NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F009440

Metagenome Family F009440

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009440
Family Type Metagenome
Number of Sequences 318
Average Sequence Length 41 residues
Representative Sequence MKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Number of Associated Samples 171
Number of Associated Scaffolds 318

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 64.87 %
% of genes near scaffold ends (potentially truncated) 32.08 %
% of genes from short scaffolds (< 2000 bps) 83.65 %
Associated GOLD sequencing projects 125
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (65.094 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(34.591 % of family members)
Environment Ontology (ENVO) Unclassified
(90.566 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(96.541 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 318 Family Scaffolds
PF03237Terminase_6N 1.26
PF13730HTH_36 0.63
PF05869Dam 0.63
PF16190E1_FCCH 0.31
PF01555N6_N4_Mtase 0.31
PF05063MT-A70 0.31
PF04404ERF 0.31
PF00271Helicase_C 0.31
PF12236Head-tail_con 0.31

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 318 Family Scaffolds
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 0.63
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.31
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.31
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.31


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.39 %
UnclassifiedrootN/A17.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2019105005|PelMarPul_NODE_8799_len_4261_cov_16_710161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4287Open in IMG/M
3300000101|DelMOSum2010_c10072785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1570Open in IMG/M
3300000101|DelMOSum2010_c10125320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1000Open in IMG/M
3300000101|DelMOSum2010_c10264652Not Available533Open in IMG/M
3300000115|DelMOSum2011_c10133220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P760Open in IMG/M
3300000115|DelMOSum2011_c10157975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P666Open in IMG/M
3300000115|DelMOSum2011_c10187268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P585Open in IMG/M
3300000115|DelMOSum2011_c10189604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P580Open in IMG/M
3300000115|DelMOSum2011_c10197687All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P562Open in IMG/M
3300000115|DelMOSum2011_c10209525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P538Open in IMG/M
3300000115|DelMOSum2011_c10219606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P519Open in IMG/M
3300000115|DelMOSum2011_c10227148All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P506Open in IMG/M
3300000116|DelMOSpr2010_c10043575All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300000116|DelMOSpr2010_c10096665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1124Open in IMG/M
3300000116|DelMOSpr2010_c10121290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P943Open in IMG/M
3300000116|DelMOSpr2010_c10123417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P930Open in IMG/M
3300000116|DelMOSpr2010_c10126507All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)913Open in IMG/M
3300000116|DelMOSpr2010_c10155129Not Available779Open in IMG/M
3300000116|DelMOSpr2010_c10168622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P731Open in IMG/M
3300000116|DelMOSpr2010_c10171675Not Available720Open in IMG/M
3300000116|DelMOSpr2010_c10175425All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156708Open in IMG/M
3300000116|DelMOSpr2010_c10206914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P625Open in IMG/M
3300000116|DelMOSpr2010_c10219475All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes597Open in IMG/M
3300000116|DelMOSpr2010_c10238562Not Available560Open in IMG/M
3300000117|DelMOWin2010_c10054731All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1727Open in IMG/M
3300000117|DelMOWin2010_c10074481All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1351Open in IMG/M
3300000117|DelMOWin2010_c10076527All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P1323Open in IMG/M
3300000117|DelMOWin2010_c10143140Not Available800Open in IMG/M
3300000117|DelMOWin2010_c10195092All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P627Open in IMG/M
3300000117|DelMOWin2010_c10221742All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P569Open in IMG/M
3300001355|JGI20158J14315_10023430All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3068Open in IMG/M
3300001450|JGI24006J15134_10018181Not Available3281Open in IMG/M
3300001450|JGI24006J15134_10092422All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1104Open in IMG/M
3300001460|JGI24003J15210_10034796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth1806Open in IMG/M
3300001460|JGI24003J15210_10093809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P875Open in IMG/M
3300001472|JGI24004J15324_10026827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth1904Open in IMG/M
3300001472|JGI24004J15324_10040119All Organisms → Viruses → Predicted Viral1453Open in IMG/M
3300001472|JGI24004J15324_10091934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P797Open in IMG/M
3300001472|JGI24004J15324_10105087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes718Open in IMG/M
3300001472|JGI24004J15324_10113219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P677Open in IMG/M
3300001472|JGI24004J15324_10128080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P613Open in IMG/M
3300001472|JGI24004J15324_10139246Not Available573Open in IMG/M
3300001589|JGI24005J15628_10088983All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1065Open in IMG/M
3300001589|JGI24005J15628_10096442Not Available1003Open in IMG/M
3300001589|JGI24005J15628_10102262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P960Open in IMG/M
3300002483|JGI25132J35274_1123659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P516Open in IMG/M
3300002488|JGI25128J35275_1001189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes7875Open in IMG/M
3300006025|Ga0075474_10036320All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1712Open in IMG/M
3300006026|Ga0075478_10040234All Organisms → Viruses → Predicted Viral1546Open in IMG/M
3300006026|Ga0075478_10073857All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1101Open in IMG/M
3300006026|Ga0075478_10081185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811044Open in IMG/M
3300006026|Ga0075478_10215432Not Available583Open in IMG/M
3300006027|Ga0075462_10067037Not Available1131Open in IMG/M
3300006027|Ga0075462_10164386Not Available675Open in IMG/M
3300006029|Ga0075466_1060141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1097Open in IMG/M
3300006029|Ga0075466_1109371All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P742Open in IMG/M
3300006029|Ga0075466_1113243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281725Open in IMG/M
3300006735|Ga0098038_1015155All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P2977Open in IMG/M
3300006735|Ga0098038_1017345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2770Open in IMG/M
3300006735|Ga0098038_1035152All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1857Open in IMG/M
3300006735|Ga0098038_1038610All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1758Open in IMG/M
3300006735|Ga0098038_1052446All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1470Open in IMG/M
3300006735|Ga0098038_1140458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P810Open in IMG/M
3300006735|Ga0098038_1191845Not Available664Open in IMG/M
3300006737|Ga0098037_1041290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1679Open in IMG/M
3300006737|Ga0098037_1141885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P810Open in IMG/M
3300006737|Ga0098037_1146790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P793Open in IMG/M
3300006737|Ga0098037_1158165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P758Open in IMG/M
3300006737|Ga0098037_1189212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P677Open in IMG/M
3300006749|Ga0098042_1151774All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006749|Ga0098042_1153184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P564Open in IMG/M
3300006802|Ga0070749_10078944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1968Open in IMG/M
3300006802|Ga0070749_10241604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1025Open in IMG/M
3300006802|Ga0070749_10246986All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300006802|Ga0070749_10397823Not Available760Open in IMG/M
3300006802|Ga0070749_10417781Not Available738Open in IMG/M
3300006802|Ga0070749_10608862All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P589Open in IMG/M
3300006802|Ga0070749_10628833All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P577Open in IMG/M
3300006802|Ga0070749_10628835All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P577Open in IMG/M
3300006802|Ga0070749_10733213Not Available527Open in IMG/M
3300006803|Ga0075467_10105169Not Available1675Open in IMG/M
3300006803|Ga0075467_10440351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P674Open in IMG/M
3300006810|Ga0070754_10404606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P597Open in IMG/M
3300006810|Ga0070754_10441716All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P565Open in IMG/M
3300006810|Ga0070754_10492870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P528Open in IMG/M
3300006810|Ga0070754_10526447Not Available507Open in IMG/M
3300006868|Ga0075481_10192482All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)731Open in IMG/M
3300006868|Ga0075481_10334391All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156524Open in IMG/M
3300006869|Ga0075477_10063722All Organisms → Viruses → Predicted Viral1624Open in IMG/M
3300006869|Ga0075477_10341267Not Available589Open in IMG/M
3300006916|Ga0070750_10166197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P992Open in IMG/M
3300006916|Ga0070750_10213544All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P849Open in IMG/M
3300006916|Ga0070750_10229077Not Available813Open in IMG/M
3300006919|Ga0070746_10546342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P503Open in IMG/M
3300006920|Ga0070748_1120815All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156987Open in IMG/M
3300006920|Ga0070748_1315987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P554Open in IMG/M
3300006920|Ga0070748_1337512All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P533Open in IMG/M
3300006921|Ga0098060_1039032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1427Open in IMG/M
3300006921|Ga0098060_1050828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1225Open in IMG/M
3300006921|Ga0098060_1167148All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P607Open in IMG/M
3300006922|Ga0098045_1153615Not Available528Open in IMG/M
3300006929|Ga0098036_1120749Not Available803Open in IMG/M
3300006990|Ga0098046_1017905All Organisms → Viruses → Predicted Viral1826Open in IMG/M
3300006990|Ga0098046_1044663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1049Open in IMG/M
3300007229|Ga0075468_10099534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P923Open in IMG/M
3300007229|Ga0075468_10146745All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P716Open in IMG/M
3300007236|Ga0075463_10043644All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1457Open in IMG/M
3300007236|Ga0075463_10105085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P911Open in IMG/M
3300007276|Ga0070747_1232763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P643Open in IMG/M
3300007276|Ga0070747_1277892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P578Open in IMG/M
3300007344|Ga0070745_1228449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P679Open in IMG/M
3300007345|Ga0070752_1229791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes728Open in IMG/M
3300007345|Ga0070752_1302405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P609Open in IMG/M
3300007346|Ga0070753_1161011Not Available846Open in IMG/M
3300007538|Ga0099851_1021278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P2622Open in IMG/M
3300007538|Ga0099851_1253260Not Available629Open in IMG/M
3300007539|Ga0099849_1378112Not Available500Open in IMG/M
3300007541|Ga0099848_1049905All Organisms → Viruses → environmental samples → uncultured Mediterranean phage1688Open in IMG/M
3300007542|Ga0099846_1021261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P2519Open in IMG/M
3300007640|Ga0070751_1091775All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1265Open in IMG/M
3300007960|Ga0099850_1127529All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1035Open in IMG/M
3300008012|Ga0075480_10073127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1963Open in IMG/M
3300008012|Ga0075480_10274410All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156864Open in IMG/M
3300008012|Ga0075480_10311116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P796Open in IMG/M
3300008012|Ga0075480_10575208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P535Open in IMG/M
3300009074|Ga0115549_1025926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2264Open in IMG/M
3300009423|Ga0115548_1172081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P677Open in IMG/M
3300009435|Ga0115546_1140408All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes856Open in IMG/M
3300009435|Ga0115546_1144987Not Available840Open in IMG/M
3300009436|Ga0115008_10809580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P687Open in IMG/M
3300009449|Ga0115558_1276623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P673Open in IMG/M
3300009476|Ga0115555_1307830Not Available637Open in IMG/M
3300009481|Ga0114932_10314606All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P937Open in IMG/M
3300009497|Ga0115569_10289726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P725Open in IMG/M
3300009505|Ga0115564_10266376All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156868Open in IMG/M
3300009508|Ga0115567_10315147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P978Open in IMG/M
3300010148|Ga0098043_1039441All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1469Open in IMG/M
3300010153|Ga0098059_1020057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2734Open in IMG/M
3300010153|Ga0098059_1051231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth1659Open in IMG/M
3300010153|Ga0098059_1093316All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1197Open in IMG/M
3300010296|Ga0129348_1209479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P662Open in IMG/M
3300010299|Ga0129342_1073110All Organisms → Viruses → Predicted Viral1313Open in IMG/M
3300010316|Ga0136655_1037288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1556Open in IMG/M
3300010368|Ga0129324_10436247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P503Open in IMG/M
3300011253|Ga0151671_1022474All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)716Open in IMG/M
3300012920|Ga0160423_10062460Not Available2679Open in IMG/M
3300012920|Ga0160423_10126309All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1802Open in IMG/M
3300012920|Ga0160423_10664192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P704Open in IMG/M
3300013195|Ga0116815_1037141All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.664Open in IMG/M
3300017706|Ga0181377_1027961All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1185Open in IMG/M
3300017706|Ga0181377_1028739All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1163Open in IMG/M
3300017708|Ga0181369_1007997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2751Open in IMG/M
3300017708|Ga0181369_1071931Not Available746Open in IMG/M
3300017710|Ga0181403_1059509All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P796Open in IMG/M
3300017713|Ga0181391_1135097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P549Open in IMG/M
3300017714|Ga0181412_1029781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1476Open in IMG/M
3300017720|Ga0181383_1076167All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P900Open in IMG/M
3300017720|Ga0181383_1161035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes601Open in IMG/M
3300017721|Ga0181373_1013099Not Available1556Open in IMG/M
3300017721|Ga0181373_1035093All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)924Open in IMG/M
3300017725|Ga0181398_1012132All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2189Open in IMG/M
3300017729|Ga0181396_1009344All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1971Open in IMG/M
3300017734|Ga0187222_1061247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P869Open in IMG/M
3300017738|Ga0181428_1004990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3023Open in IMG/M
3300017740|Ga0181418_1012467All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2296Open in IMG/M
3300017740|Ga0181418_1059790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P941Open in IMG/M
3300017743|Ga0181402_1156915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P575Open in IMG/M
3300017745|Ga0181427_1130163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P612Open in IMG/M
3300017750|Ga0181405_1071644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P893Open in IMG/M
3300017751|Ga0187219_1044361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1494Open in IMG/M
3300017763|Ga0181410_1120097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P752Open in IMG/M
3300017765|Ga0181413_1044449Not Available1382Open in IMG/M
3300017765|Ga0181413_1088200Not Available946Open in IMG/M
3300017767|Ga0181406_1034990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1570Open in IMG/M
3300017772|Ga0181430_1107017All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P829Open in IMG/M
3300017776|Ga0181394_1062648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1231Open in IMG/M
3300017776|Ga0181394_1113937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P856Open in IMG/M
3300017779|Ga0181395_1051197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1362Open in IMG/M
3300017781|Ga0181423_1105841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1099Open in IMG/M
3300017782|Ga0181380_1093791All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED1561045Open in IMG/M
3300017782|Ga0181380_1143531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P815Open in IMG/M
3300017782|Ga0181380_1240856Not Available601Open in IMG/M
3300017783|Ga0181379_1176041All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156755Open in IMG/M
3300017950|Ga0181607_10019601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5137Open in IMG/M
3300017950|Ga0181607_10023816All Organisms → cellular organisms → Bacteria4567Open in IMG/M
3300018036|Ga0181600_10009821All Organisms → Viruses7007Open in IMG/M
3300020055|Ga0181575_10705040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P513Open in IMG/M
3300020175|Ga0206124_10018141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3583Open in IMG/M
3300020191|Ga0181604_10051273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2417Open in IMG/M
3300020194|Ga0181597_10223060Not Available895Open in IMG/M
3300020365|Ga0211506_1072163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P976Open in IMG/M
3300020388|Ga0211678_10410262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P536Open in IMG/M
3300020404|Ga0211659_10117974All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1215Open in IMG/M
3300020414|Ga0211523_10405341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P551Open in IMG/M
3300020472|Ga0211579_10650137All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → unclassified Opitutales → Opitutales bacterium589Open in IMG/M
3300021347|Ga0213862_10031032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1961Open in IMG/M
3300021365|Ga0206123_10070434All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1738Open in IMG/M
3300021375|Ga0213869_10009624Not Available5842Open in IMG/M
3300021375|Ga0213869_10204605All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium888Open in IMG/M
3300021958|Ga0222718_10044007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2883Open in IMG/M
3300021958|Ga0222718_10106269All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1646Open in IMG/M
3300021958|Ga0222718_10292401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P849Open in IMG/M
3300021958|Ga0222718_10433812All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300021959|Ga0222716_10026860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4229Open in IMG/M
3300021959|Ga0222716_10059073All Organisms → Viruses → Predicted Viral2694Open in IMG/M
3300021959|Ga0222716_10205651Not Available1243Open in IMG/M
3300021959|Ga0222716_10373059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P837Open in IMG/M
3300021959|Ga0222716_10626975All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P582Open in IMG/M
3300021960|Ga0222715_10214532All Organisms → Viruses → Predicted Viral1142Open in IMG/M
3300022061|Ga0212023_1036821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P680Open in IMG/M
3300022065|Ga0212024_1079841Not Available582Open in IMG/M
3300022065|Ga0212024_1101645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P512Open in IMG/M
3300022068|Ga0212021_1051416All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P836Open in IMG/M
3300022071|Ga0212028_1026076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1047Open in IMG/M
3300022072|Ga0196889_1085957All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P582Open in IMG/M
3300022074|Ga0224906_1048010Not Available1379Open in IMG/M
3300022164|Ga0212022_1005713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1625Open in IMG/M
3300022164|Ga0212022_1051490All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes636Open in IMG/M
3300022169|Ga0196903_1007553All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1387Open in IMG/M
3300022178|Ga0196887_1030599All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1505Open in IMG/M
3300022183|Ga0196891_1020360All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300022198|Ga0196905_1003596All Organisms → Viruses5658Open in IMG/M
3300022198|Ga0196905_1052472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P1159Open in IMG/M
3300022198|Ga0196905_1171432Not Available552Open in IMG/M
3300022200|Ga0196901_1050979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P1545Open in IMG/M
3300024344|Ga0209992_10071164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1605Open in IMG/M
3300025070|Ga0208667_1004782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3771Open in IMG/M
3300025070|Ga0208667_1048084Not Available698Open in IMG/M
3300025083|Ga0208791_1014357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1751Open in IMG/M
3300025086|Ga0208157_1015836All Organisms → Viruses2378Open in IMG/M
3300025086|Ga0208157_1037708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1358Open in IMG/M
3300025086|Ga0208157_1044879Not Available1211Open in IMG/M
3300025086|Ga0208157_1142989Not Available533Open in IMG/M
3300025099|Ga0208669_1050201Not Available956Open in IMG/M
3300025099|Ga0208669_1102856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P594Open in IMG/M
3300025102|Ga0208666_1028398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1711Open in IMG/M
3300025102|Ga0208666_1036521All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1452Open in IMG/M
3300025102|Ga0208666_1114250All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P648Open in IMG/M
3300025120|Ga0209535_1041228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2062Open in IMG/M
3300025120|Ga0209535_1045534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth1917Open in IMG/M
3300025120|Ga0209535_1046748All Organisms → Viruses → Predicted Viral1880Open in IMG/M
3300025120|Ga0209535_1073295Not Available1332Open in IMG/M
3300025128|Ga0208919_1024848All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2212Open in IMG/M
3300025128|Ga0208919_1030010All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1973Open in IMG/M
3300025132|Ga0209232_1002198All Organisms → Viruses9799Open in IMG/M
3300025137|Ga0209336_10060480Not Available1147Open in IMG/M
3300025137|Ga0209336_10065184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P1092Open in IMG/M
3300025137|Ga0209336_10162579Not Available581Open in IMG/M
3300025137|Ga0209336_10185254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P523Open in IMG/M
3300025137|Ga0209336_10185464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P523Open in IMG/M
3300025138|Ga0209634_1033067Not Available2714Open in IMG/M
3300025151|Ga0209645_1028231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2081Open in IMG/M
3300025151|Ga0209645_1105652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium908Open in IMG/M
3300025168|Ga0209337_1024643All Organisms → Viruses3435Open in IMG/M
3300025168|Ga0209337_1049860All Organisms → Viruses2179Open in IMG/M
3300025168|Ga0209337_1057361All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1985Open in IMG/M
3300025168|Ga0209337_1250800All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P678Open in IMG/M
3300025508|Ga0208148_1016146All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2186Open in IMG/M
3300025508|Ga0208148_1026902All Organisms → Viruses → Predicted Viral1581Open in IMG/M
3300025508|Ga0208148_1027587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1555Open in IMG/M
3300025508|Ga0208148_1073216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281789Open in IMG/M
3300025508|Ga0208148_1107536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P592Open in IMG/M
3300025543|Ga0208303_1040015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1193Open in IMG/M
3300025543|Ga0208303_1092431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P652Open in IMG/M
3300025577|Ga0209304_1032050All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1532Open in IMG/M
3300025594|Ga0209094_1032663All Organisms → Viruses → Predicted Viral1490Open in IMG/M
3300025632|Ga0209194_1000541All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae29754Open in IMG/M
3300025645|Ga0208643_1020053All Organisms → Viruses2353Open in IMG/M
3300025645|Ga0208643_1127882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P666Open in IMG/M
3300025647|Ga0208160_1064284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P1012Open in IMG/M
3300025653|Ga0208428_1002170Not Available7997Open in IMG/M
3300025653|Ga0208428_1045827All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1343Open in IMG/M
3300025655|Ga0208795_1014118All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC100P2736Open in IMG/M
3300025674|Ga0208162_1042107Not Available1586Open in IMG/M
3300025687|Ga0208019_1047531Not Available1500Open in IMG/M
3300025687|Ga0208019_1118792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes786Open in IMG/M
3300025751|Ga0208150_1218856Not Available583Open in IMG/M
3300025759|Ga0208899_1012017Not Available4734Open in IMG/M
3300025759|Ga0208899_1036474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2242Open in IMG/M
3300025759|Ga0208899_1086183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1210Open in IMG/M
3300025759|Ga0208899_1223827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P579Open in IMG/M
3300025769|Ga0208767_1073183All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1475Open in IMG/M
3300025769|Ga0208767_1210841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P643Open in IMG/M
3300025771|Ga0208427_1202140Not Available631Open in IMG/M
3300025803|Ga0208425_1094666All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes701Open in IMG/M
3300025806|Ga0208545_1024562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2003Open in IMG/M
3300025806|Ga0208545_1145551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P571Open in IMG/M
3300025810|Ga0208543_1079249All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)793Open in IMG/M
3300025816|Ga0209193_1053272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1114Open in IMG/M
3300025828|Ga0208547_1062274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1247Open in IMG/M
3300025840|Ga0208917_1210570Not Available643Open in IMG/M
3300025853|Ga0208645_1086972All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1336Open in IMG/M
3300025874|Ga0209533_1070064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1899Open in IMG/M
3300025887|Ga0208544_10136251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1067Open in IMG/M
3300025889|Ga0208644_1095570All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1477Open in IMG/M
3300025889|Ga0208644_1271165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P690Open in IMG/M
3300025890|Ga0209631_10141405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1312Open in IMG/M
3300025892|Ga0209630_10118362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1394Open in IMG/M
3300025894|Ga0209335_10145640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1157Open in IMG/M
3300027859|Ga0209503_10274726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P818Open in IMG/M
3300028022|Ga0256382_1041574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1054Open in IMG/M
3300029309|Ga0183683_1003010All Organisms → Viruses5986Open in IMG/M
3300029318|Ga0185543_1085551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P624Open in IMG/M
3300029319|Ga0183748_1017556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2645Open in IMG/M
3300029319|Ga0183748_1071615Not Available888Open in IMG/M
3300029787|Ga0183757_1002766All Organisms → Viruses6737Open in IMG/M
3300029787|Ga0183757_1006387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3784Open in IMG/M
3300031565|Ga0307379_10074081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P3786Open in IMG/M
3300032073|Ga0315315_10274325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1572Open in IMG/M
3300032073|Ga0315315_11387489All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P614Open in IMG/M
3300032088|Ga0315321_10851523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P513Open in IMG/M
3300032277|Ga0316202_10031867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2531Open in IMG/M
3300032277|Ga0316202_10179682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P982Open in IMG/M
3300034375|Ga0348336_030277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2566Open in IMG/M
3300034418|Ga0348337_077630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC035P1175Open in IMG/M
3300034418|Ga0348337_133472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P735Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous34.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.47%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine9.12%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.12%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.09%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.46%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.14%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.89%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.57%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.26%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.26%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.94%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.94%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.94%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.63%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.63%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.31%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.31%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.31%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2019105005Marine microbial communities from Pulau Tioman, MalaysiaEnvironmentalOpen in IMG/M
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300013195Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station7_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020191Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020194Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020365Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025594Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025653Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025771Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025874Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MgKW_187602019105005MarineMKAKDYKSITELLEKKYKKKFYLFQDFEDIINRIKQRKDKQ
DelMOSum2010_1007278573300000101MarineITEILEKKYQCKFYLFMDLKDCENRIKQKRKDQQ*
DelMOSum2010_1012532033300000101MarineMKAKNYKSITEILEKKYKKKFYLFMDLEDCMNXIKQKRKD*
DelMOSum2010_1026465213300000101MarineITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQQ*
DelMOSum2011_1013322023300000115MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKD*
DelMOSum2011_1015797533300000115MarineMKAKNYKSIIEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ*
DelMOSum2011_1018726833300000115MarineMKAKDYKSITEILEKKYKKKFYLFMDLKDCMNRIKKQKARNK*
DelMOSum2011_1018960413300000115MarineMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR*
DelMOSum2011_1019768713300000115MarineMKAKNYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDR*
DelMOSum2011_1020952523300000115MarineMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
DelMOSum2011_1021960623300000115MarineMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQQ*
DelMOSum2011_1022714813300000115MarineMKAKDYKSITKILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ*
DelMOSpr2010_1004357533300000116MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDL*
DelMOSpr2010_1009666583300000116MarineSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ*
DelMOSpr2010_1012129033300000116MarineMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIK
DelMOSpr2010_1012341733300000116MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKD
DelMOSpr2010_1012650743300000116MarineMGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
DelMOSpr2010_1015512923300000116MarineMKAKNYKSITEILEKKYKKKFYLFMDFQDCMNRIKQRKEQ*
DelMOSpr2010_1016862223300000116MarineMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
DelMOSpr2010_1017167523300000116MarineMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ*
DelMOSpr2010_1017542533300000116MarineMKAKNYKSITEILEKKYKKKFYLFMDLEDCMNKIKQKRKD*
DelMOSpr2010_1020691433300000116MarineMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRK
DelMOSpr2010_1021947513300000116MarineYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
DelMOSpr2010_1023856233300000116MarineKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ*
DelMOWin2010_1005473143300000117MarineMKAKDYKSITEILTKKYQCKFFLFMDLEDCMNRIKQKRKVK*
DelMOWin2010_1007448133300000117MarineMKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDR*
DelMOWin2010_1007652753300000117MarineMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ*
DelMOWin2010_1014314013300000117MarineMKAKDYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKR
DelMOWin2010_1019509213300000117MarineMKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKR
DelMOWin2010_1022174213300000117MarineKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR*
JGI20158J14315_10023430103300001355Pelagic MarineMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDK*
JGI24006J15134_1001818163300001450MarineMGGSIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR*
JGI24006J15134_1009242213300001450MarineMKAKNYKSITEILEKKYKKKFYLFQDFEDCMNRIKQKRKDQQ*
JGI24003J15210_1003479613300001460MarineMKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ*
JGI24003J15210_1009380933300001460MarineMKAKDYKSITEILTKKYQCKFYLFMDFKDCENKIKQKRKDR*
JGI24004J15324_1002682713300001472MarineMKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRNNQQ*
JGI24004J15324_1004011973300001472MarineMKAKNYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRRVK*
JGI24004J15324_1009193423300001472MarineMKAKDYKSITEILTKKYQCKFYLFMDFKDCENRIKQKRKDR*
JGI24004J15324_1010508733300001472MarineSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKNQQ*
JGI24004J15324_1011321933300001472MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDR*
JGI24004J15324_1012808023300001472MarineMKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKREDQ*
JGI24004J15324_1013924613300001472MarineMKAKNYKSITEILEKKYKKKFYLFMDLEDCINRIKQKRKEQQ*
JGI24005J15628_1008898333300001589MarineMGGSIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
JGI24005J15628_1009644223300001589MarineMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDQ*
JGI24005J15628_1010226213300001589MarineMKAKDYKSITEILEKKYQCKFYLFMDLKDCENRIKQKRKDQ*
JGI25132J35274_112365923300002483MarineMKAKDYKSITEILEKKYQCKFYLWMDFKDVSDRIKQKVRNNDNTR*
JGI25128J35275_1001189103300002488MarineMKAKNYKSITEILNKKYKKKXYLFMDLEDCMNRIKQKRKEQ*
Ga0075474_1003632043300006025AqueousMKAKNYKSITEILTKKYQCEFYLFMDLEDCENRIKQKRKDR*
Ga0075478_1004023453300006026AqueousMKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDRQ*
Ga0075478_1007385753300006026AqueousMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKR
Ga0075478_1008118533300006026AqueousMKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDLQ*
Ga0075478_1021543213300006026AqueousKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ*
Ga0075462_1006703743300006027AqueousMKAKDYKSITEILEKKYKKKFYLFMDIKDCMNRIKQKRKDQ*
Ga0075462_1016438633300006027AqueousYKSITEILEKKYKKKFYLFMDLEDCMNKIKQKRKD*
Ga0075466_106014123300006029AqueousMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR*
Ga0075466_110937113300006029AqueousKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDR*
Ga0075466_111324343300006029AqueousITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ*
Ga0098038_101515573300006735MarineMKAKDYKSITKLLEKKYKKKFYLFQDFEDIMNRIKQKRKDQ*
Ga0098038_101734553300006735MarineMKAKDYKSITEILTKKYQCKFYLFMDLRDCENRIKQKRKDQ*
Ga0098038_103515263300006735MarineMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK*
Ga0098038_103861023300006735MarineMKAKDYKSITEILEKKYKKKFYLFMDLKDCENRIKKQKSRNNGK*
Ga0098038_105244643300006735MarineMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ*
Ga0098038_114045833300006735MarineMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR*
Ga0098038_119184513300006735MarineMKAKNYKSITEILNKKYKKKFYLFMDLEDCMNRIKQKRKDQ*
Ga0098037_104129043300006737MarineMKAKNYKSITEILTKKYKKKFYLFMDLEDCMNRIKQKRKDQQ*
Ga0098037_114188513300006737MarineMKAKDYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRKDK*
Ga0098037_114679043300006737MarineMKAKDYKSITEILEKKYKKKFYLFMDLKDCENRIKKQKARK*
Ga0098037_115816533300006737MarineMKAKDYKSITEILEKKYKKKFYLFQDFEDCINRIKQKRKEQ*
Ga0098037_118921213300006737MarineMKAKNYKSITEILEKKYQCKFYLFMDLKDCENRIKQKRKVK*
Ga0098042_115177423300006749MarineMKSKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKR
Ga0098042_115318433300006749MarineMKAKDYKSITELLEKKYKKKFYLFQDFEDVINRIKQKRKEQ*
Ga0070749_1007894413300006802AqueousMKAKNYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ*
Ga0070749_1024160443300006802AqueousMKAKNYKSIIEILEKKYKKKFYLFMDIQDCMNRIKQRKEQ*
Ga0070749_1024698633300006802AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQNCMNRIKQKKSEGNNE*
Ga0070749_1039782333300006802AqueousNRKVNMKAKNYKSITEILEKKYKKKFYLFMDLEDCMNKIKQKRKD*
Ga0070749_1041778113300006802AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKEQ*
Ga0070749_1060886223300006802AqueousMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
Ga0070749_1062883333300006802AqueousNMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKVK*
Ga0070749_1062883533300006802AqueousNMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDL*
Ga0070749_1073321333300006802AqueousMKAKNYKSITEILEKKYKKKFYLFMDIQDCMNRIKQRKEQ*
Ga0075467_1010516913300006803AqueousMGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNR
Ga0075467_1044035133300006803AqueousSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
Ga0070754_1040460633300006810AqueousENMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKEQ*
Ga0070754_1044171613300006810AqueousKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ*
Ga0070754_1049287013300006810AqueousYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ*
Ga0070754_1052644723300006810AqueousMKAKDYKSITEILTKKYQCKFYLFMDIEDCMNRIKQKRKDQ
Ga0075481_1019248233300006868AqueousMGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR*
Ga0075481_1033439123300006868AqueousMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
Ga0075477_1006372213300006869AqueousKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ*
Ga0075477_1034126713300006869AqueousKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ*
Ga0070750_1016619733300006916AqueousMKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK*
Ga0070750_1021354423300006916AqueousMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDR*
Ga0070750_1022907713300006916AqueousYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ*
Ga0070746_1054634223300006919AqueousMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDR*
Ga0070748_112081533300006920AqueousVFIDIIRKETIMKAKNYKSITEILEKKYQCKYYLFMDFEDCMNRIKQKRKDQ*
Ga0070748_131598713300006920AqueousNMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKVK*
Ga0070748_133751213300006920AqueousIIMKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKDQ*
Ga0098060_103903243300006921MarineMKSKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK*
Ga0098060_105082823300006921MarineMKAKDYKSITEILNKKYKKKFYLFMDLEDCMNRIKQKRKDQ*
Ga0098060_116714833300006921MarineMKAKNYKSITEILTKKYKKKFYLFQDFEDIMNRIKQKRKDQ*
Ga0098045_115361523300006922MarineMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
Ga0098036_112074923300006929MarineMKAKNYKSITEILTKKYKKKFYLFMDLEDCMNRIKQKRKDQQ*QV*
Ga0098046_101790523300006990MarineMKAKDYKSITEILEKKYKKKFYLFQDFEDCINRIKQKRKVK*
Ga0098046_104466313300006990MarineKMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK*
Ga0075468_1009953413300007229AqueousMKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKR
Ga0075468_1014674533300007229AqueousMKAKNYKSITEILEKKYQCKFFLFMDLEDCMNRIKQKRKDQ*
Ga0075463_1004364413300007236AqueousVFIDIIRKETIMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKD
Ga0075463_1010508533300007236AqueousMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKD
Ga0070747_123276343300007276AqueousKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
Ga0070747_127789223300007276AqueousMKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDR*
Ga0070745_122844933300007344AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRK
Ga0070752_122979123300007345AqueousMKAKNYKSITEILTKKYQCKFYLFMDIEDCMNRIKQKRKDQQ*
Ga0070752_130240533300007345AqueousMKAKNYKSIIEILEKKYKKKFYLIMDIQDCMNRIKQRKEQ*
Ga0070753_116101133300007346AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQR
Ga0099851_102127873300007538AqueousMKAKNYKSITEILEKKYKKKFYLFMDFQDCMNRIKQRKSEE*
Ga0099851_125326013300007538AqueousKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ*
Ga0099849_137811213300007539AqueousNMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ*
Ga0099848_104990553300007541AqueousMKVKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ*
Ga0099846_102126153300007542AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKSEE*
Ga0070751_109177553300007640AqueousMKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRK
Ga0070751_112095533300007640AqueousVFIDIIRKETIMKAKNYKSIIEILEKKYQCKFYLFMDLKDCENRIKQKRKDQ*
Ga0099850_112752933300007960AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKKSEGNNE*
Ga0075480_1007312713300008012AqueousMKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDQQ*
Ga0075480_1027441033300008012AqueousMKAKNYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ*
Ga0075480_1031111643300008012AqueousMKAKDYKSITKILTKKYQCKFYLFMDLEDCMNRIKQKR
Ga0075480_1057520823300008012AqueousMGGSIIKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR*
Ga0115549_102592673300009074Pelagic MarineMKAKDYKSITEILTKKYKKKFYLFMDLKDCMNRIKKQKARE*
Ga0115548_117208133300009423Pelagic MarineMKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKD
Ga0115546_114040813300009435Pelagic MarineNMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDQ*
Ga0115546_114498723300009435Pelagic MarineMKAKDYKSITEILTKKYKKKFYLFMDLKDCMDRIKKQKARE*
Ga0115008_1080958033300009436MarineMKAKDYKSITEILEKKYKKKFYLFMDLKDCENRIKKQKARNK*
Ga0115558_127662333300009449Pelagic MarineMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQQ*
Ga0115555_130783033300009476Pelagic MarineLIGVKIIINKRKDHTMKAKNYKSITEVLDKKYNKGIVNKKDKINFYLFMDLEDCMNRIKQKRKDQ*
Ga0114932_1031460623300009481Deep SubsurfaceMKAKDYKSITEILEKKYQCKFYLFMDFKDVSDRIKQKQKEKARVNND*
Ga0115569_1028972613300009497Pelagic MarineIMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDK*
Ga0115564_1026637623300009505Pelagic MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKDQQ*
Ga0115567_1031514743300009508Pelagic MarineMKAKNYKSITEILEKKYQCKFFLFMDLEDCMNRIKQKRKDK*
Ga0098043_103944113300010148MarineMKAKDYKSITEILEKKYQCKSYLWMDFKDVSDKIKQKVRNND
Ga0098059_102005763300010153MarineMKAKDYKSITEILEKKYKKKFYLFQDFEDIMNRIKQKRKDQ*
Ga0098059_105123133300010153MarineMKAKNYKSITEILEKKYQCKFYLLMNHEDCMKKIKKKRKDQ*
Ga0098059_109331613300010153MarineMLNRKDHTMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR*
Ga0129348_120947923300010296Freshwater To Marine Saline GradientMKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ*
Ga0129342_107311023300010299Freshwater To Marine Saline GradientMKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ*
Ga0136655_103728823300010316Freshwater To Marine Saline GradientMKAKNYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDR*
Ga0129324_1043624723300010368Freshwater To Marine Saline GradientMGGSIMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ*
Ga0151671_102247413300011253MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRK
Ga0160423_1006246043300012920Surface SeawaterMKAKDYKSITELLEKKYKKKFYLFQDFEDVINRIKQKESEE*
Ga0160423_1012630923300012920Surface SeawaterMKAKNYKSITELLEKKYKKKFYLFQDFEDIINIIKQKRKDQ*
Ga0160423_1066419223300012920Surface SeawaterMKAKNYKSITELLEKKYKKKFYLFQDFEDIMNRINQKKKGK*
Ga0116815_103714123300013195MarineMKAKDYKSITELLEKKYKKKFYLFQDFEDIINRIKQKESEE*
Ga0181377_102796143300017706MarineMLNRKDHTMKAKDYKSITEILTKKYKKKFYLFQDFEDVINRIKQKRKDQQ
Ga0181377_102873943300017706MarineMKAKDYKSITEILEKKYQCKFYLFMDLKDCENRIKQKRKDQ
Ga0181369_100799743300017708MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK
Ga0181369_107193123300017708MarineMKAKDYKSITELLEKKYKKKFYLFQDFEDIMNRIKQKRKDQ
Ga0181403_105950933300017710SeawaterMKAKDYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKDQ
Ga0181391_113509733300017713SeawaterMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQSGIDDSIS
Ga0181412_102978133300017714SeawaterMKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKDQ
Ga0181383_107616723300017720SeawaterMKAKKYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ
Ga0181383_116103513300017720SeawaterMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQKXQI
Ga0181373_101309913300017721MarineKIIIKAKNNKTNTEILTKKYQCKIYLFMDLEDCMNRIKQKRKETI
Ga0181373_103509343300017721MarineMKAKDYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRKD
Ga0181398_101213253300017725SeawaterMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKIKNR
Ga0181396_100934453300017729SeawaterMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKIKNR
Ga0187222_106124743300017734SeawaterMKAKKYKSITEILTKKYQCKFYLFMDLKDCENRIKQ
Ga0181428_100499063300017738SeawaterMKAKDYKSITEILKKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0181418_101246733300017740SeawaterMKAKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKER
Ga0181418_105979043300017740SeawaterMKAKNYKSITEILTKKYQCKFYLFMDLEDCINRIKQKRK
Ga0181402_115691513300017743SeawaterKDYKSITEILEKKYQCKFYLFMDLEDCENRIKQKRKDQ
Ga0181427_113016333300017745SeawaterMKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ
Ga0181405_107164423300017750SeawaterMKAKNYKSITEILEKKYQCKFYLFMDLEDCENRIKQKRKER
Ga0187219_104436153300017751SeawaterMKAKKYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKR
Ga0181410_112009733300017763SeawaterMKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKD
Ga0181413_104444933300017765SeawaterMKAKNYKSITEILEKKYKKKFYLFMDLEDCENRIKQKRKER
Ga0181413_108820023300017765SeawaterMKAKEYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKDQ
Ga0181406_103499033300017767SeawaterMKAKKYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0181430_110701733300017772SeawaterMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQXQV
Ga0181394_106264813300017776SeawaterMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKIKNR
Ga0181394_111393723300017776SeawaterMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKKKRKDQ
Ga0181395_105119733300017779SeawaterMKAKDYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDR
Ga0181423_110584123300017781SeawaterMKAKDYKSITEILEKKYQCKFYLFMDLEDCINRIKQKRKDQ
Ga0181380_109379123300017782SeawaterMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ
Ga0181380_114353143300017782SeawaterKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKER
Ga0181380_124085623300017782SeawaterMKAKKYKSITEILTKKYQCKFYLFMDLEDCINRIKQK
Ga0181379_117604123300017783SeawaterMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQXQI
Ga0181607_1001960173300017950Salt MarshMSLLNRKDHKMKAKDYKSITEILTKKYQCKFYSFMDLKDCENRIKQKRKDRQ
Ga0181607_1002381683300017950Salt MarshMKAKNYKSITEILKKKYKKKFYLFMDIQDCMNRIKQRKDQ
Ga0181600_1000982163300018036Salt MarshMKAKDYKSITEILTKKYQCKFYSFMDLKDCENRIKQKRKDRQ
Ga0181575_1070504013300020055Salt MarshMKAKNYKSITELLEKKYKTKFYLFMDFEDVINRIKKRKGV
Ga0206124_1001814153300020175SeawaterMKAKDYKSITEILEKKYKKKFYLFMDLKDCMNRIKKQKASK
Ga0181604_1005127333300020191Salt MarshMKAKDYKSITEILTKKYQCKFYSFMDLKDCENRIKQKRKDRQXQV
Ga0181597_1022306013300020194Salt MarshAKNYKSITEILKKKYKKKFYLFMDIQDCMNRIKQRKDQ
Ga0211506_107216343300020365MarineMKAKDYKSITELLEKKYKKKFYLFQDFEDIMNRIKQKESEE
Ga0211678_1041026213300020388MarineMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQXQV
Ga0211659_1011797423300020404MarineMKAKDYKSITEILEKKYQCKFYLWMDFKDVSDKIKQKVRNNDNTR
Ga0211523_1040534123300020414MarineMKAKDYKSITELLEKKYKKKFYLFQDFEDIINRIKQKESEE
Ga0211579_1065013723300020472MarineMKAKDYKSITEILEKKYQCKFYLFMDFKDVSDRIKQKQKESEGV
Ga0213862_1003103233300021347SeawaterMKAKDYKSITELLEKKYKKKFYLFQDFEDIINRIKQKERNNNNE
Ga0213858_1014617523300021356SeawaterMKAKNYKSITELLEKKYKKKFYLFQDFEDVINRIKKRKGV
Ga0206123_1007043413300021365SeawaterMKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ
Ga0213869_1000962443300021375SeawaterMKAKNYKSITEILEKKYQCKFYLFMDLKDCENRIKQKRKDQ
Ga0213869_1020460543300021375SeawaterMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQ
Ga0222718_1004400743300021958Estuarine WaterMSLLNRKDHKMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDR
Ga0222718_1010626913300021958Estuarine WaterKDHTMKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK
Ga0222718_1029240113300021958Estuarine WaterMKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQK
Ga0222718_1043381233300021958Estuarine WaterMKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKV
Ga0222716_1002686073300021959Estuarine WaterMKAKNYKSITEILEKKYKIKFYLFMDFSDCLNRINQKRKEQNEK
Ga0222716_1005907353300021959Estuarine WaterMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKEQ
Ga0222716_1020565113300021959Estuarine WaterMKAKEYKSITKILEKKYKKKFYLFQDFEDVKNRIKGVK
Ga0222716_1037305933300021959Estuarine WaterMIIKNKDYKSITEILEKKYKIKFYLFMDIQDCMNRIKQRKVGK
Ga0222716_1062697533300021959Estuarine WaterMNMLSRKDHTMKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK
Ga0222715_1021453213300021960Estuarine WaterMKAKDYKSITEILTKKYQCKFYSFMDLKDCENRIKQK
Ga0212023_103682123300022061AqueousMKAKNYKSITEILEKKYQCKFFLFMDLEDCMNRIKQKRKDQ
Ga0212024_107984113300022065AqueousMKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK
Ga0212024_110164533300022065AqueousTIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0212021_105141613300022068AqueousKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0212028_102607643300022071AqueousMKAKNYKSITEILTKKYQCEFYLFMDLEDCENRIKQKRKDR
Ga0196889_108595733300022072AqueousGVNMKAKNYKSITEILTKKYQCEFYLFMDLEDCENRIKQKRKDR
Ga0224906_104801023300022074SeawaterMKAKNYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKDQ
Ga0212022_100571343300022164AqueousMKAKNYKSITEILEKKYQCKFFLFMDLEDCMNRIKQKRKDQQXQV
Ga0212022_105149023300022164AqueousVFIDIIRKETIMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0196903_100755323300022169AqueousMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0196887_103059923300022178AqueousMGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0196891_102036033300022183AqueousMKAKDYKSITEILEKKYKKKFYLFMDIKDCMNRIKQKRKDQ
Ga0196905_100359643300022198AqueousMKVKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ
Ga0196905_105247263300022198AqueousKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKSEE
Ga0196905_117143213300022198AqueousKENMKAKNYKSITKILEKKYKKKFYLFMDLQDCMNRIKQRKDQ
Ga0196901_105097953300022200AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKSEE
Ga0209992_1007116473300024344Deep SubsurfaceMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQQ
Ga0208667_100478283300025070MarineMKAKDYKSITEILTKKYQCKFYLFMDLRDCENRIKQKRKDQ
Ga0208667_104808423300025070MarineMKAKDYKSITEILEKKYKKKFYLFMDLKDCENRIKKQKSRNNGK
Ga0208791_101435753300025083MarineMKAKDYKSITEILTKKYQCKFYLFMDLRDCENRIK
Ga0208157_101583613300025086MarineMKAKNYKSITEILNKKYKKKFYLFMDLEDCMNRIKQKRKDQ
Ga0208157_103770853300025086MarineMLNRKDHTMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0208157_104487933300025086MarineMKAKNYKSITEILTKKYKKKFYLFMDLEDCMNRIKQKRKDQQXQV
Ga0208157_114298923300025086MarineMKAKDYKSITKLLEKKYKKKFYLFQDFEDIMNRIKQKRKDQ
Ga0208669_105020123300025099MarineMKAKNYKSITEILTKKYKKKFYLFMDLEDCMNRIKQKRKDQQ
Ga0208669_110285623300025099MarineMKAKDYKSITEILEKKYKKKFYLFQDFEDCINRIKQKRKEQ
Ga0208666_102839823300025102MarineMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKVK
Ga0208666_103652143300025102MarineMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQ
Ga0208666_111425023300025102MarineMKAKNYKSITEILEKKYQCKFYLFMDLEDCKNRIKQKRKDQQXQV
Ga0209535_104122833300025120MarineMKAKNYKSITEILTKKYQCKFYLFMDFKDCENKIKQKRKDR
Ga0209535_104553413300025120MarineMKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQQXQ
Ga0209535_104674853300025120MarineMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIK
Ga0209535_107329533300025120MarineMKAKNYKSITEMLTKKYQCKFYLFMDLEDCENRIK
Ga0208919_102484863300025128MarineMKAKNYKSITELLEKKYKKKFYLFQDFEDVINRIKQKKKGK
Ga0208919_103001063300025128MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0209232_100219843300025132MarineMKAKNYKSITEILNKKYKKKFYLFMDLEDCMNRIKQKRKEQ
Ga0209336_1006048033300025137MarineMKAKNYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDQ
Ga0209336_1006518453300025137MarineMKAKDYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRRVK
Ga0209336_1016257933300025137MarineMKAKNYKSITEILEKKYKKKFYLFMDLEDCINRIKQKRKEQQXQI
Ga0209336_1018525423300025137MarineMKAKDYKSITEILEKKYKKKFYLFMDLKDCMNRIKQKRKDK
Ga0209336_1018546433300025137MarineMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0209634_103306743300025138MarineMKAKNYKSITEILEKKYKKKFYLFQDFEDCMNRIKQKRKDQQ
Ga0209645_102823123300025151MarineMKAKDYKSITEILEKKYQCKFYLWMDFKDVSDRIKQKVRNNDNTR
Ga0209645_110565223300025151MarineMKAKNYKSITELLEKKYKKKFYLFQDFEDVINRIKQKESEE
Ga0209337_102464363300025168MarineMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0209337_104986013300025168MarineMKAKNYKSITEILEKKYKKKFYLFQDFEDCMNRIKQKRKDQQXQV
Ga0209337_105736123300025168MarineMKAKNYKSITEILEKKYQCKFYLFMDLRDCENRIKQKRRVK
Ga0209337_125080043300025168MarineKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0208148_101614663300025508AqueousMKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQXQV
Ga0208148_102690213300025508AqueousMKAKNYKSITEILEKKYKKKFYLFMDLEDCMNKIKQKRKD
Ga0208148_102758793300025508AqueousMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKVK
Ga0208148_107321613300025508AqueousKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ
Ga0208148_110753623300025508AqueousMGGSIMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0208303_104001533300025543AqueousMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0208303_109243113300025543AqueousMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKR
Ga0209304_103205013300025577Pelagic MarineMKAKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKDQQ
Ga0209094_103266343300025594Pelagic MarineMKAKDYKSITEILTKKYKKKFYLFMDLKDCMNRIKKQKARE
Ga0209194_100054113300025632Pelagic MarineMKAKDYKSITEILTKKYKKKFYLFMDLKDCMDRIKK
Ga0208643_102005373300025645AqueousMKAKDYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ
Ga0208643_112788213300025645AqueousKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDR
Ga0208160_106428413300025647AqueousKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKSEE
Ga0208428_100217093300025653AqueousMKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDR
Ga0208428_104582733300025653AqueousVFIDIIRKETIMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0208795_101411853300025655AqueousMKAKNYKSITEILEKKYKKKFYLFMDFQDCMNRIKQRKSEE
Ga0208162_104210713300025674AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ
Ga0208019_104753153300025687AqueousMKAKNYKSITEILEKKYKKKFYLFMDFQDCMNRIKQRK
Ga0208019_111879233300025687AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKKSEGNNE
Ga0208150_121885633300025751AqueousFERKKAKNYKSIIEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ
Ga0208899_101201723300025759AqueousMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDL
Ga0208899_103647443300025759AqueousMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKVK
Ga0208899_108618343300025759AqueousMKAKDYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQQXQV
Ga0208899_122382723300025759AqueousMKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIKQKRKDR
Ga0208767_107318333300025769AqueousMKAKNYKSIIEILEKKYKKKFYLFMDIQDCMNRIKQRKEQ
Ga0208767_121084113300025769AqueousGTIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0208427_120214013300025771AqueousNMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQKRKDQ
Ga0208425_109466643300025803AqueousVNMKAKNYKSITEILTKKYQCKFYLFMDLEDCENRIKQKRKDR
Ga0208545_102456253300025806AqueousMKAKDYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0208545_114555113300025806AqueousKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQ
Ga0208543_107924933300025810AqueousMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKD
Ga0209193_105327223300025816Pelagic MarineMKAKNYKSITEILEKKYQCKFYLFMDFEDCMNRIKQKRKDQQ
Ga0208547_106227413300025828AqueousAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ
Ga0208917_121057033300025840AqueousSFERKKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ
Ga0208645_108697243300025853AqueousMGGSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0209533_107006423300025874Pelagic MarineMKAKDYKSITEILEKKYQCKFYLFMDLKDCMNRIKQKRKDQQ
Ga0208544_1013625113300025887AqueousSIMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0208644_109557053300025889AqueousMKAKNYKSIIEILEKKYQCKFYLFMDLEDCMNRIKQKRKDQ
Ga0208644_127116543300025889AqueousMKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQ
Ga0209631_1014140543300025890Pelagic MarineMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDK
Ga0209630_1011836253300025892Pelagic MarineMKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQK
Ga0209335_1014564063300025894Pelagic MarineTIMKAKNYKSITEILTKKYQCKFYLFMDLKDCMNRIKQKRKDK
Ga0209503_1027472633300027859MarineMKAKNYKSITEILTKKYQCKFYLFMDLKDCENRIKQKRKDQQXIDMNNM
Ga0256382_104157413300028022SeawaterMKAKDYKSITEILEKKYKKKFYLFQDFEDIINRIKQKESEE
Ga0183683_1003010123300029309MarineMKAKKYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ
Ga0185543_108555113300029318MarineMKAKDYKSITEILEKKYKKKFYLFQDFEDIMNRIKQKESEE
Ga0183748_101755663300029319MarineMKAKDYTSITEILEKKYQCKFYSWMTYKEVFDRIKQKEKARKNDNTR
Ga0183748_107161513300029319MarineMKAKNYKSITEILEKKYKKKFYLFQDFEDVINKIKRKGV
Ga0183757_100276683300029787MarineMKAKDYKSITKILEKKYKKKFYLFQDFEDVINRIKKIKGVRYDNTRKN
Ga0183757_100638763300029787MarineMKAKNYKSITEILKKKYMKKTCKPSCLYKWDVKEFYLFMDLEDCMNRIKQKRKDQ
Ga0307379_1007408133300031565SoilMKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKDQ
Ga0315315_1027432523300032073SeawaterMKAKNYKSITEILTKKYQCKFYLFMDLEDCMNRIKQKRKDQQ
Ga0315315_1138748913300032073SeawaterMKAKDYKSITEILEKKYKKKFYLFMDLEDCMNRIK
Ga0315321_1085152323300032088SeawaterMKAKDYKSITEILEKKYKKKFYLFQDFEDVINRIKQKRKVK
Ga0316202_1003186743300032277Microbial MatMKAKNYKSITEILTKKYQCKFYLFMDFEDCMNRIKQKRKDQQXQV
Ga0316202_1017968243300032277Microbial MatMKAKDYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRK
Ga0348336_030277_1369_15093300034375AqueousMGGSIMKAKNYKSITEILEKKYQCKFYLFMDLEDCMNRIKQKRKDR
Ga0348337_077630_2_1093300034418AqueousMKAKDYKSITEILEKKYKKKFYLFMDLQDCMNRIKQ
Ga0348337_133472_619_7353300034418AqueousMKAKNYKSITEILEKKYKKKFYLFMDLQDCMNRIKQRKD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.