Basic Information | |
---|---|
Family ID | F009499 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 317 |
Average Sequence Length | 45 residues |
Representative Sequence | MDEDDRPPICPRCGVTMVPAALSADDKHEGDWVCLECEELDEDE |
Number of Associated Samples | 202 |
Number of Associated Scaffolds | 317 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 45.43 % |
% of genes near scaffold ends (potentially truncated) | 27.13 % |
% of genes from short scaffolds (< 2000 bps) | 81.39 % |
Associated GOLD sequencing projects | 178 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.495 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.202 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.606 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.057 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 8.33% Coil/Unstructured: 76.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 317 Family Scaffolds |
---|---|---|
PF13302 | Acetyltransf_3 | 8.52 |
PF14333 | DUF4389 | 4.73 |
PF07883 | Cupin_2 | 3.15 |
PF01042 | Ribonuc_L-PSP | 2.84 |
PF07690 | MFS_1 | 1.89 |
PF01872 | RibD_C | 1.58 |
PF13474 | SnoaL_3 | 1.58 |
PF13669 | Glyoxalase_4 | 1.58 |
PF07676 | PD40 | 1.58 |
PF03471 | CorC_HlyC | 1.26 |
PF00144 | Beta-lactamase | 1.26 |
PF12671 | Amidase_6 | 1.26 |
PF13527 | Acetyltransf_9 | 1.26 |
PF03795 | YCII | 0.95 |
PF03575 | Peptidase_S51 | 0.95 |
PF03704 | BTAD | 0.95 |
PF08281 | Sigma70_r4_2 | 0.95 |
PF14534 | DUF4440 | 0.95 |
PF00072 | Response_reg | 0.95 |
PF00583 | Acetyltransf_1 | 0.95 |
PF08044 | DUF1707 | 0.95 |
PF01243 | Putative_PNPOx | 0.95 |
PF03060 | NMO | 0.95 |
PF06224 | HTH_42 | 0.63 |
PF02771 | Acyl-CoA_dh_N | 0.63 |
PF03861 | ANTAR | 0.63 |
PF00171 | Aldedh | 0.63 |
PF04542 | Sigma70_r2 | 0.63 |
PF13714 | PEP_mutase | 0.63 |
PF00903 | Glyoxalase | 0.63 |
PF00486 | Trans_reg_C | 0.63 |
PF01842 | ACT | 0.63 |
PF12728 | HTH_17 | 0.63 |
PF09413 | DUF2007 | 0.63 |
PF13508 | Acetyltransf_7 | 0.63 |
PF07366 | SnoaL | 0.63 |
PF14520 | HHH_5 | 0.32 |
PF06210 | DUF1003 | 0.32 |
PF00149 | Metallophos | 0.32 |
PF03480 | DctP | 0.32 |
PF00578 | AhpC-TSA | 0.32 |
PF01722 | BolA | 0.32 |
PF08327 | AHSA1 | 0.32 |
PF00211 | Guanylate_cyc | 0.32 |
PF00005 | ABC_tran | 0.32 |
PF06348 | DUF1059 | 0.32 |
PF13416 | SBP_bac_8 | 0.32 |
PF14023 | DUF4239 | 0.32 |
PF01053 | Cys_Met_Meta_PP | 0.32 |
PF09723 | Zn-ribbon_8 | 0.32 |
PF12681 | Glyoxalase_2 | 0.32 |
PF09851 | SHOCT | 0.32 |
PF10502 | Peptidase_S26 | 0.32 |
PF00009 | GTP_EFTU | 0.32 |
PF14310 | Fn3-like | 0.32 |
PF00561 | Abhydrolase_1 | 0.32 |
PF00571 | CBS | 0.32 |
PF00353 | HemolysinCabind | 0.32 |
PF06267 | DUF1028 | 0.32 |
PF00027 | cNMP_binding | 0.32 |
PF02566 | OsmC | 0.32 |
PF08669 | GCV_T_C | 0.32 |
PF03176 | MMPL | 0.32 |
PF13671 | AAA_33 | 0.32 |
PF02776 | TPP_enzyme_N | 0.32 |
PF12773 | DZR | 0.32 |
PF00462 | Glutaredoxin | 0.32 |
PF13531 | SBP_bac_11 | 0.32 |
PF14537 | Cytochrom_c3_2 | 0.32 |
PF02899 | Phage_int_SAM_1 | 0.32 |
PF00300 | His_Phos_1 | 0.32 |
PF02609 | Exonuc_VII_S | 0.32 |
PF13191 | AAA_16 | 0.32 |
PF00231 | ATP-synt | 0.32 |
PF02909 | TetR_C_1 | 0.32 |
PF00293 | NUDIX | 0.32 |
PF13489 | Methyltransf_23 | 0.32 |
PF09423 | PhoD | 0.32 |
PF03167 | UDG | 0.32 |
PF06831 | H2TH | 0.32 |
PF02880 | PGM_PMM_III | 0.32 |
PF09335 | SNARE_assoc | 0.32 |
PF01883 | FeS_assembly_P | 0.32 |
PF00180 | Iso_dh | 0.32 |
PF08031 | BBE | 0.32 |
PF00528 | BPD_transp_1 | 0.32 |
PF13614 | AAA_31 | 0.32 |
PF03631 | Virul_fac_BrkB | 0.32 |
PF00166 | Cpn10 | 0.32 |
PF13424 | TPR_12 | 0.32 |
PF13649 | Methyltransf_25 | 0.32 |
PF00753 | Lactamase_B | 0.32 |
PF13480 | Acetyltransf_6 | 0.32 |
PF08240 | ADH_N | 0.32 |
PF01391 | Collagen | 0.32 |
PF08447 | PAS_3 | 0.32 |
PF13783 | DUF4177 | 0.32 |
PF14907 | NTP_transf_5 | 0.32 |
PF00034 | Cytochrom_C | 0.32 |
PF04228 | Zn_peptidase | 0.32 |
PF13207 | AAA_17 | 0.32 |
PF04229 | GrpB | 0.32 |
PF00266 | Aminotran_5 | 0.32 |
PF05175 | MTS | 0.32 |
PF05974 | DUF892 | 0.32 |
PF01551 | Peptidase_M23 | 0.32 |
PF00296 | Bac_luciferase | 0.32 |
PF01709 | Transcrip_reg | 0.32 |
PF01047 | MarR | 0.32 |
PF13419 | HAD_2 | 0.32 |
COG ID | Name | Functional Category | % Frequency in 317 Family Scaffolds |
---|---|---|---|
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.84 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.58 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.58 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.26 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.26 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.26 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.95 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.95 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.95 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.95 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.63 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.63 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.63 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.63 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.63 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.63 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.63 |
COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.63 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.63 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.63 |
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.32 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.32 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.32 |
COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0224 | FoF1-type ATP synthase, gamma subunit | Energy production and conversion [C] | 0.32 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.32 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.32 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.32 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.32 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.32 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.32 |
COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.32 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.32 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.32 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.32 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.32 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.32 |
COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.32 |
COG1722 | Exonuclease VII small subunit | Replication, recombination and repair [L] | 0.32 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.32 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.32 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.32 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.32 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.32 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.32 |
COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.32 |
COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.32 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.32 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.32 |
COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.32 |
COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.32 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.32 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.32 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.32 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.32 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.50 % |
Unclassified | root | N/A | 20.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559006|FI_contig09141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1063 | Open in IMG/M |
2199352025|deepsgr__Contig_81093 | Not Available | 923 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10011732 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10060474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 971 | Open in IMG/M |
3300001536|A1565W1_10286040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1769 | Open in IMG/M |
3300001686|C688J18823_10047275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2975 | Open in IMG/M |
3300001867|JGI12627J18819_10423384 | Not Available | 543 | Open in IMG/M |
3300002568|C688J35102_118712164 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300002568|C688J35102_120388021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1032 | Open in IMG/M |
3300002568|C688J35102_120967213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 3521 | Open in IMG/M |
3300002568|C688J35102_120974515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4039 | Open in IMG/M |
3300003267|soilL1_10191756 | Not Available | 1162 | Open in IMG/M |
3300003324|soilH2_10216630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1733 | Open in IMG/M |
3300004081|Ga0063454_100114793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1328 | Open in IMG/M |
3300004081|Ga0063454_100297366 | Not Available | 1007 | Open in IMG/M |
3300004114|Ga0062593_102306425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
3300004114|Ga0062593_103184491 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300004479|Ga0062595_100007057 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
3300004479|Ga0062595_100022808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2410 | Open in IMG/M |
3300004479|Ga0062595_100079294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1653 | Open in IMG/M |
3300004479|Ga0062595_100114369 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
3300004479|Ga0062595_100483454 | Not Available | 923 | Open in IMG/M |
3300004479|Ga0062595_100706774 | Not Available | 811 | Open in IMG/M |
3300004643|Ga0062591_100511449 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
3300004643|Ga0062591_101127280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
3300004643|Ga0062591_102025004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300005093|Ga0062594_100832825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 859 | Open in IMG/M |
3300005093|Ga0062594_101101816 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300005176|Ga0066679_10708961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga aerilata | 651 | Open in IMG/M |
3300005327|Ga0070658_10128621 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
3300005327|Ga0070658_10341322 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300005327|Ga0070658_11686256 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005329|Ga0070683_100053377 | All Organisms → cellular organisms → Bacteria | 3745 | Open in IMG/M |
3300005332|Ga0066388_100150383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2906 | Open in IMG/M |
3300005332|Ga0066388_101097225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
3300005332|Ga0066388_101628114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1138 | Open in IMG/M |
3300005332|Ga0066388_101743464 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300005336|Ga0070680_100699999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
3300005337|Ga0070682_100679915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 823 | Open in IMG/M |
3300005339|Ga0070660_101485048 | Not Available | 576 | Open in IMG/M |
3300005344|Ga0070661_100055227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2908 | Open in IMG/M |
3300005344|Ga0070661_100785502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 780 | Open in IMG/M |
3300005355|Ga0070671_100525724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1019 | Open in IMG/M |
3300005366|Ga0070659_101117307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 695 | Open in IMG/M |
3300005434|Ga0070709_10000689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19202 | Open in IMG/M |
3300005434|Ga0070709_10852984 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300005435|Ga0070714_100001543 | All Organisms → cellular organisms → Bacteria | 16791 | Open in IMG/M |
3300005435|Ga0070714_100116183 | All Organisms → cellular organisms → Bacteria | 2375 | Open in IMG/M |
3300005435|Ga0070714_100328001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1433 | Open in IMG/M |
3300005435|Ga0070714_100673584 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300005435|Ga0070714_101566822 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300005435|Ga0070714_102201245 | Not Available | 537 | Open in IMG/M |
3300005436|Ga0070713_100287586 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300005436|Ga0070713_101724690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
3300005436|Ga0070713_102080720 | Not Available | 550 | Open in IMG/M |
3300005437|Ga0070710_10166041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1372 | Open in IMG/M |
3300005437|Ga0070710_10976149 | Not Available | 616 | Open in IMG/M |
3300005439|Ga0070711_100630126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 897 | Open in IMG/M |
3300005440|Ga0070705_100315774 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300005451|Ga0066681_10271584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1033 | Open in IMG/M |
3300005454|Ga0066687_10386493 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300005455|Ga0070663_100730542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 844 | Open in IMG/M |
3300005468|Ga0070707_100002954 | All Organisms → cellular organisms → Bacteria | 16132 | Open in IMG/M |
3300005468|Ga0070707_101644773 | Not Available | 609 | Open in IMG/M |
3300005518|Ga0070699_101907889 | Not Available | 543 | Open in IMG/M |
3300005530|Ga0070679_100519865 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300005532|Ga0070739_10017123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6228 | Open in IMG/M |
3300005533|Ga0070734_10024197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3943 | Open in IMG/M |
3300005535|Ga0070684_101309951 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300005537|Ga0070730_10003352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14412 | Open in IMG/M |
3300005538|Ga0070731_10000144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 130115 | Open in IMG/M |
3300005539|Ga0068853_101498979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 653 | Open in IMG/M |
3300005554|Ga0066661_10443869 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300005560|Ga0066670_10155664 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300005568|Ga0066703_10168496 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300005575|Ga0066702_10001088 | All Organisms → cellular organisms → Bacteria | 8262 | Open in IMG/M |
3300005587|Ga0066654_10727628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
3300005598|Ga0066706_10539858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 928 | Open in IMG/M |
3300005598|Ga0066706_11431952 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300005614|Ga0068856_101028987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 842 | Open in IMG/M |
3300005614|Ga0068856_101830110 | Not Available | 619 | Open in IMG/M |
3300005713|Ga0066905_100067567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2282 | Open in IMG/M |
3300005713|Ga0066905_102236715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas hydrophila | 510 | Open in IMG/M |
3300005764|Ga0066903_100551041 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
3300005764|Ga0066903_100611392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1892 | Open in IMG/M |
3300005764|Ga0066903_100733646 | Not Available | 1750 | Open in IMG/M |
3300005764|Ga0066903_101204924 | Not Available | 1406 | Open in IMG/M |
3300005764|Ga0066903_101408914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1310 | Open in IMG/M |
3300005764|Ga0066903_102826234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 942 | Open in IMG/M |
3300005764|Ga0066903_104206382 | Not Available | 770 | Open in IMG/M |
3300005764|Ga0066903_104883422 | Not Available | 712 | Open in IMG/M |
3300005764|Ga0066903_107232700 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300005843|Ga0068860_102539400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
3300005891|Ga0075283_1039764 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300005891|Ga0075283_1070619 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300005901|Ga0075274_1021223 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300005902|Ga0075273_10122682 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006028|Ga0070717_10184163 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
3300006028|Ga0070717_10943935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
3300006028|Ga0070717_11318998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300006028|Ga0070717_11326905 | Not Available | 654 | Open in IMG/M |
3300006046|Ga0066652_100365386 | Not Available | 1304 | Open in IMG/M |
3300006046|Ga0066652_101001837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 793 | Open in IMG/M |
3300006046|Ga0066652_101101064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
3300006059|Ga0075017_100032930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3420 | Open in IMG/M |
3300006163|Ga0070715_10546091 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300006173|Ga0070716_101413262 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300006175|Ga0070712_101665895 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300006237|Ga0097621_100830314 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300006354|Ga0075021_10038199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2750 | Open in IMG/M |
3300006578|Ga0074059_11009898 | Not Available | 706 | Open in IMG/M |
3300006755|Ga0079222_12139205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300006800|Ga0066660_10489835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1033 | Open in IMG/M |
3300006804|Ga0079221_10846745 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300006804|Ga0079221_10868854 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300006804|Ga0079221_10884657 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006806|Ga0079220_10766331 | Not Available | 723 | Open in IMG/M |
3300006806|Ga0079220_11387905 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → unclassified Rhodothermales → Rhodothermales bacterium | 595 | Open in IMG/M |
3300006806|Ga0079220_11952801 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300006854|Ga0075425_103116699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300006903|Ga0075426_10728869 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300006904|Ga0075424_100031514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5491 | Open in IMG/M |
3300006954|Ga0079219_10174853 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → unclassified Rhodothermales → Rhodothermales bacterium | 1182 | Open in IMG/M |
3300009012|Ga0066710_100397430 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
3300009093|Ga0105240_10098822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3553 | Open in IMG/M |
3300009093|Ga0105240_10512069 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300009093|Ga0105240_12185776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300009137|Ga0066709_104219172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
3300009156|Ga0111538_12440635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300009174|Ga0105241_10116266 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
3300009174|Ga0105241_10883328 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300009177|Ga0105248_10769969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1086 | Open in IMG/M |
3300009545|Ga0105237_11117361 | Not Available | 795 | Open in IMG/M |
3300010043|Ga0126380_11605948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
3300010048|Ga0126373_11182568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
3300010048|Ga0126373_11621151 | Not Available | 712 | Open in IMG/M |
3300010048|Ga0126373_12899694 | Not Available | 535 | Open in IMG/M |
3300010154|Ga0127503_10153356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1313 | Open in IMG/M |
3300010320|Ga0134109_10326961 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010323|Ga0134086_10312748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
3300010359|Ga0126376_11996599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. | 622 | Open in IMG/M |
3300010359|Ga0126376_12803972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300010366|Ga0126379_10167246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2073 | Open in IMG/M |
3300010371|Ga0134125_11311405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
3300010371|Ga0134125_11566753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 717 | Open in IMG/M |
3300010373|Ga0134128_10051545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4761 | Open in IMG/M |
3300010373|Ga0134128_10439790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1455 | Open in IMG/M |
3300010373|Ga0134128_11805937 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300010376|Ga0126381_100095412 | All Organisms → cellular organisms → Bacteria | 3783 | Open in IMG/M |
3300010376|Ga0126381_100984746 | Not Available | 1216 | Open in IMG/M |
3300010396|Ga0134126_10978290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
3300010396|Ga0134126_12538440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
3300010399|Ga0134127_10400351 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300012011|Ga0120152_1194249 | Not Available | 510 | Open in IMG/M |
3300012199|Ga0137383_10906589 | Not Available | 644 | Open in IMG/M |
3300012200|Ga0137382_10200529 | Not Available | 1370 | Open in IMG/M |
3300012201|Ga0137365_10431554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 971 | Open in IMG/M |
3300012207|Ga0137381_10522597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
3300012207|Ga0137381_10879537 | Not Available | 775 | Open in IMG/M |
3300012211|Ga0137377_10187056 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
3300012212|Ga0150985_105078840 | Not Available | 1443 | Open in IMG/M |
3300012351|Ga0137386_10984223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
3300012359|Ga0137385_10565290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus normandii | 958 | Open in IMG/M |
3300012915|Ga0157302_10067429 | Not Available | 1053 | Open in IMG/M |
3300012951|Ga0164300_10048908 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
3300012951|Ga0164300_10428870 | Not Available | 735 | Open in IMG/M |
3300012951|Ga0164300_11136734 | Not Available | 513 | Open in IMG/M |
3300012955|Ga0164298_10021694 | All Organisms → cellular organisms → Bacteria | 2748 | Open in IMG/M |
3300012955|Ga0164298_10617244 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300012958|Ga0164299_10000222 | All Organisms → cellular organisms → Bacteria | 12294 | Open in IMG/M |
3300012958|Ga0164299_11309165 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012960|Ga0164301_10619095 | Not Available | 802 | Open in IMG/M |
3300012971|Ga0126369_11559552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 750 | Open in IMG/M |
3300012971|Ga0126369_12399966 | Not Available | 613 | Open in IMG/M |
3300012982|Ga0168317_1002880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7817 | Open in IMG/M |
3300012986|Ga0164304_10588553 | Not Available | 828 | Open in IMG/M |
3300012986|Ga0164304_10751732 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300012987|Ga0164307_10228537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1285 | Open in IMG/M |
3300012987|Ga0164307_10334273 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300012987|Ga0164307_11617027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300012988|Ga0164306_10180041 | Not Available | 1467 | Open in IMG/M |
3300012988|Ga0164306_11570126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300012989|Ga0164305_10153651 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300013100|Ga0157373_10128922 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300013102|Ga0157371_10794069 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300013104|Ga0157370_10144217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2218 | Open in IMG/M |
3300013105|Ga0157369_12345407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300013297|Ga0157378_11676327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
3300013297|Ga0157378_11848211 | Not Available | 653 | Open in IMG/M |
3300013307|Ga0157372_10021889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6910 | Open in IMG/M |
3300013307|Ga0157372_10147139 | All Organisms → cellular organisms → Bacteria | 2717 | Open in IMG/M |
3300013307|Ga0157372_12518473 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300013307|Ga0157372_12802565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
3300013307|Ga0157372_13459507 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300014497|Ga0182008_10809878 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300014823|Ga0120170_1098093 | Not Available | 595 | Open in IMG/M |
3300015192|Ga0167646_1076638 | Not Available | 725 | Open in IMG/M |
3300015371|Ga0132258_10144656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 5693 | Open in IMG/M |
3300015371|Ga0132258_10767122 | Not Available | 2430 | Open in IMG/M |
3300015371|Ga0132258_11085581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2023 | Open in IMG/M |
3300015371|Ga0132258_12053271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1437 | Open in IMG/M |
3300015371|Ga0132258_13682232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
3300015372|Ga0132256_100189335 | Not Available | 2097 | Open in IMG/M |
3300015373|Ga0132257_100410020 | Not Available | 1649 | Open in IMG/M |
3300015374|Ga0132255_101169750 | Not Available | 1158 | Open in IMG/M |
3300017937|Ga0187809_10309886 | Not Available | 584 | Open in IMG/M |
3300017944|Ga0187786_10362771 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300017947|Ga0187785_10030941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1938 | Open in IMG/M |
3300017974|Ga0187777_10048692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2730 | Open in IMG/M |
3300018431|Ga0066655_11182126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300018433|Ga0066667_10405093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1103 | Open in IMG/M |
3300018468|Ga0066662_10003391 | Not Available | 7657 | Open in IMG/M |
3300018468|Ga0066662_10003411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7639 | Open in IMG/M |
3300018468|Ga0066662_11603863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
3300018468|Ga0066662_12149073 | Not Available | 585 | Open in IMG/M |
3300018482|Ga0066669_11249388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
3300019361|Ga0173482_10104946 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300019361|Ga0173482_10215788 | Not Available | 796 | Open in IMG/M |
3300019888|Ga0193751_1024249 | All Organisms → cellular organisms → Bacteria | 2939 | Open in IMG/M |
3300019888|Ga0193751_1050330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1797 | Open in IMG/M |
3300020069|Ga0197907_10434916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
3300020069|Ga0197907_11437109 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300020070|Ga0206356_10419861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
3300020082|Ga0206353_10451095 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300020610|Ga0154015_1253125 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300021372|Ga0213877_10250278 | Not Available | 588 | Open in IMG/M |
3300021384|Ga0213876_10388518 | Not Available | 742 | Open in IMG/M |
3300021560|Ga0126371_10331679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1653 | Open in IMG/M |
3300021560|Ga0126371_12013361 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300024181|Ga0247693_1045001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
3300025625|Ga0208219_1000515 | All Organisms → cellular organisms → Bacteria | 13822 | Open in IMG/M |
3300025909|Ga0207705_10049741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3017 | Open in IMG/M |
3300025909|Ga0207705_10868047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
3300025909|Ga0207705_11283536 | Not Available | 560 | Open in IMG/M |
3300025911|Ga0207654_10697712 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300025912|Ga0207707_10047088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3756 | Open in IMG/M |
3300025912|Ga0207707_10461009 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300025912|Ga0207707_10842975 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300025912|Ga0207707_11337555 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300025913|Ga0207695_11392459 | Not Available | 582 | Open in IMG/M |
3300025915|Ga0207693_10060799 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
3300025915|Ga0207693_10230854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1453 | Open in IMG/M |
3300025916|Ga0207663_10028799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3255 | Open in IMG/M |
3300025917|Ga0207660_10087900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2297 | Open in IMG/M |
3300025917|Ga0207660_10688182 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300025917|Ga0207660_11605278 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300025919|Ga0207657_10350958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1163 | Open in IMG/M |
3300025921|Ga0207652_10705317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
3300025921|Ga0207652_10922657 | Not Available | 770 | Open in IMG/M |
3300025922|Ga0207646_10002382 | All Organisms → cellular organisms → Bacteria | 22201 | Open in IMG/M |
3300025927|Ga0207687_10393456 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300025927|Ga0207687_10513233 | Not Available | 1002 | Open in IMG/M |
3300025928|Ga0207700_10451169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
3300025928|Ga0207700_11028818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300025929|Ga0207664_10786828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
3300025929|Ga0207664_10844028 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300025929|Ga0207664_10846561 | Not Available | 822 | Open in IMG/M |
3300025929|Ga0207664_11786203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas humilata | 537 | Open in IMG/M |
3300025931|Ga0207644_10647951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 879 | Open in IMG/M |
3300025932|Ga0207690_10865503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
3300025944|Ga0207661_10673591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 951 | Open in IMG/M |
3300025949|Ga0207667_10654817 | Not Available | 1056 | Open in IMG/M |
3300025994|Ga0208142_1011883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
3300026078|Ga0207702_10284235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1565 | Open in IMG/M |
3300026078|Ga0207702_10852390 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300026078|Ga0207702_12502559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
3300026116|Ga0207674_10566133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1098 | Open in IMG/M |
3300026121|Ga0207683_11815491 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300026142|Ga0207698_10215097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1732 | Open in IMG/M |
3300026322|Ga0209687_1278859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → environmental samples → uncultured Thermoleophilia bacterium | 525 | Open in IMG/M |
3300026550|Ga0209474_10203461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1260 | Open in IMG/M |
3300026552|Ga0209577_10147886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1851 | Open in IMG/M |
3300026552|Ga0209577_10412042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 966 | Open in IMG/M |
3300026960|Ga0207582_1018519 | Not Available | 648 | Open in IMG/M |
3300027502|Ga0209622_1092257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_57_11 | 555 | Open in IMG/M |
3300027773|Ga0209810_1002283 | All Organisms → cellular organisms → Bacteria | 23658 | Open in IMG/M |
3300027826|Ga0209060_10054409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1921 | Open in IMG/M |
3300027826|Ga0209060_10458750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
3300027842|Ga0209580_10180907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
3300027869|Ga0209579_10000004 | All Organisms → cellular organisms → Bacteria | 890648 | Open in IMG/M |
3300027894|Ga0209068_10120164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1401 | Open in IMG/M |
3300027907|Ga0207428_10645428 | Not Available | 760 | Open in IMG/M |
3300028563|Ga0265319_1065489 | Not Available | 1171 | Open in IMG/M |
3300028573|Ga0265334_10053461 | Not Available | 1542 | Open in IMG/M |
3300028787|Ga0307323_10191550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300028800|Ga0265338_10005197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17092 | Open in IMG/M |
3300028800|Ga0265338_10662758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
3300028800|Ga0265338_10725568 | Not Available | 684 | Open in IMG/M |
3300028881|Ga0307277_10202459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
3300028881|Ga0307277_10436991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300029923|Ga0311347_10902249 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300031198|Ga0307500_10105752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
3300031226|Ga0307497_10646943 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031231|Ga0170824_110515125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 876 | Open in IMG/M |
3300031546|Ga0318538_10785691 | Not Available | 517 | Open in IMG/M |
3300031572|Ga0318515_10597296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
3300031671|Ga0307372_10035045 | All Organisms → cellular organisms → Bacteria | 5292 | Open in IMG/M |
3300031845|Ga0318511_10293606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
3300031938|Ga0308175_100000311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 35311 | Open in IMG/M |
3300031938|Ga0308175_100010044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 7060 | Open in IMG/M |
3300031938|Ga0308175_100019440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5378 | Open in IMG/M |
3300031938|Ga0308175_100111480 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
3300031939|Ga0308174_10331054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1209 | Open in IMG/M |
3300031939|Ga0308174_11616041 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300031996|Ga0308176_10890538 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300032001|Ga0306922_10362906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1553 | Open in IMG/M |
3300032180|Ga0307471_101370926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga aerilata | 868 | Open in IMG/M |
3300032770|Ga0335085_10011927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12836 | Open in IMG/M |
3300032770|Ga0335085_10317670 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
3300032828|Ga0335080_10265063 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
3300032829|Ga0335070_11218981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
3300032954|Ga0335083_10597282 | Not Available | 910 | Open in IMG/M |
3300032955|Ga0335076_11582432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300033004|Ga0335084_10706511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1027 | Open in IMG/M |
3300033004|Ga0335084_11179582 | Not Available | 766 | Open in IMG/M |
3300033158|Ga0335077_12228909 | Not Available | 502 | Open in IMG/M |
3300033758|Ga0314868_012610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 856 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.68% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.73% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.10% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.10% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.15% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.21% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.21% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.58% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.58% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.58% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.26% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.95% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.63% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.63% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.32% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.32% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.32% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.32% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.32% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.32% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.32% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.32% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.32% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.32% |
Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.32% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.32% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.32% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025994 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026960 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A5-10 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FI_00252640 | 2166559006 | Grass Soil | VDDDDRPPICPRCGVTMVPAALSAGGDHEGDWVCLECEELDEE |
deepsgr_01163610 | 2199352025 | Soil | MDADDRPPICERCGVTMVPAALSADDKHEGDWVCLECEEFDEEE |
AF_2010_repII_A1DRAFT_100117321 | 3300000597 | Forest Soil | VDYDDRPPICPRCGVTMVPAVLSADEEHDGEWACLECEELDEEK* |
AF_2010_repII_A1DRAFT_100604743 | 3300000597 | Forest Soil | MTAPDNGPPICATCGVTMVPAALSAHDDHDHEWVCLECEELDEETSHSP* |
A1565W1_102860403 | 3300001536 | Permafrost | VEDDDRPPICPRCGVTMVPAALSADDNREGDWVCLECEELDEDG* |
C688J18823_100472753 | 3300001686 | Soil | MEDDRPPICPRCGVTMVPAALSADDKREGDWVCVECEELDEA* |
JGI12627J18819_104233842 | 3300001867 | Forest Soil | VDDDSRPPICPRCGVTMVPAALSADDDHEGEWVCLECEELDEDE* |
C688J35102_1187121642 | 3300002568 | Soil | LDDRPPICPRCGVTMVPGALRADDEHEGDWVCLECEERDEEE* |
C688J35102_1203880212 | 3300002568 | Soil | MDADDRPPICPRCGVTMVPAALSADDRREGDWVCLECEELDEEE* |
C688J35102_1209672133 | 3300002568 | Soil | MAADDRPPICPRCGVTMVPGALSADDKHEGDWVCLECEELDEEE* |
C688J35102_1209745155 | 3300002568 | Soil | MDDDDRPPICPRCGVTMVPAALSAEKTRDASWVCLECEELGEEQ* |
soilL1_101917563 | 3300003267 | Sugarcane Root And Bulk Soil | VDEDDRPPICATCGVTMVPAALSARENPDDDWVCLECEELDEEA* |
soilH2_102166302 | 3300003324 | Sugarcane Root And Bulk Soil | MDERPPICPRCGVTMVPAALGSGSTPHGDWVCLECEALGEE* |
Ga0063454_1001147932 | 3300004081 | Soil | MEDDRPPICPRCGVTMVPAALSADDTHEGDWVCVECEELDET* |
Ga0063454_1002973661 | 3300004081 | Soil | MDADDRPPICPRCGVTMVPGALSADDEHEGDWVCLECEELDEEN* |
Ga0062593_1023064251 | 3300004114 | Soil | PPICPTCGVTMVPAALSARAGLTDDWVCLECEELGEPDPS* |
Ga0062593_1031844912 | 3300004114 | Soil | DDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEDE* |
Ga0062595_1000070572 | 3300004479 | Soil | MDDHGMDEDDRPPICLRCGVTMVPAALSADEEHEGEWVCLECEELDEEK* |
Ga0062595_1000228081 | 3300004479 | Soil | VDFRSEEADDRPPICATCGVTMVPAGLSAAENHDADWVCLECEERAPEE* |
Ga0062595_1000792943 | 3300004479 | Soil | VDTRDVETDDRPPICATCGVTMVPAALSAKEDRDGEWVCLECEELDSES* |
Ga0062595_1001143694 | 3300004479 | Soil | GLDDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEDE* |
Ga0062595_1004834542 | 3300004479 | Soil | MDDRPPICPRCGVTMVPAALSADEGCDGDWACLECEELGEEA* |
Ga0062595_1007067743 | 3300004479 | Soil | VDNDERPPICARCGVTMVPAALSAFDKQEGDWVCLECEELDGDE* |
Ga0062591_1005114492 | 3300004643 | Soil | VDDDNRPPICPRCGVTLVPAALSADDNHESDWVCLECEELDENE* |
Ga0062591_1011272801 | 3300004643 | Soil | MVRTVDADDRPPICAACGVTMVPAALSADEDRDGEWVCLECEELD |
Ga0062591_1020250042 | 3300004643 | Soil | RSPICPRCGVTMVPAALSADDKHEGDWVCLEREELDEAD* |
Ga0062594_1008328252 | 3300005093 | Soil | LDDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEDE* |
Ga0062594_1011018162 | 3300005093 | Soil | MDADDRPPICPRCGVTMVPAALSAGDKHEGDGLCLEREEL |
Ga0066679_107089612 | 3300005176 | Soil | MDDDDRPPICPRCGVTLVPARLSADDKHDGEWVCLECEELDGEV* |
Ga0070658_101286213 | 3300005327 | Corn Rhizosphere | MDDDRPPICPRCGVTLVPAELSAGDEHDGDWVCLECEELDGET* |
Ga0070658_103413221 | 3300005327 | Corn Rhizosphere | EDRPPICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT* |
Ga0070658_116862561 | 3300005327 | Corn Rhizosphere | MDDRPPICPRCGVTMVPAALSADAEREGDWVCLECEELGEDA* |
Ga0070683_1000533774 | 3300005329 | Corn Rhizosphere | VVDEDDEDRPPICPRCGVTMVPAALSADDGHDGEWVCLECEEL |
Ga0066388_1001503833 | 3300005332 | Tropical Forest Soil | VDDRPPICPRCGVTMVPAALSADDGQEGDWVCLECEEMDEAE* |
Ga0066388_1010972252 | 3300005332 | Tropical Forest Soil | MAVDHDDDRPPICFRCGVTMVPAALSADEEHEGDWVCLECEELDEVDPE* |
Ga0066388_1016281142 | 3300005332 | Tropical Forest Soil | MARAADRDDRPPICATCGVTMVPAALSADEDHEGEWVCLECEELGEAR* |
Ga0066388_1017434641 | 3300005332 | Tropical Forest Soil | ADDRPPICPRCGVTKVPAALSADDEREGDWVCLECEELDEE* |
Ga0070680_1006999991 | 3300005336 | Corn Rhizosphere | VVDEDDEGRPPICPRCGVTMVPAELSADDGHDGEWVCLECEELGEDT* |
Ga0070682_1006799152 | 3300005337 | Corn Rhizosphere | VDEDDEGRPPICPRCGVTMVPAELSADDGHDGEWVCLECEELGEDA* |
Ga0070660_1014850481 | 3300005339 | Corn Rhizosphere | VAADDRPPICPTCGVTMVPAALSADAEHEGEWVCLECEELGED |
Ga0070661_1000552276 | 3300005344 | Corn Rhizosphere | VVDEDDEDRPPICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT* |
Ga0070661_1007855021 | 3300005344 | Corn Rhizosphere | VVDEDDEGRPPICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT* |
Ga0070671_1005257243 | 3300005355 | Switchgrass Rhizosphere | MRDDDRPPICPRCGVTMVPAALSAEETTEGDWVCLECEELEDEEE* |
Ga0070659_1011173072 | 3300005366 | Corn Rhizosphere | VDEDDEDRPPICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT* |
Ga0070709_100006892 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDDDRPPICPRCGVTMVPAVLSADGDHQGDWVCLECEELDEE* |
Ga0070709_108529842 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VKEDDRPPICPRCGVTMVPSALSAEGSRPGEWVCLECEELGEDD* |
Ga0070714_10000154316 | 3300005435 | Agricultural Soil | VTERDDDRPPICPRCGVTMVPAALSADDTREGDWVCLECEELADDEQ* |
Ga0070714_1001161833 | 3300005435 | Agricultural Soil | MEDDDQPPICARCGVTLVPAALSAVEGAVKGRDSDWVCLECEELGEDV* |
Ga0070714_1003280011 | 3300005435 | Agricultural Soil | MEADDRAPICPRCGVTMVPAALSADHDPEGDWVCLECEELG |
Ga0070714_1006735843 | 3300005435 | Agricultural Soil | VNELDERPPICPRCGVTMVPSALSAEDGRAGDWVCLECEELGEEP |
Ga0070714_1015668222 | 3300005435 | Agricultural Soil | VADDDRPPICPRCGVTMVPAALSADEKREGEWVCLECEELEEGE* |
Ga0070714_1022012451 | 3300005435 | Agricultural Soil | MTQRDDDRPPICPRCGVTMVPAALSADENRDGDWVCLECEELDEAE* |
Ga0070713_1002875864 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEDDRPPICPRCGVTMVPAALSADDKHEGEWVCLECEELGEEE* |
Ga0070713_1017246901 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ICPSCGVTMVPAGLSARAEDGDADSDWVCLECEERDEPD* |
Ga0070713_1020807202 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMDRDDRPPICSRCGVTMVPAALSAEEGRDGDWTCLECEELGDDD* |
Ga0070710_101660411 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GVDPDDRPPICPTCGVTMVPAALSARKDNDDEWVCLECEELD* |
Ga0070710_109761491 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LRPRILLGVSDDRPPICARCGVTMVPAALSAEEGRDGDWTCLECEELGDDD* |
Ga0070711_1006301262 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VTERDDERPPICPRCGVTMVPAALSADDTREGDWVCLECEELADDEQ* |
Ga0070705_1003157742 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VKVHDDERPPICPRCGVTLVPAALSADDKHESDWVCLECEELDEDE* |
Ga0066681_102715842 | 3300005451 | Soil | MDADDRPPICPRCGVTMVPAALSAEDKHEGDWVCLECEELDEEE* |
Ga0066687_103864931 | 3300005454 | Soil | MDDDDRPPICPRCGVTLVPARLSADDEHDGEWVCLECEELGAEV* |
Ga0070663_1007305422 | 3300005455 | Corn Rhizosphere | VDEDDEDRPPICPRCGVTMVPAELSADDGHDGEWVCLECEELGEDT* |
Ga0070707_10000295422 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDDDRPPICPRCGVTMVPAALSADDKHEGEWVCLECEELDEDE* |
Ga0070707_1016447731 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEDDRPPICPRCGVTMVPAALSAATVHDTEWACLECEELD |
Ga0070699_1019078891 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ARNTHGVENDERPPICPRCGVTMVPAALSADDDPEGEWVCLECEELDDES* |
Ga0070679_1005198652 | 3300005530 | Corn Rhizosphere | MDEEDRPPICPRCGVTMVPATLSAEDKTGDWVCLECEELG |
Ga0070739_100171235 | 3300005532 | Surface Soil | VQDEDRPPICPRCGVTMVPAELSADDKRDDDWVCLECEELGEDD* |
Ga0070734_100241974 | 3300005533 | Surface Soil | VSFEDRPPICPCCGVTMVPAALSAEDDPDGDWVCLECEELDEDE* |
Ga0070684_1013099512 | 3300005535 | Corn Rhizosphere | MEDDDQPPICARCGVTLVPAALSAVQGAVKGRDGDWACLECEELGEDV* |
Ga0070730_100033521 | 3300005537 | Surface Soil | RVARDDRPPICPTCGVTMVPAALSANDDRDGEWVCLECEELDEGDR* |
Ga0070731_10000144140 | 3300005538 | Surface Soil | MRDDDRPPICPRCGVTMVPAALSAGGRHEGDWVCLECEERNEDED* |
Ga0068853_1014989792 | 3300005539 | Corn Rhizosphere | LDDDNRPPICPRCGVTLVPAALSADDKHESDWVCLECEELDEDE* |
Ga0066661_104438692 | 3300005554 | Soil | MRIPRDDERPPICPVCGVTMVPATLSASGEMDGDWVCLECEELEEPEHA* |
Ga0066670_101556643 | 3300005560 | Soil | MEDDRPPICPRCGVTMVPAALSADDTHEGDWVCVECEELDEA* |
Ga0066703_101684961 | 3300005568 | Soil | VHEDRPPICLRCGVTMVPAALSAIASGDGDWVCLECEELD |
Ga0066702_100010885 | 3300005575 | Soil | VHEDRPPICLRCGVTMVPAALSAIASGDGDWVCLECEELGEEE* |
Ga0066654_107276282 | 3300005587 | Soil | MEDARPPICPRCGVTMVPAALSAAEKRDGDWVCLECEELDEAE* |
Ga0066706_105398583 | 3300005598 | Soil | VEDDDRPPICPRCGVTMVPAALSADGDPEGEWVCLECEELDDES* |
Ga0066706_114319522 | 3300005598 | Soil | MDDDDRPPICPRCGVTLVPARLSADDKHDGEWVCLECEELGGEV* |
Ga0068856_1010289872 | 3300005614 | Corn Rhizosphere | VVDEDDEDRPPICPRCGVTMVPAELSADDGHDGEWVCLECEELGEDT* |
Ga0068856_1018301102 | 3300005614 | Corn Rhizosphere | VDEDNRPPICPRCGVTLVPAALSADDKHESDWVCLECEELDEDE* |
Ga0066905_1000675673 | 3300005713 | Tropical Forest Soil | MTDDRPPICPRCGVTMVPAALSADDKHEVDWVCLECEELDLED* |
Ga0066905_1022367151 | 3300005713 | Tropical Forest Soil | RAILGGVEVDDRPPICPRCGVTMVPATLSAEDAQGGEWVCLECEELGEED* |
Ga0066903_1005510413 | 3300005764 | Tropical Forest Soil | VDEDDDRPPICPRCGVTMVPAALSAEPDHDADWVCLECEELDEESLG* |
Ga0066903_1006113924 | 3300005764 | Tropical Forest Soil | MFEDDRPPICPRCGVTMVAAALSANEEREGDWVCLECEELDEVDPE* |
Ga0066903_1007336464 | 3300005764 | Tropical Forest Soil | MDDDDRPPICPWCGVTMVPAALSADQRREGDWVCLECEELDEDE* |
Ga0066903_1012049242 | 3300005764 | Tropical Forest Soil | MDEDDRPPICPWCGVTMVPAALSAQDDHDDDWVCLECEEK* |
Ga0066903_1014089142 | 3300005764 | Tropical Forest Soil | MDEDDRPPICLRCGVTMVPAALSADDVHEGYWVCLECEELGEEQ* |
Ga0066903_1028262342 | 3300005764 | Tropical Forest Soil | VDDRPPICLRCGVTMVPAALSADEDQEGDWVCLECEELDEAE* |
Ga0066903_1042063822 | 3300005764 | Tropical Forest Soil | VDDDDRPPICPRCGVTMVPAALSADDTRDGDWVCLECEELADESD* |
Ga0066903_1048834223 | 3300005764 | Tropical Forest Soil | VTEDDRPPICPTCGVTMVPAALSAEEDPEGEWVCLECEELDEET* |
Ga0066903_1072327002 | 3300005764 | Tropical Forest Soil | MFEDDRPPICPRCGVTMVPAALSAAEVHEGDWVCLECEELDEVDPE* |
Ga0068860_1025394001 | 3300005843 | Switchgrass Rhizosphere | SVDDDDRPPICPRCGVTMVPAVLSADGDDQGDWVCLECEELDEE* |
Ga0075283_10397642 | 3300005891 | Rice Paddy Soil | VDEEDRPPICPRCGVTMVPAALSADDEHEGQWVCLECEELGEDA* |
Ga0075283_10706191 | 3300005891 | Rice Paddy Soil | EDRPPICARCGVTMVPAALSADDEHEGEWVCLECEELGEDT* |
Ga0075274_10212233 | 3300005901 | Rice Paddy Soil | PTADTSVVDEDDRPPICSRCGVTMVPAALSADDEHEGEWACLECEELGDDA* |
Ga0075273_101226821 | 3300005902 | Rice Paddy Soil | DEEDRPPICPRCGVTMVPAALSADDEHEGEWVCVECEERGEDG* |
Ga0070717_101841632 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MADDRPPICATCGVTMVPAALSADEDHEGEWVCLECEELDEDR* |
Ga0070717_109439352 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LGHVTERADDRPPICPRCGVTMVPAALSADDTREGDWVCLECEELADDEQ* |
Ga0070717_113189981 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDADTRPPICPRCGVTLVPAALSADGDKHEGDWACLECEELDEEE* |
Ga0070717_113269052 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDRDDDRPPICPRCGVTMVPAVLSANETREGDWVCLECEELADDEQ* |
Ga0066652_1003653861 | 3300006046 | Soil | MDADDRPPICPRCGVTMVPAALSADDRHEGDWVCLECEELDEEE* |
Ga0066652_1010018371 | 3300006046 | Soil | NLRNTHEVDADDRPPICLTCGVTMVPAALSAREVHNGEWVCLECEELDEER* |
Ga0066652_1011010641 | 3300006046 | Soil | VSDFRDADDRPPICATCGVTMVPAALSTHEDHEGEWVCLECEELDEER* |
Ga0075017_1000329307 | 3300006059 | Watersheds | VDDRPPICPRCGVTMVPAALSADERREGDWVCLECEELDVSPSSEE* |
Ga0070715_105460913 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ICPRCGVTMVPAALSADDDPEGDWVCLECEELDEDE* |
Ga0070716_1014132623 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LRLPGDDDRPPICPRCGVTMVPAALSADGAAGREWVCLECEERDEPDER* |
Ga0070712_1016658953 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | DDRPPICPRCGVTMVPAALSADDKHEGEWVCLECEELDKDE* |
Ga0097621_1008303141 | 3300006237 | Miscanthus Rhizosphere | GDTAAVDEEDRPPICPGCGVTLVPAALSADDEHEGEWVCLECEDRGEDG* |
Ga0075021_100381993 | 3300006354 | Watersheds | VEAVDDPVGDRAPICPRCGVTMVPAALSASEAPEGDWVCLECEELDEGDAQ* |
Ga0074059_110098982 | 3300006578 | Soil | MGEADDRAPICPRCGVTMVPAALSADEDPEGDWVCLECEELGEDT* |
Ga0079222_121392052 | 3300006755 | Agricultural Soil | MDDLDRPPICPRCGVTMVPAALSADENPEGDWVCLECEELDEDE* |
Ga0066660_104898353 | 3300006800 | Soil | MDDDDRPPICPRCGETMVPAALSADAKYEGDWVCLECEELDEDE* |
Ga0079221_108467452 | 3300006804 | Agricultural Soil | MDDRPPICPRCGVTMVPAALSADEGRDGDWVCLECEELGEEA* |
Ga0079221_108688542 | 3300006804 | Agricultural Soil | DDRPPICPRCGVTMVPAALSAATVHDAEWVCLECEELDEAT* |
Ga0079221_108846571 | 3300006804 | Agricultural Soil | PPICPRCGVTMVPVELSADGDREREWACLECEELGEDE* |
Ga0079220_107663312 | 3300006806 | Agricultural Soil | VDRDERPPICPRCGVTMVPVELSADGDREGEWACLECEELGEDE* |
Ga0079220_113879052 | 3300006806 | Agricultural Soil | MDDRPPICPRCGVTMVPAALSADEGRDGDWVCLEC |
Ga0079220_119528011 | 3300006806 | Agricultural Soil | MMGEDDRPPICPRCGVTMVPAALSADENPEGDWVCLECEELDEDE* |
Ga0075425_1031166991 | 3300006854 | Populus Rhizosphere | PPICPRCGVTMVPADLSADDEHEGDWVCLECEELDESD* |
Ga0075426_107288692 | 3300006903 | Populus Rhizosphere | MEDDDQPPICARCGVTLVPAALSAVEDAVKGRDSDWVCLECEELGEDV* |
Ga0075424_1000315142 | 3300006904 | Populus Rhizosphere | VDDDNRPPICPRCGVTLVPAALSADDNHESDWVCLECEELDEDE* |
Ga0079219_101748532 | 3300006954 | Agricultural Soil | MDDRPPICPRCGVTMVPTALSADEGRDGDWVCLECEELGEEA* |
Ga0066710_1003974304 | 3300009012 | Grasslands Soil | VDDDDRPPICPVCGVTMVPAELSEEGALGREWVCLECEELDEPDR |
Ga0105240_100988224 | 3300009093 | Corn Rhizosphere | MEDDDQPPICARCGVTLVPAALSAVQGTVKGRDGDWACLECEELGEDV* |
Ga0105240_105120692 | 3300009093 | Corn Rhizosphere | MDEEDRPPICPRCGVTMVPATLSAEDKTGDWVCLECEELGDDE* |
Ga0105240_121857762 | 3300009093 | Corn Rhizosphere | MSADDRPPICPRCGVTMVPAALSADDNHEGDWVCLECEELDEAE* |
Ga0066709_1042191721 | 3300009137 | Grasslands Soil | VDDDDRPPICPVCGVTMVPAELSEEGALGRDWVCLECEELDEPDR* |
Ga0111538_124406352 | 3300009156 | Populus Rhizosphere | VDDDNRPPICPRCGVTLVPAALSADDNHESDWVCLECEELDEDE |
Ga0105241_101162661 | 3300009174 | Corn Rhizosphere | PICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT* |
Ga0105241_108833282 | 3300009174 | Corn Rhizosphere | VDEDDEHRPPICPRCGVTMVPAELSADDGHDGEWVCLECEELGEDT* |
Ga0105248_107699693 | 3300009177 | Switchgrass Rhizosphere | MRDDDRPPICPRCGVTMVPAALSAGDTQEGDWVCLECEELDEAE* |
Ga0105237_111173611 | 3300009545 | Corn Rhizosphere | VDEDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEGE* |
Ga0126380_116059482 | 3300010043 | Tropical Forest Soil | MARAADTDDRPPICETCGVTMVPAALSADEDHGGEWLCLECEELDEER* |
Ga0126373_111825683 | 3300010048 | Tropical Forest Soil | MDDDDRPPICPRCGVTMVPAELSADDTREGDWVCLECEELADESE* |
Ga0126373_116211511 | 3300010048 | Tropical Forest Soil | RPPICPRCGVTTVPAALSLHDNHEGDWVCLECEELDEEE* |
Ga0126373_128996942 | 3300010048 | Tropical Forest Soil | MDEDERPPICPRCGVTMVPSALSADDRHDGDWVCLECEELDEPE* |
Ga0127503_101533561 | 3300010154 | Soil | VEYDDRPPICPRCGVTMVPAALSADDNHEGAWVCLECEELREDE* |
Ga0134109_103269612 | 3300010320 | Grasslands Soil | MDADDRPPICPRCGVTMVPAALSAEDKHEGDWVCLECEERDEED* |
Ga0134086_103127482 | 3300010323 | Grasslands Soil | MEDDRPPICPRCGVTMVPAALSAAEDPEGDWVCLECEELEDDPE* |
Ga0126376_119965991 | 3300010359 | Tropical Forest Soil | MDQDDRPPICQRCGVTMVPAALSANDKHEADWVCLECEELDEER* |
Ga0126376_128039722 | 3300010359 | Tropical Forest Soil | VDDRPPICPRCGVTMVPAALSAAADQEGDWVCLECEELDEAE* |
Ga0126379_101672464 | 3300010366 | Tropical Forest Soil | MYEDDRPPICPRCGVTMVPAALSADDEREGDWVCLECEELDEVDPE* |
Ga0134125_113114052 | 3300010371 | Terrestrial Soil | VDDDDRPPICLRCGVTMVPAVLSAHGDHHGDWVCLECEELDEE* |
Ga0134125_115667532 | 3300010371 | Terrestrial Soil | MTRRDDEEDRPPICPVCGVTMVAAALSVRPARDEEWVCLECEERGEQAG* |
Ga0134128_100515454 | 3300010373 | Terrestrial Soil | MDGDDRPPICPRCGVTMVPAALSADDAHEGDWVCLECEELDEEE* |
Ga0134128_104397901 | 3300010373 | Terrestrial Soil | MDDHGMDEDDRPPICLRCGVTMVPAALSADEEHEGEWVCLECEQLDEEK* |
Ga0134128_118059372 | 3300010373 | Terrestrial Soil | MEDNDQPPICARCGVTLVPAALSAVEDAVKGRDSDWVCLECEELGEDV* |
Ga0126381_1000954126 | 3300010376 | Tropical Forest Soil | MRDHDPRVDDRPPMCATCGVTMVPAALSADEDHEGDWVCLECEELDEER* |
Ga0126381_1009847463 | 3300010376 | Tropical Forest Soil | MRDQRYPSDARSVDDVDGDGDDRPPICPTCGVTMVPADLSAHDDHDGEWVCLECEELEAET* |
Ga0134126_109782901 | 3300010396 | Terrestrial Soil | MEDDDQPPICARCGVTLVPAALSAVEGAVKSRDSDWVCLECEELGEDV* |
Ga0134126_125384401 | 3300010396 | Terrestrial Soil | RPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEDE* |
Ga0134127_104003511 | 3300010399 | Terrestrial Soil | ADDRPPICPTCGVTMVPAALSADAEHEGEWVCLECEELGEDK* |
Ga0120152_11942491 | 3300012011 | Permafrost | ADDRPPICATCGVTMVPAALSSREDHDGEWVCLECEELERAE* |
Ga0137383_109065892 | 3300012199 | Vadose Zone Soil | MDDANRPPICPRCGVTMLPAALSADDNHQGDWVCLECEELDEDE* |
Ga0137382_102005292 | 3300012200 | Vadose Zone Soil | MDDDDRPSISPRCGVTMVPAALSADDKHDGEWVCLECEELGGEV* |
Ga0137365_104315542 | 3300012201 | Vadose Zone Soil | MDDDDRPPICPRCGVTMVPAALSADAKREGDWVCLECEELDEDE* |
Ga0137381_105225972 | 3300012207 | Vadose Zone Soil | VEDDDRPPICPRCGVTMVPAALSAEDDPEGEWVCLECEELDDES* |
Ga0137381_108795372 | 3300012207 | Vadose Zone Soil | MDDDDRPPICPRCGVTMVPAALSADAKYEGDWVCLECEELDEDE* |
Ga0137377_101870564 | 3300012211 | Vadose Zone Soil | MDDDDRPSICPRCGVTMVPAALSADAKYEGDWVCLECEELDEDE* |
Ga0150985_1050788401 | 3300012212 | Avena Fatua Rhizosphere | MDADDRPPICPRCGVTMVPAALSAEDRHEGDWVCLECEELDEEE* |
Ga0137386_109842232 | 3300012351 | Vadose Zone Soil | VEDDDRPPICPRCGVTMVPAALSADDDPEGEWVCLECEELDDES* |
Ga0137385_105652902 | 3300012359 | Vadose Zone Soil | MDDNDRPPICPRCGVTLVPARLSADDKHDGEWVCLECEELDGEV* |
Ga0157302_100674293 | 3300012915 | Soil | MVRTVDADDRPPICAACGVTMVPAALSADEDRDGEWVCLECEELDER* |
Ga0164300_100489082 | 3300012951 | Soil | VDDDNRPPICPRCGVTLVPAALSADDKHESDWVCLECEELDEDE* |
Ga0164300_104288702 | 3300012951 | Soil | NTHGVDDDNRPPICPRCGVTLVPAALSADDRRESDWVCLECEELDEDE* |
Ga0164300_111367341 | 3300012951 | Soil | MDEDDRPPICPRCGVTMVPAALSADDKHEGEWVCLECEELGEED* |
Ga0164298_100216944 | 3300012955 | Soil | VDDDDRPPICLRCGVTMVPAVLSADGDHQGDWVCLECEELDEE* |
Ga0164298_106172441 | 3300012955 | Soil | EDRPPICPGCGVTLVPAALSADDEHEGEWVCLECEDRGEDG* |
Ga0164299_1000022212 | 3300012958 | Soil | VDDDDRPPICPRCGVTMVPAVLSADGDHQGDGVCLECEELDEE* |
Ga0164299_113091651 | 3300012958 | Soil | VDDDTRPPICPRCGVTLVPATLSADDKQESDWVCLECEELDEDE* |
Ga0164301_106190952 | 3300012960 | Soil | VDEEDRPPICPGCGVTLVPAALSADDEHEGEWVCLECEDRGEDG* |
Ga0126369_115595522 | 3300012971 | Tropical Forest Soil | MDDDDRPPICPRCGVTMVPAALSADEEHEGDWVCLECEELDEVDPE* |
Ga0126369_123999661 | 3300012971 | Tropical Forest Soil | MADDRPPICATCGVTMVPAALSADENHEAEWVCLECEELDEEK* |
Ga0168317_10028807 | 3300012982 | Weathered Mine Tailings | MLAREDEPPICPVCGVTMVPAALSADDDVEGDWVCLECEET* |
Ga0164304_105885532 | 3300012986 | Soil | VHDDDRPPICPRCGVTLVPATLSADDKQESDWVCLECEELDEDE* |
Ga0164304_107517322 | 3300012986 | Soil | VDDDNRPPICPRCGVTLVPAALSANDKHESDWVCLECEELDEDE* |
Ga0164307_102285373 | 3300012987 | Soil | VDEEDRPPICPGCGVTLVPAALSADDEHEGEWVCLECEELDEDC* |
Ga0164307_103342733 | 3300012987 | Soil | VTVHDDDRPPICPRCGVTLVPATLSADDKQESDWVCLECEELDEDE* |
Ga0164307_116170272 | 3300012987 | Soil | APICPRCGVTMVPSALSAEEGRGGDWVCLECEELGEEL* |
Ga0164306_101800412 | 3300012988 | Soil | MDDDNRPPICPRCGVTLVPAALSADDKHESDWVCLECEELDEDE* |
Ga0164306_115701262 | 3300012988 | Soil | DEDERPPICPRCGVTMVPSALSAEARHSGDWVCLECEELDEE* |
Ga0164305_101536514 | 3300012989 | Soil | TAAVDEEDRPPICPGCGVTLVPAALSADDEHEGEWVCLECEDRGEDG* |
Ga0157373_101289225 | 3300013100 | Corn Rhizosphere | MEDDDQPPICARCGVTLVPAALSGVEDAVKGRDSDWVCLECEELGEDV* |
Ga0157371_107940692 | 3300013102 | Corn Rhizosphere | LDDDNRPPICPRCGVTLVPAALSADDKHESDWVCLECEDLDEDE* |
Ga0157370_101442172 | 3300013104 | Corn Rhizosphere | MEGDDQPPVCAGCGVTLVPAALSAVQGAVKGRDGDWACLECEELGEDV* |
Ga0157369_123454071 | 3300013105 | Corn Rhizosphere | PICPVCGVTMVPAALSAEERAEGDWVCLECEEAGEEV* |
Ga0157378_116763272 | 3300013297 | Miscanthus Rhizosphere | SGARNTHSVDDDDRPPICPRCGVTMVPAVLSADGDHQGDWVCLECEELDEE* |
Ga0157378_118482112 | 3300013297 | Miscanthus Rhizosphere | CPRCGVTLVPAALSADDKRESDWVCLECEELDEDE* |
Ga0157372_100218892 | 3300013307 | Corn Rhizosphere | MEDDDQPPICARCGVTLVPAALSAVEGAVKGRDSDWACLECEELGEDV* |
Ga0157372_101471395 | 3300013307 | Corn Rhizosphere | MDDDRPPICPRCGVTLVPAELSAGDKHDGDWVCLECEELDGET* |
Ga0157372_125184731 | 3300013307 | Corn Rhizosphere | RPRVKVHDDERPPICPRCGVTLVPAALSADDKHESDWVCLECEELDEDE* |
Ga0157372_128025651 | 3300013307 | Corn Rhizosphere | VDDDRAPICPVCGVTMVPAALSADERAEGEWVCLECEEAGEEV* |
Ga0157372_134595072 | 3300013307 | Corn Rhizosphere | MRDDDRPPICPSCGVTMVPGALSAAAGPADEWVCLECEELGDEPRVS* |
Ga0182008_108098781 | 3300014497 | Rhizosphere | DGMEDDDQPPICARCGVTLVPAALSAVEGAVKGRDSDWVCLECEELGEDV* |
Ga0120170_10980931 | 3300014823 | Permafrost | GVEDDDRPPICPRCGVTMVPAALSADDNREGDWVCLECEELDEDG* |
Ga0167646_10766381 | 3300015192 | Glacier Forefield Soil | MRDDDRPPICPRCGVTMVPAALSAEDRHEGDWVCLECEELDEKES* |
Ga0132258_101446567 | 3300015371 | Arabidopsis Rhizosphere | MARAEDPDDRPPICATCGVTMLPAALSASEGSDGEWVCLECEELDEER* |
Ga0132258_107671226 | 3300015371 | Arabidopsis Rhizosphere | MADDRPPICATCGVTMVPAALSADGNHDGEWVCLECEELNEDK* |
Ga0132258_110855813 | 3300015371 | Arabidopsis Rhizosphere | MDEDDRPPICPRCGVTMVPAALSAGDHEGDWVCLECEELGEEW* |
Ga0132258_120532714 | 3300015371 | Arabidopsis Rhizosphere | MGEDDRPPICPRCGVTMVPAALSADDDPEGEWVCLECEELDEED* |
Ga0132258_136822321 | 3300015371 | Arabidopsis Rhizosphere | MDADDRPPICPRCGVTMVPAALSAEDEPEGDWVCLECEELDDEE* |
Ga0132256_1001893354 | 3300015372 | Arabidopsis Rhizosphere | VDDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEDE* |
Ga0132257_1004100201 | 3300015373 | Arabidopsis Rhizosphere | VDDDNRPPICPRCGVTLVPAALSAEDKRETDWVCLECEELDEDE* |
Ga0132255_1011697502 | 3300015374 | Arabidopsis Rhizosphere | ALGDTRCMDEDDRPPICPRCGVTMVPAALSAGDHEGDWVCLECEELGEEW* |
Ga0187809_103098862 | 3300017937 | Freshwater Sediment | MDDERPPICPRCGVTMVPATLSAEDARDGEWVCLECEELGEED |
Ga0187786_103627712 | 3300017944 | Tropical Peatland | MDDRPPICPTCGVTMVPAALSADEDATGDWICLECEETDAEAQ |
Ga0187785_100309413 | 3300017947 | Tropical Peatland | VDEDDRAPICPWCGVTMVPAALSAETDHDAEWVCLECEELDEER |
Ga0187777_100486922 | 3300017974 | Tropical Peatland | MRMNDDRPPICPRCGVTMVPVALSADEDPDGDWACLECEELGEDG |
Ga0066655_111821261 | 3300018431 | Grasslands Soil | RPPICPFCGVTMVPAALSAREVHNGEWVCLECEELDEER |
Ga0066667_104050932 | 3300018433 | Grasslands Soil | MEDDRPPICPRCGVTMVPAALSADDTHEGDWVCVECEELDEA |
Ga0066662_100033917 | 3300018468 | Grasslands Soil | VHEDRPPICLRCGVTMVPAALSAIASGDGDWVCLECEELGEEE |
Ga0066662_100034116 | 3300018468 | Grasslands Soil | MRIPRDDERPPICPVCGVTMVPAALSATGETGDDWVCLECEELEESDR |
Ga0066662_116038631 | 3300018468 | Grasslands Soil | MADDDRPPICPRCGVTMVPAALSADDAHAGDWVCLECEELGEE |
Ga0066662_121490732 | 3300018468 | Grasslands Soil | PDTQSMRDDDRPPICPRCGVTMVPAALSAGESPDGDWVCLECEELDEDEG |
Ga0066669_112493882 | 3300018482 | Grasslands Soil | MTADDRPPICPRCGVTMVPAALSADDTHEGDWVCVECEELDET |
Ga0173482_101049462 | 3300019361 | Soil | LDDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEDE |
Ga0173482_102157881 | 3300019361 | Soil | PPICATCGVTMVPAALSSREDHDGEWVCLECEELDRSE |
Ga0193751_10242495 | 3300019888 | Soil | MDEDDRPPICPRCGVTMVPAALSADDKHEGDWVCLECEELDEDE |
Ga0193751_10503302 | 3300019888 | Soil | VEDDDRPPICPRCGVTMVPAALSADDDPEGEWVCLECEELDDES |
Ga0197907_104349162 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDDDQPPICARCGVTLVPAALSAVQGAVKGRDGDWACLECEELGEDV |
Ga0197907_114371092 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VVDEDDEDRPPICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT |
Ga0206356_104198612 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDERAPICPVCGVTMVPAALSAEEVEGDWVCLECEEAGEDV |
Ga0206353_104510952 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEDDEDRPPICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT |
Ga0154015_12531251 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | PGDTHAMDDDRPPICPRCGVTLVPAELSAGDEHDGDWVCLECEELDGET |
Ga0213877_102502781 | 3300021372 | Bulk Soil | MKPLHDADRPPICPRCGVTMVPAELSADDEHEGDWVCLECEEL |
Ga0213876_103885182 | 3300021384 | Plant Roots | MSDDDRPPICLACGVTMVPVALSAEDAHTGDWVCLECEELGEDSARA |
Ga0126371_103316792 | 3300021560 | Tropical Forest Soil | VTSDSGTVDDRPPICPRCGVTMVPAALSADEDHEGEWVCLECEELAEEE |
Ga0126371_120133611 | 3300021560 | Tropical Forest Soil | MDDDDRPPICLRCGVTMVPAALSADDGHEGDWVCLECEELDQEQ |
Ga0247693_10450012 | 3300024181 | Soil | MSADERPPICPRCGVTMVPAALSADAEPEGDWVCLECEELNEEE |
Ga0208219_10005158 | 3300025625 | Arctic Peat Soil | MRTMPDDERPPICPACGVTMVPAALSAENEKAGEWVCLECEELEEPDGV |
Ga0207705_100497413 | 3300025909 | Corn Rhizosphere | MDDDRPPICPRCGVTLVPAELSAGDKHDGDWVCLECEELDGET |
Ga0207705_108680472 | 3300025909 | Corn Rhizosphere | MDDRPPICPRCGVTMVPAALSADAEREGDWVCLECEELGEDA |
Ga0207705_112835362 | 3300025909 | Corn Rhizosphere | VDEEDRPPICPRCGVTMVPAALSADDEHEGEWVCLECEELGEDA |
Ga0207654_106977122 | 3300025911 | Corn Rhizosphere | VVDEDDEHRPPICPRCGVTMVPAELSADDGHDGEWVCLECEELGEDT |
Ga0207707_100470882 | 3300025912 | Corn Rhizosphere | VDEDDEDRPPICPRCGVTMVPAELSADDGHDGEWVCLECEELGEDT |
Ga0207707_104610093 | 3300025912 | Corn Rhizosphere | LDDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEEK |
Ga0207707_108429752 | 3300025912 | Corn Rhizosphere | MDDDRPPICPRCGVTLVPAELSAGDEHDGDWVCLECEELDGET |
Ga0207707_113375551 | 3300025912 | Corn Rhizosphere | DDDRPPICPRCGVTMVPAALSADEHGDGDWACLECEELGEEG |
Ga0207695_113924591 | 3300025913 | Corn Rhizosphere | PICPRCGVTMVPATLSAEDKTGDWVCLECEELGDDE |
Ga0207693_100607991 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DRPPICPRCGVTMVPAALSADDKHEGEWVCLECEELGEEE |
Ga0207693_102308542 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VTERDDERPPICPRCGVTMVPAALSADDTREGDWVCLECEELDEAE |
Ga0207663_100287992 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEDDRPPICPRCGVTMVPAALSADDKHEGEWVCLECEELTEEE |
Ga0207660_100879004 | 3300025917 | Corn Rhizosphere | MDDDRPPICPRCGVTLVPAELSAGDEHDGDWVCLECEELDGE |
Ga0207660_106881821 | 3300025917 | Corn Rhizosphere | DTHALDDDRPPICPRCGVTLVPAELSAGDEHDGDWVCLECEELDGET |
Ga0207660_116052781 | 3300025917 | Corn Rhizosphere | PPICLRCGVTMVPAALSADEEHEGEWVCLECEELDEEK |
Ga0207657_103509582 | 3300025919 | Corn Rhizosphere | VDEDDEDRPPICPRCGVTMVPAALSADDRHEGEWVCLECEELGEDT |
Ga0207652_107053172 | 3300025921 | Corn Rhizosphere | VVDEDDEGRPPICPRCGVTMVPAELSADDGHDGEWVCLECEELGEDT |
Ga0207652_109226571 | 3300025921 | Corn Rhizosphere | MDDDERPPICARCGVTMVPAALSADDRHEGDWVCLECEELDEDE |
Ga0207646_100023825 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDDDRPPICPRCGVTMVPAALSADDKHEGEWVCLECEELDEDE |
Ga0207687_103934563 | 3300025927 | Miscanthus Rhizosphere | VKVHDDERPPICPRCGVTLVPAALSADDKHESDWVCLECEELDEDE |
Ga0207687_105132333 | 3300025927 | Miscanthus Rhizosphere | RDTHGLDDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEDE |
Ga0207700_104511693 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MADDRPPICATCGVTMVPAALSADEDHEGEWVCLECEELDEDR |
Ga0207700_110288182 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VRDDRPPICPTCGVTMVPAALSADEENEDEWVCLECEEHPAET |
Ga0207664_107868282 | 3300025929 | Agricultural Soil | MTQRDDDRPPICPRCGVTMVPAALSADENRDGDWVCLECEELDEAE |
Ga0207664_108440282 | 3300025929 | Agricultural Soil | MEDDDQPPICARCGVTLVPAALSAVEGAVKGRDSDWVCLECEELGEDV |
Ga0207664_108465612 | 3300025929 | Agricultural Soil | RPPICATCGVTMVPAALSADEDHEGEWVCLECEELDEDR |
Ga0207664_117862032 | 3300025929 | Agricultural Soil | VNEFDERPPICPRCGVTMVPSALSAEDGRAGDWVCLECEELGEEPTY |
Ga0207644_106479513 | 3300025931 | Switchgrass Rhizosphere | MRDDDRPPICPRCGVTMVPAALSAEETTEGDWVCLECEELEDEEE |
Ga0207690_108655031 | 3300025932 | Corn Rhizosphere | VVDEDDEGRPPICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT |
Ga0207661_106735911 | 3300025944 | Corn Rhizosphere | DDRPPICPRCGVTMVPAVLSADGDHQGDWVCLECEELDEE |
Ga0207667_106548171 | 3300025949 | Corn Rhizosphere | LDDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEGE |
Ga0208142_10118832 | 3300025994 | Rice Paddy Soil | VDEEDRPPICPRCGVTMVPAALSADDEHEGQWVCLECEELGEDA |
Ga0207702_102842351 | 3300026078 | Corn Rhizosphere | MDEDDRPPICPRCGVTMVPAALSADDKHEGEWVCLECEELGEED |
Ga0207702_108523903 | 3300026078 | Corn Rhizosphere | AVDEEDRPPICPGCGVTLVPAALSADDEHEGEWVCLECEDRGEDG |
Ga0207702_125025592 | 3300026078 | Corn Rhizosphere | MVEGDEPPICPRCGVTMVPAALSADPGVTGDWVCLECEALGEDLAS |
Ga0207674_105661333 | 3300026116 | Corn Rhizosphere | MDDDRPPICPRCGVTLVPAELSAGDKHDADWVCLECEEL |
Ga0207683_118154911 | 3300026121 | Miscanthus Rhizosphere | GGDTHGLDDDNRPPICPRCGVTLVPAALSADDKRESDWVCLECEELDEDE |
Ga0207698_102150971 | 3300026142 | Corn Rhizosphere | PAPDTDVVDEDDEGRPPICPRCGVTMVPAALSADDGHDGEWVCLECEELGEDT |
Ga0209687_12788591 | 3300026322 | Soil | DERPPICPVCGVTMVPAALSATGEKAGDWVCLECEELPASEEER |
Ga0209474_102034612 | 3300026550 | Soil | MEADDRPPICLRCGVTMVPAALSAGADPDGDWVCLECEELNEEE |
Ga0209577_101478863 | 3300026552 | Soil | VEDDDRPPICPRCGVTMVPAALSADDDPEGEWVCLECEELDEES |
Ga0209577_104120423 | 3300026552 | Soil | MDDDDRPPICPRCGETMVPAALSADAKYEGDWVCLECEELDEDE |
Ga0207582_10185192 | 3300026960 | Soil | VDDDNRPPICPRCGVTLVPAALSADDNHESDWVCLECEELDENE |
Ga0209622_10922571 | 3300027502 | Forest Soil | HDNRPPICPRCGVTMVPAALSAGDKQEGDWVCLECEELDEDE |
Ga0209810_100228327 | 3300027773 | Surface Soil | VQDEDRPPICPRCGVTMVPAELSADDKRDDDWVCLECEELGEDD |
Ga0209060_100544093 | 3300027826 | Surface Soil | VSFEDRPPICPCCGVTMVPAALSAEDDPDGDWVCLECEELDEDE |
Ga0209060_104587501 | 3300027826 | Surface Soil | VNDDRPPICPRCGVTTVPAALSAEGGHDGDWVCLECEALGEEP |
Ga0209580_101809073 | 3300027842 | Surface Soil | VDEDDDRPPICPVCGVTMVPAALSALDDTDGDWVCLECEERDEA |
Ga0209579_10000004219 | 3300027869 | Surface Soil | MRDDDRPPICPRCGVTMVPAALSAGGRHEGDWVCLECEERNEDED |
Ga0209068_101201642 | 3300027894 | Watersheds | VEAVDDPVGDRAPICPRCGVTMVPAALSASEAPEGDWVCLECEELDEGDAQ |
Ga0207428_106454282 | 3300027907 | Populus Rhizosphere | DNRPPICPRCAVTLVPAVLSADDNHESDWVCLECEELDEDE |
Ga0265319_10654892 | 3300028563 | Rhizosphere | VDDRPPICPRCGVTMVPAELSAAADPEGDWVCLECEELDEDE |
Ga0265334_100534613 | 3300028573 | Rhizosphere | MHDDDRPPICPRCGVTMVPAALSAEDTHEGDWVCLECEELDDEES |
Ga0307323_101915502 | 3300028787 | Soil | MDADDRPPICPRCGVTMVPAALSADDKHEGDWVCLECEELDEEE |
Ga0265338_100051977 | 3300028800 | Rhizosphere | MHDDDRPPICPRCGVTMVPSALSAEDAHEGDWVCLECEELDDEES |
Ga0265338_106627581 | 3300028800 | Rhizosphere | RDDDRPPICPRCGVTMVPSALSAGEDTAGDWVCLECEELDEPE |
Ga0265338_107255682 | 3300028800 | Rhizosphere | MHDDDRPPICPRCGVTMVPAALSAEDAHEGDWVCLECEELDEDED |
Ga0307277_102024592 | 3300028881 | Soil | MDENDRPPICLRCGVTMVPAALSADDDPVGDWVCLECEELGEDSAL |
Ga0307277_104369912 | 3300028881 | Soil | MDADDRPPICPRCGVTMVPAALSADDRHEGDWVCLECEELDEEE |
Ga0311347_109022491 | 3300029923 | Fen | GPSEDDRPPICSACGVTMVPAALSAEAGRHAEWVCLECEESGEPES |
Ga0307500_101057522 | 3300031198 | Soil | VDDDDRPPICPRCGVTLVPAALSADDKQESDWVCLECEELDEDE |
Ga0307497_106469431 | 3300031226 | Soil | VDDDDRPPICPRCGVTLVPAALSVDDKQESDWVCLECEELDEDE |
Ga0170824_1105151252 | 3300031231 | Forest Soil | VDDGNRPPICPRCGVTMVPAALSADDTHEGDWVCVECEERDEQE |
Ga0318538_107856912 | 3300031546 | Soil | MSTAAIETDDRPPICPRCGVTMVPAALSADDNRDGDWVCLECEELDEED |
Ga0318515_105972962 | 3300031572 | Soil | DRPPICGTCGVTMVPAALSADQDHDGEWVCLECEELGEER |
Ga0307372_100350451 | 3300031671 | Soil | MPNDGRPPICPRCGVTMVPAALSAGDTHDGDWVCLECEELDDEES |
Ga0318511_102936064 | 3300031845 | Soil | LVARDEPPICPRCGVTMVPAALSADDSHEGEWVCLECEELDEQD |
Ga0308175_10000031119 | 3300031938 | Soil | MPDDERPPICARCGVTMVPAALSADEGHGGDWVCLECEELDEDE |
Ga0308175_1000100443 | 3300031938 | Soil | MDDDRPPICPRCGVTLVPASLSAHAELHGEWVCLECEELDEEV |
Ga0308175_1000194404 | 3300031938 | Soil | MDDDDRPPICPRCGVTMVPAALSADDDREGDWVCLECEELGEEK |
Ga0308175_1001114803 | 3300031938 | Soil | MAADMPFVTPGMDAGDRPPICPRCGVTMVPAALSADDEPEGDWVCLECEELDEDE |
Ga0308174_103310542 | 3300031939 | Soil | MAADDRPPICPRCGVTMVPGALSADDKHEGDWVCLECEELDEEE |
Ga0308174_116160412 | 3300031939 | Soil | DERPPICARCGVTMVPAALSADEGHGGDWVCLECEELDEDE |
Ga0308176_108905383 | 3300031996 | Soil | MDDDDRPPICPRCGVTMVPAALSADDDRAGDWVCLECEELGEEK |
Ga0306922_103629061 | 3300032001 | Soil | CPRCGVTMVPAALSADDQPEGDWVCLECEELDDSRRSGER |
Ga0307471_1013709262 | 3300032180 | Hardwood Forest Soil | MNDDDRPPICPRCGVTMVPATLSADDKHEGEWVCLECEELDEER |
Ga0335085_100119276 | 3300032770 | Soil | VDAEDRPPICPRCGVTMAPAALSADDKQGGEWVCLECEELDEET |
Ga0335085_103176702 | 3300032770 | Soil | VDEEDRPPICPRCGVTMVPAALSADDDHEGEWVCLECEELGEDL |
Ga0335080_102650632 | 3300032828 | Soil | VDEEGRPPICPRCGVTMVPAALSADDDHEGEWVCLECEELGEDL |
Ga0335070_112189812 | 3300032829 | Soil | MDDDRPPICPRCGVTMVPSALSAGDGRDGDWVCLECEELGEGD |
Ga0335083_105972822 | 3300032954 | Soil | MDDDRPPICPRCGVTMVPSALSADDGRNGDWVCLECEELDEGDWTD |
Ga0335076_115824322 | 3300032955 | Soil | PICPRCGVTMVPATLSAEDAPAGEWVCLECEELGQED |
Ga0335084_107065112 | 3300033004 | Soil | RLPSADDRPPICPRCGVTMVPAALSADEKPEGDWVCLECEELDEDE |
Ga0335084_111795821 | 3300033004 | Soil | VRVPSDDDRPPICPRCGVTMVPAALSADEKPEGDWVCLECEELDEDE |
Ga0335077_122289091 | 3300033158 | Soil | PPICPRCGVTMAPAALSADDKQDGEWVCLECEELDEET |
Ga0314868_012610_160_294 | 3300033758 | Peatland | MDDDDRPPICPRCGVTMVPAALSADDGHEGDWVCLECEELDEER |
⦗Top⦘ |