ga0070749_10246986 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300006802|Ga0070749_10397823 | Not Available | 760 | Open in IMG/M |
3300006802|Ga0070749_10417781 | Not Available | 738 | Open in IMG/M |
3300006802|Ga0070749_10608862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 589 | Open in IMG/M |
3300006802|Ga0070749_10628833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 577 | Open in IMG/M |
3300006802|Ga0070749_10628835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 577 | Open in IMG/M |
3300006802|Ga0070749_10733213 | Not Available | 527 | Open in IMG/M |
3300006803|Ga0075467_10105169 | Not Available | 1675 | Open in IMG/M |
3300006803|Ga0075467_10440351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 674 | Open in IMG/M |
3300006810|Ga0070754_10404606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 597 | Open in IMG/M |
3300006810|Ga0070754_10441716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 565 | Open in IMG/M |
3300006810|Ga0070754_10492870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 528 | Open in IMG/M |
3300006810|Ga0070754_10526447 | Not Available | 507 | Open in IMG/M |
3300006868|Ga0075481_10192482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 731 | Open in IMG/M |
3300006868|Ga0075481_10334391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 524 | Open in IMG/M |
3300006869|Ga0075477_10063722 | All Organisms → Viruses → Predicted Viral | 1624 | Open in IMG/M |
3300006869|Ga0075477_10341267 | Not Available | 589 | Open in IMG/M |
3300006916|Ga0070750_10166197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 992 | Open in IMG/M |
3300006916|Ga0070750_10213544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 849 | Open in IMG/M |
3300006916|Ga0070750_10229077 | Not Available | 813 | Open in IMG/M |
3300006919|Ga0070746_10546342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 503 | Open in IMG/M |
3300006920|Ga0070748_1120815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 987 | Open in IMG/M |
3300006920|Ga0070748_1315987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 554 | Open in IMG/M |
3300006920|Ga0070748_1337512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 533 | Open in IMG/M |
3300006921|Ga0098060_1039032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1427 | Open in IMG/M |
3300006921|Ga0098060_1050828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1225 | Open in IMG/M |
3300006921|Ga0098060_1167148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 607 | Open in IMG/M |
3300006922|Ga0098045_1153615 | Not Available | 528 | Open in IMG/M |
3300006929|Ga0098036_1120749 | Not Available | 803 | Open in IMG/M |
3300006990|Ga0098046_1017905 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
3300006990|Ga0098046_1044663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1049 | Open in IMG/M |
3300007229|Ga0075468_10099534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 923 | Open in IMG/M |
3300007229|Ga0075468_10146745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 716 | Open in IMG/M |
3300007236|Ga0075463_10043644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1457 | Open in IMG/M |
3300007236|Ga0075463_10105085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 911 | Open in IMG/M |
3300007276|Ga0070747_1232763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 643 | Open in IMG/M |
3300007276|Ga0070747_1277892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 578 | Open in IMG/M |
3300007344|Ga0070745_1228449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 679 | Open in IMG/M |
3300007345|Ga0070752_1229791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 728 | Open in IMG/M |
3300007345|Ga0070752_1302405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 609 | Open in IMG/M |
3300007346|Ga0070753_1161011 | Not Available | 846 | Open in IMG/M |
3300007538|Ga0099851_1021278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 2622 | Open in IMG/M |
3300007538|Ga0099851_1253260 | Not Available | 629 | Open in IMG/M |
3300007539|Ga0099849_1378112 | Not Available | 500 | Open in IMG/M |
3300007541|Ga0099848_1049905 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1688 | Open in IMG/M |
3300007542|Ga0099846_1021261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 2519 | Open in IMG/M |
3300007640|Ga0070751_1091775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1265 | Open in IMG/M |
3300007960|Ga0099850_1127529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1035 | Open in IMG/M |
3300008012|Ga0075480_10073127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1963 | Open in IMG/M |
3300008012|Ga0075480_10274410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 864 | Open in IMG/M |
3300008012|Ga0075480_10311116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 796 | Open in IMG/M |
3300008012|Ga0075480_10575208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 535 | Open in IMG/M |
3300009074|Ga0115549_1025926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2264 | Open in IMG/M |
3300009423|Ga0115548_1172081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 677 | Open in IMG/M |
3300009435|Ga0115546_1140408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 856 | Open in IMG/M |
3300009435|Ga0115546_1144987 | Not Available | 840 | Open in IMG/M |
3300009436|Ga0115008_10809580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 687 | Open in IMG/M |
3300009449|Ga0115558_1276623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 673 | Open in IMG/M |
3300009476|Ga0115555_1307830 | Not Available | 637 | Open in IMG/M |
3300009481|Ga0114932_10314606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 937 | Open in IMG/M |
3300009497|Ga0115569_10289726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 725 | Open in IMG/M |
3300009505|Ga0115564_10266376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 868 | Open in IMG/M |
3300009508|Ga0115567_10315147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 978 | Open in IMG/M |
3300010148|Ga0098043_1039441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1469 | Open in IMG/M |
3300010153|Ga0098059_1020057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2734 | Open in IMG/M |
3300010153|Ga0098059_1051231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth | 1659 | Open in IMG/M |
3300010153|Ga0098059_1093316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1197 | Open in IMG/M |
3300010296|Ga0129348_1209479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 662 | Open in IMG/M |
3300010299|Ga0129342_1073110 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
3300010316|Ga0136655_1037288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1556 | Open in IMG/M |
3300010368|Ga0129324_10436247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 503 | Open in IMG/M |
3300011253|Ga0151671_1022474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 716 | Open in IMG/M |
3300012920|Ga0160423_10062460 | Not Available | 2679 | Open in IMG/M |
3300012920|Ga0160423_10126309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1802 | Open in IMG/M |
3300012920|Ga0160423_10664192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 704 | Open in IMG/M |
3300013195|Ga0116815_1037141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 664 | Open in IMG/M |
3300017706|Ga0181377_1027961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1185 | Open in IMG/M |
3300017706|Ga0181377_1028739 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1163 | Open in IMG/M |
3300017708|Ga0181369_1007997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2751 | Open in IMG/M |
3300017708|Ga0181369_1071931 | Not Available | 746 | Open in IMG/M |
3300017710|Ga0181403_1059509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 796 | Open in IMG/M |
3300017713|Ga0181391_1135097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 549 | Open in IMG/M |
3300017714|Ga0181412_1029781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1476 | Open in IMG/M |
3300017720|Ga0181383_1076167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 900 | Open in IMG/M |
3300017720|Ga0181383_1161035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 601 | Open in IMG/M |
3300017721|Ga0181373_1013099 | Not Available | 1556 | Open in IMG/M |
3300017721|Ga0181373_1035093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 924 | Open in IMG/M |
3300017725|Ga0181398_1012132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2189 | Open in IMG/M |
3300017729|Ga0181396_1009344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1971 | Open in IMG/M |
3300017734|Ga0187222_1061247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 869 | Open in IMG/M |
3300017738|Ga0181428_1004990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3023 | Open in IMG/M |
3300017740|Ga0181418_1012467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2296 | Open in IMG/M |
3300017740|Ga0181418_1059790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 941 | Open in IMG/M |
3300017743|Ga0181402_1156915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 575 | Open in IMG/M |
3300017745|Ga0181427_1130163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 612 | Open in IMG/M |
3300017750|Ga0181405_1071644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 893 | Open in IMG/M |
3300017751|Ga0187219_1044361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1494 | Open in IMG/M |
3300017763|Ga0181410_1120097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 752 | Open in IMG/M |
3300017765|Ga0181413_1044449 | Not Available | 1382 | Open in IMG/M |
3300017765|Ga0181413_1088200 | Not Available | 946 | Open in IMG/M |
3300017767|Ga0181406_1034990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1570 | Open in IMG/M |
3300017772|Ga0181430_1107017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 829 | Open in IMG/M |
3300017776|Ga0181394_1062648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1231 | Open in IMG/M |
3300017776|Ga0181394_1113937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 856 | Open in IMG/M |
3300017779|Ga0181395_1051197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1362 | Open in IMG/M |
3300017781|Ga0181423_1105841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1099 | Open in IMG/M |
3300017782|Ga0181380_1093791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 1045 | Open in IMG/M |
3300017782|Ga0181380_1143531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 815 | Open in IMG/M |
3300017782|Ga0181380_1240856 | Not Available | 601 | Open in IMG/M |
3300017783|Ga0181379_1176041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 755 | Open in IMG/M |
3300017950|Ga0181607_10019601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5137 | Open in IMG/M |
3300017950|Ga0181607_10023816 | All Organisms → cellular organisms → Bacteria | 4567 | Open in IMG/M |
3300018036|Ga0181600_10009821 | All Organisms → Viruses | 7007 | Open in IMG/M |
3300020055|Ga0181575_10705040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 513 | Open in IMG/M |
3300020175|Ga0206124_10018141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3583 | Open in IMG/M |
3300020191|Ga0181604_10051273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2417 | Open in IMG/M |
3300020194|Ga0181597_10223060 | Not Available | 895 | Open in IMG/M |
3300020365|Ga0211506_1072163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 976 | Open in IMG/M |
3300020388|Ga0211678_10410262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 536 | Open in IMG/M |
3300020404|Ga0211659_10117974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1215 | Open in IMG/M |
3300020414|Ga0211523_10405341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 551 | Open in IMG/M |
3300020472|Ga0211579_10650137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → unclassified Opitutales → Opitutales bacterium | 589 | Open in IMG/M |
3300021347|Ga0213862_10031032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1961 | Open in IMG/M |
3300021365|Ga0206123_10070434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1738 | Open in IMG/M |
3300021375|Ga0213869_10009624 | Not Available | 5842 | Open in IMG/M |
3300021375|Ga0213869_10204605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 888 | Open in IMG/M |
3300021958|Ga0222718_10044007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2883 | Open in IMG/M |
3300021958|Ga0222718_10106269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1646 | Open in IMG/M |
3300021958|Ga0222718_10292401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 849 | Open in IMG/M |
3300021958|Ga0222718_10433812 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300021959|Ga0222716_10026860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4229 | Open in IMG/M |
3300021959|Ga0222716_10059073 | All Organisms → Viruses → Predicted Viral | 2694 | Open in IMG/M |
3300021959|Ga0222716_10205651 | Not Available | 1243 | Open in IMG/M |
3300021959|Ga0222716_10373059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 837 | Open in IMG/M |
3300021959|Ga0222716_10626975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 582 | Open in IMG/M |
3300021960|Ga0222715_10214532 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
3300022061|Ga0212023_1036821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 680 | Open in IMG/M |
3300022065|Ga0212024_1079841 | Not Available | 582 | Open in IMG/M |
3300022065|Ga0212024_1101645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 512 | Open in IMG/M |
3300022068|Ga0212021_1051416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 836 | Open in IMG/M |
3300022071|Ga0212028_1026076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1047 | Open in IMG/M |
3300022072|Ga0196889_1085957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 582 | Open in IMG/M |
3300022074|Ga0224906_1048010 | Not Available | 1379 | Open in IMG/M |
3300022164|Ga0212022_1005713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1625 | Open in IMG/M |
3300022164|Ga0212022_1051490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 636 | Open in IMG/M |
3300022169|Ga0196903_1007553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1387 | Open in IMG/M |
3300022178|Ga0196887_1030599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1505 | Open in IMG/M |
3300022183|Ga0196891_1020360 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
3300022198|Ga0196905_1003596 | All Organisms → Viruses | 5658 | Open in IMG/M |
3300022198|Ga0196905_1052472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 1159 | Open in IMG/M |
3300022198|Ga0196905_1171432 | Not Available | 552 | Open in IMG/M |
3300022200|Ga0196901_1050979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 1545 | Open in IMG/M |
3300024344|Ga0209992_10071164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1605 | Open in IMG/M |
3300025070|Ga0208667_1004782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3771 | Open in IMG/M |
3300025070|Ga0208667_1048084 | Not Available | 698 | Open in IMG/M |
3300025083|Ga0208791_1014357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1751 | Open in IMG/M |
3300025086|Ga0208157_1015836 | All Organisms → Viruses | 2378 | Open in IMG/M |
3300025086|Ga0208157_1037708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1358 | Open in IMG/M |
3300025086|Ga0208157_1044879 | Not Available | 1211 | Open in IMG/M |
3300025086|Ga0208157_1142989 | Not Available | 533 | Open in IMG/M |
3300025099|Ga0208669_1050201 | Not Available | 956 | Open in IMG/M |
3300025099|Ga0208669_1102856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 594 | Open in IMG/M |
3300025102|Ga0208666_1028398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1711 | Open in IMG/M |
3300025102|Ga0208666_1036521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1452 | Open in IMG/M |
3300025102|Ga0208666_1114250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 648 | Open in IMG/M |
3300025120|Ga0209535_1041228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2062 | Open in IMG/M |
3300025120|Ga0209535_1045534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth | 1917 | Open in IMG/M |
3300025120|Ga0209535_1046748 | All Organisms → Viruses → Predicted Viral | 1880 | Open in IMG/M |
3300025120|Ga0209535_1073295 | Not Available | 1332 | Open in IMG/M |
3300025128|Ga0208919_1024848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2212 | Open in IMG/M |
3300025128|Ga0208919_1030010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1973 | Open in IMG/M |
3300025132|Ga0209232_1002198 | All Organisms → Viruses | 9799 | Open in IMG/M |
3300025137|Ga0209336_10060480 | Not Available | 1147 | Open in IMG/M |
3300025137|Ga0209336_10065184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1092 | Open in IMG/M |
3300025137|Ga0209336_10162579 | Not Available | 581 | Open in IMG/M |
3300025137|Ga0209336_10185254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 523 | Open in IMG/M |
3300025137|Ga0209336_10185464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 523 | Open in IMG/M |
3300025138|Ga0209634_1033067 | Not Available | 2714 | Open in IMG/M |
3300025151|Ga0209645_1028231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2081 | Open in IMG/M |
3300025151|Ga0209645_1105652 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 908 | Open in IMG/M |
3300025168|Ga0209337_1024643 | All Organisms → Viruses | 3435 | Open in IMG/M |
3300025168|Ga0209337_1049860 | All Organisms → Viruses | 2179 | Open in IMG/M |
3300025168|Ga0209337_1057361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1985 | Open in IMG/M |
3300025168|Ga0209337_1250800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 678 | Open in IMG/M |
3300025508|Ga0208148_1016146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2186 | Open in IMG/M |
3300025508|Ga0208148_1026902 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
3300025508|Ga0208148_1027587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1555 | Open in IMG/M |
3300025508|Ga0208148_1073216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281 | 789 | Open in IMG/M |
3300025508|Ga0208148_1107536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 592 | Open in IMG/M |
3300025543|Ga0208303_1040015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1193 | Open in IMG/M |
3300025543|Ga0208303_1092431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 652 | Open in IMG/M |
3300025577|Ga0209304_1032050 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1532 | Open in IMG/M |
3300025594|Ga0209094_1032663 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
3300025632|Ga0209194_1000541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 29754 | Open in IMG/M |
3300025645|Ga0208643_1020053 | All Organisms → Viruses | 2353 | Open in IMG/M |
3300025645|Ga0208643_1127882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 666 | Open in IMG/M |
3300025647|Ga0208160_1064284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 1012 | Open in IMG/M |
3300025653|Ga0208428_1002170 | Not Available | 7997 | Open in IMG/M |
3300025653|Ga0208428_1045827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1343 | Open in IMG/M |
3300025655|Ga0208795_1014118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P | 2736 | Open in IMG/M |
3300025674|Ga0208162_1042107 | Not Available | 1586 | Open in IMG/M |
3300025687|Ga0208019_1047531 | Not Available | 1500 | Open in IMG/M |
3300025687|Ga0208019_1118792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 786 | Open in IMG/M |
3300025751|Ga0208150_1218856 | Not Available | 583 | Open in IMG/M |
3300025759|Ga0208899_1012017 | Not Available | 4734 | Open in IMG/M |
3300025759|Ga0208899_1036474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2242 | Open in IMG/M |
3300025759|Ga0208899_1086183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1210 | Open in IMG/M |
3300025759|Ga0208899_1223827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 579 | Open in IMG/M |
3300025769|Ga0208767_1073183 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1475 | Open in IMG/M |
3300025769|Ga0208767_1210841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 643 | Open in IMG/M |
3300025771|Ga0208427_1202140 | Not Available | 631 | Open in IMG/M |
3300025803|Ga0208425_1094666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 701 | Open in IMG/M |
3300025806|Ga0208545_1024562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2003 | Open in IMG/M |
3300025806|Ga0208545_1145551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 571 | Open in IMG/M |
3300025810|Ga0208543_1079249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 793 | Open in IMG/M |
3300025816|Ga0209193_1053272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1114 | Open in IMG/M |
3300025828|Ga0208547_1062274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1247 | Open in IMG/M |
3300025840|Ga0208917_1210570 | Not Available | 643 | Open in IMG/M |
3300025853|Ga0208645_1086972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1336 | Open in IMG/M |
3300025874|Ga0209533_1070064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1899 | Open in IMG/M |
3300025887|Ga0208544_10136251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P | 1067 | Open in IMG/M |
3300025889|Ga0208644_1095570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1477 | Open in IMG/M |
3300025889|Ga0208644_1271165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 690 | Open in IMG/M |
3300025890|Ga0209631_10141405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1312 | Open in IMG/M |
3300025892|Ga0209630_10118362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1394 | Open in IMG/M |
3300025894|Ga0209335_10145640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1157 | Open in IMG/M |
3300027859|Ga0209503_10274726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P | 818 | Open in IMG/M |
3300028022|Ga0256382_1041574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1054 | Open in IMG/M |
3300029309|Ga0183683_1003010 | All Organisms → Viruses | 5986 | Open in IMG/M |
3300029318|Ga0185543_1085551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 624 | Open in IMG/M |
3300029319|Ga0183748_1017556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2645 | Open in IMG/M |
3300029319|Ga0183748_1071615 | Not Available | 888 | Open in IMG/M |
3300029787|Ga0183757_1002766 | All Organisms → Viruses | 6737 | Open in IMG/M |
3300029787|Ga0183757_1006387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3784 | Open in IMG/M |
3300031565|Ga0307379_10074081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 3786 | Open in IMG/M |
3300032073|Ga0315315_10274325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 1572 | Open in IMG/M |
3300032073|Ga0315315_11387489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 614 | Open in IMG/M |
3300032088|Ga0315321_10851523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 513 | Open in IMG/M |
3300032277|Ga0316202_10031867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2531 | Open in IMG/M |
3300032277|Ga0316202_10179682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 982 | Open in IMG/M |
3300034375|Ga0348336_030277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P | 2566 | Open in IMG/M |
3300034418|Ga0348337_077630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC035P | 1175 | Open in IMG/M |
3300034418|Ga0348337_133472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 735 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 34.59% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.47% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 9.12% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.12% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.09% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.46% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.14% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.89% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.57% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.26% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.26% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.94% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.94% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.94% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.63% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.63% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.31% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.31% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.31% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2019105005 | Marine microbial communities from Pulau Tioman, Malaysia | Environmental | Open in IMG/M |
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300013195 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station7_GOM_Metagenome | Environmental | Open in IMG/M |
3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MgKW_18760 | 2019105005 | Marine | MKAKDYKSITELLEKKYKKKFYLFQDFEDIINRIKQRKDKQ |
DelMOSum2010_100727857 | 3300000101 | Marine | ITEILEKKYQCKFYLFMDLKDCENRIKQKRKDQQ* |
DelMOSum2010_101253203 | 3300000101 | Marine | MKAKNYKSITEILEKKYKKKFYLFMDLEDCMNXIKQKRKD* |
DelMOSum2010_102646521 | 3300000101 | Marine | ITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQQ* |
DelMOSum2011_101332202 | 3300000115 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKD* |
DelMOSum2011_101579753 | 3300000115 | Marine | MKAKNYKSIIEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ* |
DelMOSum2011_101872683 | 3300000115 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLKDCMNRIKKQKARNK* |
DelMOSum2011_101896041 | 3300000115 | Marine | MKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
DelMOSum2011_101976871 | 3300000115 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDR* |
DelMOSum2011_102095252 | 3300000115 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
DelMOSum2011_102196062 | 3300000115 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQQ* |
DelMOSum2011_102271481 | 3300000115 | Marine | MKAKDYKSITKILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ* |
DelMOSpr2010_100435753 | 3300000116 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDL* |
DelMOSpr2010_100966658 | 3300000116 | Marine | SITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ* |
DelMOSpr2010_101212903 | 3300000116 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIK |
DelMOSpr2010_101234173 | 3300000116 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKD |
DelMOSpr2010_101265074 | 3300000116 | Marine | MGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
DelMOSpr2010_101551292 | 3300000116 | Marine | MKAKNYKSITEILEKKYKKKFYLFMDFQDCMNRIKQRKEQ* |
DelMOSpr2010_101686222 | 3300000116 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
DelMOSpr2010_101716752 | 3300000116 | Marine | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ* |
DelMOSpr2010_101754253 | 3300000116 | Marine | MKAKNYKSITEILEKKYKKKFYLFMDLEDCMNKIKQKRKD* |
DelMOSpr2010_102069143 | 3300000116 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRK |
DelMOSpr2010_102194751 | 3300000116 | Marine | YKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
DelMOSpr2010_102385623 | 3300000116 | Marine | KSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ* |
DelMOWin2010_100547314 | 3300000117 | Marine | MKAKDYKSITEILTKKYQCKFFLFMDLEDCMNRIKQKRKVK* |
DelMOWin2010_100744813 | 3300000117 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDR* |
DelMOWin2010_100765275 | 3300000117 | Marine | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ* |
DelMOWin2010_101431401 | 3300000117 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKR |
DelMOWin2010_101950921 | 3300000117 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKR |
DelMOWin2010_102217421 | 3300000117 | Marine | KSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
JGI20158J14315_1002343010 | 3300001355 | Pelagic Marine | MKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDK* |
JGI24006J15134_100181816 | 3300001450 | Marine | MGGSIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
JGI24006J15134_100924221 | 3300001450 | Marine | MKAKNYKSITEILEKKYKKKFYLFQDFEDCMNRIKQKRKDQQ* |
JGI24003J15210_100347961 | 3300001460 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ* |
JGI24003J15210_100938093 | 3300001460 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDFKDCENKIKQKRKDR* |
JGI24004J15324_100268271 | 3300001472 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRNNQQ* |
JGI24004J15324_100401197 | 3300001472 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRRVK* |
JGI24004J15324_100919342 | 3300001472 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDFKDCENRIKQKRKDR* |
JGI24004J15324_101050873 | 3300001472 | Marine | SITEILEKKYQCKFYLFMDLEDCMNRIKQKRKNQQ* |
JGI24004J15324_101132193 | 3300001472 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
JGI24004J15324_101280802 | 3300001472 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKREDQ* |
JGI24004J15324_101392461 | 3300001472 | Marine | MKAKNYKSITEILEKKYKKKFYLFMDLEDCINRIKQKRKEQQ* |
JGI24005J15628_100889833 | 3300001589 | Marine | MGGSIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
JGI24005J15628_100964422 | 3300001589 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDQ* |
JGI24005J15628_101022621 | 3300001589 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDLKDCENRIKQKRKDQ* |
JGI25132J35274_11236592 | 3300002483 | Marine | MKAKDYKSITEILEKKYQCKFYLWMDFKDVSDRIKQKVRNNDNTR* |
JGI25128J35275_100118910 | 3300002488 | Marine | MKAKNYKSITEILNKKYKKKXYLFMDLEDCMNRIKQKRKEQ* |
Ga0075474_100363204 | 3300006025 | Aqueous | MKAKNYKSITEILTKKYQCEFYLFMDLEDCENRIKQKRKDR* |
Ga0075478_100402345 | 3300006026 | Aqueous | MKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDRQ* |
Ga0075478_100738575 | 3300006026 | Aqueous | MKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKR |
Ga0075478_100811853 | 3300006026 | Aqueous | MKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDLQ* |
Ga0075478_102154321 | 3300006026 | Aqueous | KNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ* |
Ga0075462_100670374 | 3300006027 | Aqueous | MKAKDYKSITEILEKKYKKKFYLFMDIKDCMNRIKQKRKDQ* |
Ga0075462_101643863 | 3300006027 | Aqueous | YKSITEILEKKYKKKFYLFMDLEDCMNKIKQKRKD* |
Ga0075466_10601412 | 3300006029 | Aqueous | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
Ga0075466_11093711 | 3300006029 | Aqueous | KSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
Ga0075466_11132434 | 3300006029 | Aqueous | ITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ* |
Ga0098038_10151557 | 3300006735 | Marine | MKAKDYKSITKLLEKKYKKKFYLFQDFEDIMNRIKQKRKDQ* |
Ga0098038_10173455 | 3300006735 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLRDCENRIKQKRKDQ* |
Ga0098038_10351526 | 3300006735 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK* |
Ga0098038_10386102 | 3300006735 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLKDCENRIKKQKSRNNGK* |
Ga0098038_10524464 | 3300006735 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ* |
Ga0098038_11404583 | 3300006735 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
Ga0098038_11918451 | 3300006735 | Marine | MKAKNYKSITEILNKKYKKKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0098037_10412904 | 3300006737 | Marine | MKAKNYKSITEILTKKYKKKFYLFMDLEDCMNRIKQKRKDQQ* |
Ga0098037_11418851 | 3300006737 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRKDK* |
Ga0098037_11467904 | 3300006737 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLKDCENRIKKQKARK* |
Ga0098037_11581653 | 3300006737 | Marine | MKAKDYKSITEILEKKYKKKFYLFQDFEDCINRIKQKRKEQ* |
Ga0098037_11892121 | 3300006737 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLKDCENRIKQKRKVK* |
Ga0098042_11517742 | 3300006749 | Marine | MKSKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKR |
Ga0098042_11531843 | 3300006749 | Marine | MKAKDYKSITELLEKKYKKKFYLFQDFEDVINRIKQKRKEQ* |
Ga0070749_100789441 | 3300006802 | Aqueous | MKAKNYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ* |
Ga0070749_102416044 | 3300006802 | Aqueous | MKAKNYKSIIEILEKKYKKKFYLFMDIQDCMNRIKQRKEQ* |
Ga0070749_102469863 | 3300006802 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQNCMNRIKQKKSEGNNE* |
Ga0070749_103978233 | 3300006802 | Aqueous | NRKVNMKAKNYKSITEILEKKYKKKFYLFMDLEDCMNKIKQKRKD* |
Ga0070749_104177811 | 3300006802 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKEQ* |
Ga0070749_106088622 | 3300006802 | Aqueous | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0070749_106288333 | 3300006802 | Aqueous | NMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKVK* |
Ga0070749_106288353 | 3300006802 | Aqueous | NMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDL* |
Ga0070749_107332133 | 3300006802 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDIQDCMNRIKQRKEQ* |
Ga0075467_101051691 | 3300006803 | Aqueous | MGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNR |
Ga0075467_104403513 | 3300006803 | Aqueous | SIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0070754_104046063 | 3300006810 | Aqueous | ENMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKEQ* |
Ga0070754_104417161 | 3300006810 | Aqueous | KDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ* |
Ga0070754_104928701 | 3300006810 | Aqueous | YKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0070754_105264472 | 3300006810 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDIEDCMNRIKQKRKDQ |
Ga0075481_101924823 | 3300006868 | Aqueous | MGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
Ga0075481_103343912 | 3300006868 | Aqueous | MKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0075477_100637221 | 3300006869 | Aqueous | KAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ* |
Ga0075477_103412671 | 3300006869 | Aqueous | KSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ* |
Ga0070750_101661973 | 3300006916 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK* |
Ga0070750_102135442 | 3300006916 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
Ga0070750_102290771 | 3300006916 | Aqueous | YKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ* |
Ga0070746_105463422 | 3300006919 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDR* |
Ga0070748_11208153 | 3300006920 | Aqueous | VFIDIIRKETIMKAKNYKSITEILEKKYQCKYYLFMDFEDCMNRIKQKRKDQ* |
Ga0070748_13159871 | 3300006920 | Aqueous | NMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKVK* |
Ga0070748_13375121 | 3300006920 | Aqueous | IIMKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKDQ* |
Ga0098060_10390324 | 3300006921 | Marine | MKSKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK* |
Ga0098060_10508282 | 3300006921 | Marine | MKAKDYKSITEILNKKYKKKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0098060_11671483 | 3300006921 | Marine | MKAKNYKSITEILTKKYKKKFYLFQDFEDIMNRIKQKRKDQ* |
Ga0098045_11536152 | 3300006922 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0098036_11207492 | 3300006929 | Marine | MKAKNYKSITEILTKKYKKKFYLFMDLEDCMNRIKQKRKDQQ*QV* |
Ga0098046_10179052 | 3300006990 | Marine | MKAKDYKSITEILEKKYKKKFYLFQDFEDCINRIKQKRKVK* |
Ga0098046_10446631 | 3300006990 | Marine | KMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK* |
Ga0075468_100995341 | 3300007229 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKR |
Ga0075468_101467453 | 3300007229 | Aqueous | MKAKNYKSITEILEKKYQCKFFLFMDLEDCMNRIKQKRKDQ* |
Ga0075463_100436441 | 3300007236 | Aqueous | VFIDIIRKETIMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKD |
Ga0075463_101050853 | 3300007236 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKD |
Ga0070747_12327634 | 3300007276 | Aqueous | KDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0070747_12778922 | 3300007276 | Aqueous | MKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDR* |
Ga0070745_12284493 | 3300007344 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRK |
Ga0070752_12297912 | 3300007345 | Aqueous | MKAKNYKSITEILTKKYQCKFYLFMDIEDCMNRIKQKRKDQQ* |
Ga0070752_13024053 | 3300007345 | Aqueous | MKAKNYKSIIEILEKKYKKKFYLIMDIQDCMNRIKQRKEQ* |
Ga0070753_11610113 | 3300007346 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQR |
Ga0099851_10212787 | 3300007538 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDFQDCMNRIKQRKSEE* |
Ga0099851_12532601 | 3300007538 | Aqueous | KNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ* |
Ga0099849_13781121 | 3300007539 | Aqueous | NMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ* |
Ga0099848_10499055 | 3300007541 | Aqueous | MKVKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ* |
Ga0099846_10212615 | 3300007542 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKSEE* |
Ga0070751_10917755 | 3300007640 | Aqueous | MKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRK |
Ga0070751_11209553 | 3300007640 | Aqueous | VFIDIIRKETIMKAKNYKSIIEILEKKYQCKFYLFMDLKDCENRIKQKRKDQ* |
Ga0099850_11275293 | 3300007960 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKKSEGNNE* |
Ga0075480_100731271 | 3300008012 | Aqueous | MKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDQQ* |
Ga0075480_102744103 | 3300008012 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0075480_103111164 | 3300008012 | Aqueous | MKAKDYKSITKILTKKYQCKFYLFMDLEDCMNRIKQKR |
Ga0075480_105752082 | 3300008012 | Aqueous | MGGSIIKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
Ga0115549_10259267 | 3300009074 | Pelagic Marine | MKAKDYKSITEILTKKYKKKFYLFMDLKDCMNRIKKQKARE* |
Ga0115548_11720813 | 3300009423 | Pelagic Marine | MKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKD |
Ga0115546_11404081 | 3300009435 | Pelagic Marine | NMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDQ* |
Ga0115546_11449872 | 3300009435 | Pelagic Marine | MKAKDYKSITEILTKKYKKKFYLFMDLKDCMDRIKKQKARE* |
Ga0115008_108095803 | 3300009436 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLKDCENRIKKQKARNK* |
Ga0115558_12766233 | 3300009449 | Pelagic Marine | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQQ* |
Ga0115555_13078303 | 3300009476 | Pelagic Marine | LIGVKIIINKRKDHTMKAKNYKSITEVLDKKYNKGIVNKKDKINFYLFMDLEDCMNRIKQKRKDQ* |
Ga0114932_103146062 | 3300009481 | Deep Subsurface | MKAKDYKSITEILEKKYQCKFYLFMDFKDVSDRIKQKQKEKARVNND* |
Ga0115569_102897261 | 3300009497 | Pelagic Marine | IMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDK* |
Ga0115564_102663762 | 3300009505 | Pelagic Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKDQQ* |
Ga0115567_103151474 | 3300009508 | Pelagic Marine | MKAKNYKSITEILEKKYQCKFFLFMDLEDCMNRIKQKRKDK* |
Ga0098043_10394411 | 3300010148 | Marine | MKAKDYKSITEILEKKYQCKSYLWMDFKDVSDKIKQKVRNND |
Ga0098059_10200576 | 3300010153 | Marine | MKAKDYKSITEILEKKYKKKFYLFQDFEDIMNRIKQKRKDQ* |
Ga0098059_10512313 | 3300010153 | Marine | MKAKNYKSITEILEKKYQCKFYLLMNHEDCMKKIKKKRKDQ* |
Ga0098059_10933161 | 3300010153 | Marine | MLNRKDHTMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR* |
Ga0129348_12094792 | 3300010296 | Freshwater To Marine Saline Gradient | MKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ* |
Ga0129342_10731102 | 3300010299 | Freshwater To Marine Saline Gradient | MKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ* |
Ga0136655_10372882 | 3300010316 | Freshwater To Marine Saline Gradient | MKAKNYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDR* |
Ga0129324_104362472 | 3300010368 | Freshwater To Marine Saline Gradient | MGGSIMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ* |
Ga0151671_10224741 | 3300011253 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRK |
Ga0160423_100624604 | 3300012920 | Surface Seawater | MKAKDYKSITELLEKKYKKKFYLFQDFEDVINRIKQKESEE* |
Ga0160423_101263092 | 3300012920 | Surface Seawater | MKAKNYKSITELLEKKYKKKFYLFQDFEDIINIIKQKRKDQ* |
Ga0160423_106641922 | 3300012920 | Surface Seawater | MKAKNYKSITELLEKKYKKKFYLFQDFEDIMNRINQKKKGK* |
Ga0116815_10371412 | 3300013195 | Marine | MKAKDYKSITELLEKKYKKKFYLFQDFEDIINRIKQKESEE* |
Ga0181377_10279614 | 3300017706 | Marine | MLNRKDHTMKAKDYKSITEILTKKYKKKFYLFQDFEDVINRIKQKRKDQQ |
Ga0181377_10287394 | 3300017706 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDLKDCENRIKQKRKDQ |
Ga0181369_10079974 | 3300017708 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK |
Ga0181369_10719312 | 3300017708 | Marine | MKAKDYKSITELLEKKYKKKFYLFQDFEDIMNRIKQKRKDQ |
Ga0181403_10595093 | 3300017710 | Seawater | MKAKDYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKDQ |
Ga0181391_11350973 | 3300017713 | Seawater | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQSGIDDSIS |
Ga0181412_10297813 | 3300017714 | Seawater | MKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKDQ |
Ga0181383_10761672 | 3300017720 | Seawater | MKAKKYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ |
Ga0181383_11610351 | 3300017720 | Seawater | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQKXQI |
Ga0181373_10130991 | 3300017721 | Marine | KIIIKAKNNKTNTEILTKKYQCKIYLFMDLEDCMNRIKQKRKETI |
Ga0181373_10350934 | 3300017721 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRKD |
Ga0181398_10121325 | 3300017725 | Seawater | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKIKNR |
Ga0181396_10093445 | 3300017729 | Seawater | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKIKNR |
Ga0187222_10612474 | 3300017734 | Seawater | MKAKKYKSITEILTKKYQCKFYLFMDLKDCENRIKQ |
Ga0181428_10049906 | 3300017738 | Seawater | MKAKDYKSITEILKKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0181418_10124673 | 3300017740 | Seawater | MKAKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKER |
Ga0181418_10597904 | 3300017740 | Seawater | MKAKNYKSITEILTKKYQCKFYLFMDLEDCINRIKQKRK |
Ga0181402_11569151 | 3300017743 | Seawater | KDYKSITEILEKKYQCKFYLFMDLEDCENRIKQKRKDQ |
Ga0181427_11301633 | 3300017745 | Seawater | MKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ |
Ga0181405_10716442 | 3300017750 | Seawater | MKAKNYKSITEILEKKYQCKFYLFMDLEDCENRIKQKRKER |
Ga0187219_10443615 | 3300017751 | Seawater | MKAKKYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKR |
Ga0181410_11200973 | 3300017763 | Seawater | MKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKD |
Ga0181413_10444493 | 3300017765 | Seawater | MKAKNYKSITEILEKKYKKKFYLFMDLEDCENRIKQKRKER |
Ga0181413_10882002 | 3300017765 | Seawater | MKAKEYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKDQ |
Ga0181406_10349903 | 3300017767 | Seawater | MKAKKYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0181430_11070173 | 3300017772 | Seawater | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQXQV |
Ga0181394_10626481 | 3300017776 | Seawater | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKIKNR |
Ga0181394_11139372 | 3300017776 | Seawater | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKKKRKDQ |
Ga0181395_10511973 | 3300017779 | Seawater | MKAKDYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDR |
Ga0181423_11058412 | 3300017781 | Seawater | MKAKDYKSITEILEKKYQCKFYLFMDLEDCINRIKQKRKDQ |
Ga0181380_10937912 | 3300017782 | Seawater | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ |
Ga0181380_11435314 | 3300017782 | Seawater | KNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKER |
Ga0181380_12408562 | 3300017782 | Seawater | MKAKKYKSITEILTKKYQCKFYLFMDLEDCINRIKQK |
Ga0181379_11760412 | 3300017783 | Seawater | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQXQI |
Ga0181607_100196017 | 3300017950 | Salt Marsh | MSLLNRKDHKMKAKDYKSITEILTKKYQCKFYSFMDLKDCENRIKQKRKDRQ |
Ga0181607_100238168 | 3300017950 | Salt Marsh | MKAKNYKSITEILKKKYKKKFYLFMDIQDCMNRIKQRKDQ |
Ga0181600_100098216 | 3300018036 | Salt Marsh | MKAKDYKSITEILTKKYQCKFYSFMDLKDCENRIKQKRKDRQ |
Ga0181575_107050401 | 3300020055 | Salt Marsh | MKAKNYKSITELLEKKYKTKFYLFMDFEDVINRIKKRKGV |
Ga0206124_100181415 | 3300020175 | Seawater | MKAKDYKSITEILEKKYKKKFYLFMDLKDCMNRIKKQKASK |
Ga0181604_100512733 | 3300020191 | Salt Marsh | MKAKDYKSITEILTKKYQCKFYSFMDLKDCENRIKQKRKDRQXQV |
Ga0181597_102230601 | 3300020194 | Salt Marsh | AKNYKSITEILKKKYKKKFYLFMDIQDCMNRIKQRKDQ |
Ga0211506_10721634 | 3300020365 | Marine | MKAKDYKSITELLEKKYKKKFYLFQDFEDIMNRIKQKESEE |
Ga0211678_104102621 | 3300020388 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQXQV |
Ga0211659_101179742 | 3300020404 | Marine | MKAKDYKSITEILEKKYQCKFYLWMDFKDVSDKIKQKVRNNDNTR |
Ga0211523_104053412 | 3300020414 | Marine | MKAKDYKSITELLEKKYKKKFYLFQDFEDIINRIKQKESEE |
Ga0211579_106501372 | 3300020472 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDFKDVSDRIKQKQKESEGV |
Ga0213862_100310323 | 3300021347 | Seawater | MKAKDYKSITELLEKKYKKKFYLFQDFEDIINRIKQKERNNNNE |
Ga0213858_101461752 | 3300021356 | Seawater | MKAKNYKSITELLEKKYKKKFYLFQDFEDVINRIKKRKGV |
Ga0206123_100704341 | 3300021365 | Seawater | MKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ |
Ga0213869_100096244 | 3300021375 | Seawater | MKAKNYKSITEILEKKYQCKFYLFMDLKDCENRIKQKRKDQ |
Ga0213869_102046054 | 3300021375 | Seawater | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQ |
Ga0222718_100440074 | 3300021958 | Estuarine Water | MSLLNRKDHKMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDR |
Ga0222718_101062691 | 3300021958 | Estuarine Water | KDHTMKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK |
Ga0222718_102924011 | 3300021958 | Estuarine Water | MKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQK |
Ga0222718_104338123 | 3300021958 | Estuarine Water | MKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKV |
Ga0222716_100268607 | 3300021959 | Estuarine Water | MKAKNYKSITEILEKKYKIKFYLFMDFSDCLNRINQKRKEQNEK |
Ga0222716_100590735 | 3300021959 | Estuarine Water | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKEQ |
Ga0222716_102056511 | 3300021959 | Estuarine Water | MKAKEYKSITKILEKKYKKKFYLFQDFEDVKNRIKGVK |
Ga0222716_103730593 | 3300021959 | Estuarine Water | MIIKNKDYKSITEILEKKYKIKFYLFMDIQDCMNRIKQRKVGK |
Ga0222716_106269753 | 3300021959 | Estuarine Water | MNMLSRKDHTMKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK |
Ga0222715_102145321 | 3300021960 | Estuarine Water | MKAKDYKSITEILTKKYQCKFYSFMDLKDCENRIKQK |
Ga0212023_10368212 | 3300022061 | Aqueous | MKAKNYKSITEILEKKYQCKFFLFMDLEDCMNRIKQKRKDQ |
Ga0212024_10798411 | 3300022065 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK |
Ga0212024_11016453 | 3300022065 | Aqueous | TIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0212021_10514161 | 3300022068 | Aqueous | KSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0212028_10260764 | 3300022071 | Aqueous | MKAKNYKSITEILTKKYQCEFYLFMDLEDCENRIKQKRKDR |
Ga0196889_10859573 | 3300022072 | Aqueous | GVNMKAKNYKSITEILTKKYQCEFYLFMDLEDCENRIKQKRKDR |
Ga0224906_10480102 | 3300022074 | Seawater | MKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKDQ |
Ga0212022_10057134 | 3300022164 | Aqueous | MKAKNYKSITEILEKKYQCKFFLFMDLEDCMNRIKQKRKDQQXQV |
Ga0212022_10514902 | 3300022164 | Aqueous | VFIDIIRKETIMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0196903_10075532 | 3300022169 | Aqueous | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0196887_10305992 | 3300022178 | Aqueous | MGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0196891_10203603 | 3300022183 | Aqueous | MKAKDYKSITEILEKKYKKKFYLFMDIKDCMNRIKQKRKDQ |
Ga0196905_10035964 | 3300022198 | Aqueous | MKVKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ |
Ga0196905_10524726 | 3300022198 | Aqueous | KAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKSEE |
Ga0196905_11714321 | 3300022198 | Aqueous | KENMKAKNYKSITKILEKKYKKKFYLFMDLQDCMNRIKQRKDQ |
Ga0196901_10509795 | 3300022200 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKSEE |
Ga0209992_100711647 | 3300024344 | Deep Subsurface | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQQ |
Ga0208667_10047828 | 3300025070 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLRDCENRIKQKRKDQ |
Ga0208667_10480842 | 3300025070 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLKDCENRIKKQKSRNNGK |
Ga0208791_10143575 | 3300025083 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLRDCENRIK |
Ga0208157_10158361 | 3300025086 | Marine | MKAKNYKSITEILNKKYKKKFYLFMDLEDCMNRIKQKRKDQ |
Ga0208157_10377085 | 3300025086 | Marine | MLNRKDHTMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0208157_10448793 | 3300025086 | Marine | MKAKNYKSITEILTKKYKKKFYLFMDLEDCMNRIKQKRKDQQXQV |
Ga0208157_11429892 | 3300025086 | Marine | MKAKDYKSITKLLEKKYKKKFYLFQDFEDIMNRIKQKRKDQ |
Ga0208669_10502012 | 3300025099 | Marine | MKAKNYKSITEILTKKYKKKFYLFMDLEDCMNRIKQKRKDQQ |
Ga0208669_11028562 | 3300025099 | Marine | MKAKDYKSITEILEKKYKKKFYLFQDFEDCINRIKQKRKEQ |
Ga0208666_10283982 | 3300025102 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK |
Ga0208666_10365214 | 3300025102 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ |
Ga0208666_11142502 | 3300025102 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLEDCKNRIKQKRKDQQXQV |
Ga0209535_10412283 | 3300025120 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDFKDCENKIKQKRKDR |
Ga0209535_10455341 | 3300025120 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQQXQ |
Ga0209535_10467485 | 3300025120 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIK |
Ga0209535_10732953 | 3300025120 | Marine | MKAKNYKSITEMLTKKYQCKFYLFMDLEDCENRIK |
Ga0208919_10248486 | 3300025128 | Marine | MKAKNYKSITELLEKKYKKKFYLFQDFEDVINRIKQKKKGK |
Ga0208919_10300106 | 3300025128 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0209232_10021984 | 3300025132 | Marine | MKAKNYKSITEILNKKYKKKFYLFMDLEDCMNRIKQKRKEQ |
Ga0209336_100604803 | 3300025137 | Marine | MKAKNYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ |
Ga0209336_100651845 | 3300025137 | Marine | MKAKDYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRRVK |
Ga0209336_101625793 | 3300025137 | Marine | MKAKNYKSITEILEKKYKKKFYLFMDLEDCINRIKQKRKEQQXQI |
Ga0209336_101852542 | 3300025137 | Marine | MKAKDYKSITEILEKKYKKKFYLFMDLKDCMNRIKQKRKDK |
Ga0209336_101854643 | 3300025137 | Marine | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0209634_10330674 | 3300025138 | Marine | MKAKNYKSITEILEKKYKKKFYLFQDFEDCMNRIKQKRKDQQ |
Ga0209645_10282312 | 3300025151 | Marine | MKAKDYKSITEILEKKYQCKFYLWMDFKDVSDRIKQKVRNNDNTR |
Ga0209645_11056522 | 3300025151 | Marine | MKAKNYKSITELLEKKYKKKFYLFQDFEDVINRIKQKESEE |
Ga0209337_10246436 | 3300025168 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0209337_10498601 | 3300025168 | Marine | MKAKNYKSITEILEKKYKKKFYLFQDFEDCMNRIKQKRKDQQXQV |
Ga0209337_10573612 | 3300025168 | Marine | MKAKNYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRRVK |
Ga0209337_12508004 | 3300025168 | Marine | KAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0208148_10161466 | 3300025508 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQXQV |
Ga0208148_10269021 | 3300025508 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLEDCMNKIKQKRKD |
Ga0208148_10275879 | 3300025508 | Aqueous | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKVK |
Ga0208148_10732161 | 3300025508 | Aqueous | KDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ |
Ga0208148_11075362 | 3300025508 | Aqueous | MGGSIMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0208303_10400153 | 3300025543 | Aqueous | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0208303_10924311 | 3300025543 | Aqueous | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKR |
Ga0209304_10320501 | 3300025577 | Pelagic Marine | MKAKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKDQQ |
Ga0209094_10326634 | 3300025594 | Pelagic Marine | MKAKDYKSITEILTKKYKKKFYLFMDLKDCMNRIKKQKARE |
Ga0209194_10005411 | 3300025632 | Pelagic Marine | MKAKDYKSITEILTKKYKKKFYLFMDLKDCMDRIKK |
Ga0208643_10200537 | 3300025645 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ |
Ga0208643_11278821 | 3300025645 | Aqueous | KDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDR |
Ga0208160_10642841 | 3300025647 | Aqueous | KSITEILEKKYKKKFYLFMDLQDCMNRIKQRKSEE |
Ga0208428_10021709 | 3300025653 | Aqueous | MKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDR |
Ga0208428_10458273 | 3300025653 | Aqueous | VFIDIIRKETIMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0208795_10141185 | 3300025655 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDFQDCMNRIKQRKSEE |
Ga0208162_10421071 | 3300025674 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ |
Ga0208019_10475315 | 3300025687 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDFQDCMNRIKQRK |
Ga0208019_11187923 | 3300025687 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKKSEGNNE |
Ga0208150_12188563 | 3300025751 | Aqueous | FERKKAKNYKSIIEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ |
Ga0208899_10120172 | 3300025759 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDL |
Ga0208899_10364744 | 3300025759 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKVK |
Ga0208899_10861834 | 3300025759 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQQXQV |
Ga0208899_12238272 | 3300025759 | Aqueous | MKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDR |
Ga0208767_10731833 | 3300025769 | Aqueous | MKAKNYKSIIEILEKKYKKKFYLFMDIQDCMNRIKQRKEQ |
Ga0208767_12108411 | 3300025769 | Aqueous | GTIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0208427_12021401 | 3300025771 | Aqueous | NMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ |
Ga0208425_10946664 | 3300025803 | Aqueous | VNMKAKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKDR |
Ga0208545_10245625 | 3300025806 | Aqueous | MKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0208545_11455511 | 3300025806 | Aqueous | KSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ |
Ga0208543_10792493 | 3300025810 | Aqueous | MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKD |
Ga0209193_10532722 | 3300025816 | Pelagic Marine | MKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDQQ |
Ga0208547_10622741 | 3300025828 | Aqueous | AKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ |
Ga0208917_12105703 | 3300025840 | Aqueous | SFERKKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ |
Ga0208645_10869724 | 3300025853 | Aqueous | MGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0209533_10700642 | 3300025874 | Pelagic Marine | MKAKDYKSITEILEKKYQCKFYLFMDLKDCMNRIKQKRKDQQ |
Ga0208544_101362511 | 3300025887 | Aqueous | SIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0208644_10955705 | 3300025889 | Aqueous | MKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ |
Ga0208644_12711654 | 3300025889 | Aqueous | MKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQ |
Ga0209631_101414054 | 3300025890 | Pelagic Marine | MKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDK |
Ga0209630_101183625 | 3300025892 | Pelagic Marine | MKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQK |
Ga0209335_101456406 | 3300025894 | Pelagic Marine | TIMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDK |
Ga0209503_102747263 | 3300027859 | Marine | MKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQQXIDMNNM |
Ga0256382_10415741 | 3300028022 | Seawater | MKAKDYKSITEILEKKYKKKFYLFQDFEDIINRIKQKESEE |
Ga0183683_100301012 | 3300029309 | Marine | MKAKKYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ |
Ga0185543_10855511 | 3300029318 | Marine | MKAKDYKSITEILEKKYKKKFYLFQDFEDIMNRIKQKESEE |
Ga0183748_10175566 | 3300029319 | Marine | MKAKDYTSITEILEKKYQCKFYSWMTYKEVFDRIKQKEKARKNDNTR |
Ga0183748_10716151 | 3300029319 | Marine | MKAKNYKSITEILEKKYKKKFYLFQDFEDVINKIKRKGV |
Ga0183757_10027668 | 3300029787 | Marine | MKAKDYKSITKILEKKYKKKFYLFQDFEDVINRIKKIKGVRYDNTRKN |
Ga0183757_10063876 | 3300029787 | Marine | MKAKNYKSITEILKKKYMKKTCKPSCLYKWDVKEFYLFMDLEDCMNRIKQKRKDQ |
Ga0307379_100740813 | 3300031565 | Soil | MKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ |
Ga0315315_102743252 | 3300032073 | Seawater | MKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ |
Ga0315315_113874891 | 3300032073 | Seawater | MKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIK |
Ga0315321_108515232 | 3300032088 | Seawater | MKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK |
Ga0316202_100318674 | 3300032277 | Microbial Mat | MKAKNYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQXQV |
Ga0316202_101796824 | 3300032277 | Microbial Mat | MKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRK |
Ga0348336_030277_1369_1509 | 3300034375 | Aqueous | MGGSIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR |
Ga0348337_077630_2_109 | 3300034418 | Aqueous | MKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQ |
Ga0348337_133472_619_735 | 3300034418 | Aqueous | MKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKD |
⦗Top⦘ |