NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F009639

Metagenome / Metatranscriptome Family F009639

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009639
Family Type Metagenome / Metatranscriptome
Number of Sequences 315
Average Sequence Length 45 residues
Representative Sequence MRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGT
Number of Associated Samples 237
Number of Associated Scaffolds 315

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.38 %
% of genes near scaffold ends (potentially truncated) 99.68 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 226
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.206 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(8.571 % of family members)
Environment Ontology (ENVO) Unclassified
(36.190 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.270 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.44%    β-sheet: 0.00%    Coil/Unstructured: 83.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 315 Family Scaffolds
PF00296Bac_luciferase 6.98
PF02446Glyco_hydro_77 3.17
PF00441Acyl-CoA_dh_1 2.22
PF01740STAS 1.90
PF13458Peripla_BP_6 1.90
PF04392ABC_sub_bind 1.59
PF02518HATPase_c 1.27
PF02515CoA_transf_3 1.27
PF01566Nramp 1.27
PF14031D-ser_dehydrat 1.27
PF02627CMD 0.95
PF028725_nucleotid_C 0.95
PF13378MR_MLE_C 0.95
PF01557FAA_hydrolase 0.95
PF13336AcetylCoA_hyd_C 0.95
PF03372Exo_endo_phos 0.95
PF00072Response_reg 0.95
PF01738DLH 0.95
PF05088Bac_GDH 0.95
PF08000bPH_1 0.95
PF08020DUF1706 0.95
PF015916PF2K 0.95
PF13561adh_short_C2 0.63
PF06808DctM 0.63
PF00005ABC_tran 0.63
PF01764Lipase_3 0.63
PF00561Abhydrolase_1 0.63
PF02770Acyl-CoA_dh_M 0.63
PF00300His_Phos_1 0.63
PF00043GST_C 0.63
PF04986Y2_Tnp 0.63
PF13343SBP_bac_6 0.63
PF15902Sortilin-Vps10 0.63
PF13379NMT1_2 0.63
PF028262-Hacid_dh_C 0.63
PF00266Aminotran_5 0.63
PF03466LysR_substrate 0.63
PF13365Trypsin_2 0.63
PF14520HHH_5 0.32
PF00582Usp 0.32
PF00873ACR_tran 0.32
PF03795YCII 0.32
PF01569PAP2 0.32
PF01636APH 0.32
PF01717Meth_synt_2 0.32
PF00211Guanylate_cyc 0.32
PF00067p450 0.32
PF00939Na_sulph_symp 0.32
PF01833TIG 0.32
PF09723Zn-ribbon_8 0.32
PF07719TPR_2 0.32
PF01553Acyltransferase 0.32
PF02574S-methyl_trans 0.32
PF08241Methyltransf_11 0.32
PF13366PDDEXK_3 0.32
PF04366Ysc84 0.32
PF04143Sulf_transp 0.32
PF12399BCA_ABC_TP_C 0.32
PF00114Pilin 0.32
PF01817CM_2 0.32
PF11745DUF3304 0.32
PF07973tRNA_SAD 0.32
PF10137TIR-like 0.32
PF04828GFA 0.32
PF00692dUTPase 0.32
PF13683rve_3 0.32
PF00487FA_desaturase 0.32
PF00881Nitroreductase 0.32
PF12697Abhydrolase_6 0.32
PF12225DUF5981 0.32
PF02805Ada_Zn_binding 0.32
PF01804Penicil_amidase 0.32
PF00903Glyoxalase 0.32
PF00486Trans_reg_C 0.32
PF16868NMT1_3 0.32
PF12439GDE_N 0.32
PF02811PHP 0.32
PF13181TPR_8 0.32
PF12276DUF3617 0.32
PF12850Metallophos_2 0.32
PF07883Cupin_2 0.32
PF07690MFS_1 0.32
PF13442Cytochrome_CBB3 0.32
PF12973Cupin_7 0.32
PF13185GAF_2 0.32
PF00106adh_short 0.32
PF02604PhdYeFM_antitox 0.32
PF00496SBP_bac_5 0.32
PF04228Zn_peptidase 0.32
PF02538Hydantoinase_B 0.32
PF09084NMT1 0.32
PF01323DSBA 0.32
PF00701DHDPS 0.32
PF07730HisKA_3 0.32
PF04186FxsA 0.32
PF13538UvrD_C_2 0.32
PF10518TAT_signal 0.32
PF07366SnoaL 0.32

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 315 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 6.98
COG16404-alpha-glucanotransferaseCarbohydrate transport and metabolism [G] 3.17
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 2.86
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.59
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 1.27
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 1.27
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.95
COG07372',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase familyDefense mechanisms [V] 0.95
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.95
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 0.95
COG4283Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domainGeneral function prediction only [R] 0.95
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 0.63
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 0.63
COG0435Glutathionyl-hydroquinone reductaseEnergy production and conversion [C] 0.63
COG0625Glutathione S-transferasePosttranslational modification, protein turnover, chaperones [O] 0.63
COG0471Di- and tricarboxylate antiporterCarbohydrate transport and metabolism [G] 0.32
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 0.32
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.32
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.32
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.32
COG0756dUTP pyrophosphatase (dUTPase)Defense mechanisms [V] 0.32
COG1055Na+/H+ antiporter NhaD or related arsenite permeaseInorganic ion transport and metabolism [P] 0.32
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 0.32
COG1605Chorismate mutaseAmino acid transport and metabolism [E] 0.32
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.32
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.32
COG2124Cytochrome P450Defense mechanisms [V] 0.32
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.32
COG2169Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domainsReplication, recombination and repair [L] 0.32
COG2321Predicted metalloproteaseGeneral function prediction only [R] 0.32
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.32
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.32
COG2391Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domainsGeneral function prediction only [R] 0.32
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.32
COG3030FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 familyGeneral function prediction only [R] 0.32
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 0.32
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.32
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.32
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.32
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.32
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.32
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.32
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.32

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.79 %
UnclassifiedrootN/A9.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps_contig94323.55736All Organisms → cellular organisms → Bacteria1234Open in IMG/M
2199352024|deeps__Contig_140510All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1381Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0478262All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100394304All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica861Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101823195All Organisms → cellular organisms → Bacteria3511Open in IMG/M
3300001431|F14TB_100706542All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300001431|F14TB_100898091All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1294Open in IMG/M
3300001431|F14TB_102522881All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300003669|LSCM4E_1019157Not Available1189Open in IMG/M
3300004156|Ga0062589_102206761All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300004267|Ga0066396_10098101All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300004463|Ga0063356_100071675All Organisms → cellular organisms → Bacteria3609Open in IMG/M
3300004633|Ga0066395_10294459All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium885Open in IMG/M
3300004633|Ga0066395_10357653All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300004633|Ga0066395_10733233All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005093|Ga0062594_101315876All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica726Open in IMG/M
3300005171|Ga0066677_10205061All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300005171|Ga0066677_10319745All Organisms → cellular organisms → Bacteria → Proteobacteria888Open in IMG/M
3300005178|Ga0066688_10427482All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300005289|Ga0065704_10313500All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica864Open in IMG/M
3300005294|Ga0065705_11091982All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium525Open in IMG/M
3300005331|Ga0070670_100384188All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300005332|Ga0066388_102019163All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300005332|Ga0066388_104282091All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005334|Ga0068869_100986296All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica733Open in IMG/M
3300005343|Ga0070687_100222623All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1157Open in IMG/M
3300005353|Ga0070669_100177247All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1665Open in IMG/M
3300005355|Ga0070671_100854233All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11794Open in IMG/M
3300005364|Ga0070673_102060177Not Available542Open in IMG/M
3300005434|Ga0070709_11731331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8511Open in IMG/M
3300005436|Ga0070713_100455512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F81202Open in IMG/M
3300005439|Ga0070711_100319593All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300005440|Ga0070705_101123774All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005441|Ga0070700_100842811All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11742Open in IMG/M
3300005468|Ga0070707_100524900All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium1146Open in IMG/M
3300005468|Ga0070707_101009456All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium797Open in IMG/M
3300005546|Ga0070696_100343070All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300005563|Ga0068855_100864075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8958Open in IMG/M
3300005587|Ga0066654_10558791Not Available631Open in IMG/M
3300005616|Ga0068852_101890049Not Available619Open in IMG/M
3300005713|Ga0066905_100913939All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria769Open in IMG/M
3300005719|Ga0068861_100173862All Organisms → cellular organisms → Bacteria1787Open in IMG/M
3300005719|Ga0068861_100961686All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales813Open in IMG/M
3300005719|Ga0068861_101189788Not Available737Open in IMG/M
3300005764|Ga0066903_100276409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2627Open in IMG/M
3300005764|Ga0066903_100735462All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300005764|Ga0066903_101651180All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300005764|Ga0066903_102513459All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300005764|Ga0066903_102782820All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300005764|Ga0066903_106005403All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium636Open in IMG/M
3300005764|Ga0066903_107024338All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium584Open in IMG/M
3300005764|Ga0066903_108560963All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium 888521Open in IMG/M
3300005836|Ga0074470_11618877All Organisms → cellular organisms → Bacteria1743Open in IMG/M
3300005841|Ga0068863_101005180All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300005843|Ga0068860_100968762All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300005843|Ga0068860_101552128All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales684Open in IMG/M
3300005983|Ga0081540_1022607All Organisms → cellular organisms → Bacteria3710Open in IMG/M
3300006049|Ga0075417_10022318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas stagni2537Open in IMG/M
3300006050|Ga0075028_100163299All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300006059|Ga0075017_100451235Not Available971Open in IMG/M
3300006163|Ga0070715_10834607Not Available562Open in IMG/M
3300006173|Ga0070716_101317861All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales584Open in IMG/M
3300006237|Ga0097621_101964300All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales559Open in IMG/M
3300006358|Ga0068871_101935656Not Available561Open in IMG/M
3300006845|Ga0075421_100659900All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1221Open in IMG/M
3300006845|Ga0075421_100930043All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300006846|Ga0075430_101352490All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006904|Ga0075424_100667716All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300006969|Ga0075419_10174522All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300009012|Ga0066710_102446347All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300009082|Ga0105099_10360526All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales861Open in IMG/M
3300009090|Ga0099827_10346225All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium1264Open in IMG/M
3300009094|Ga0111539_10218689Not Available2219Open in IMG/M
3300009095|Ga0079224_101948181Not Available834Open in IMG/M
3300009100|Ga0075418_11938021Not Available641Open in IMG/M
3300009101|Ga0105247_10963775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300009143|Ga0099792_10915280All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300009148|Ga0105243_10343867All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300009148|Ga0105243_10999058All Organisms → cellular organisms → Bacteria → Proteobacteria839Open in IMG/M
3300009148|Ga0105243_12756654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria532Open in IMG/M
3300009156|Ga0111538_10413294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY111709Open in IMG/M
3300009157|Ga0105092_10721818All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium581Open in IMG/M
3300009162|Ga0075423_10585956All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300009171|Ga0105101_10659397All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales521Open in IMG/M
3300009176|Ga0105242_10763876All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300009177|Ga0105248_10175079All Organisms → cellular organisms → Bacteria2419Open in IMG/M
3300009177|Ga0105248_10193274All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2293Open in IMG/M
3300009177|Ga0105248_11213466All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11853Open in IMG/M
3300009822|Ga0105066_1085887All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300009870|Ga0131092_10949163All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium701Open in IMG/M
3300010029|Ga0105074_1073648All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300010046|Ga0126384_12105162All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300010046|Ga0126384_12195661All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010047|Ga0126382_10265138All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300010358|Ga0126370_10617094All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia939Open in IMG/M
3300010358|Ga0126370_11352116Not Available670Open in IMG/M
3300010358|Ga0126370_11405575All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium659Open in IMG/M
3300010359|Ga0126376_10103091All Organisms → cellular organisms → Bacteria2181Open in IMG/M
3300010359|Ga0126376_10922577All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300010360|Ga0126372_11475542All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium715Open in IMG/M
3300010360|Ga0126372_11605173All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300010360|Ga0126372_13102603All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium516Open in IMG/M
3300010361|Ga0126378_12954031Not Available542Open in IMG/M
3300010362|Ga0126377_10068076All Organisms → cellular organisms → Bacteria3159Open in IMG/M
3300010366|Ga0126379_10641903All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1151Open in IMG/M
3300010366|Ga0126379_11877223All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300010366|Ga0126379_12044852All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium675Open in IMG/M
3300010366|Ga0126379_12223796All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium649Open in IMG/M
3300010373|Ga0134128_11823996All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Usitatibacteraceae → Usitatibacter → Usitatibacter rugosus669Open in IMG/M
3300010397|Ga0134124_10255834All Organisms → cellular organisms → Bacteria1613Open in IMG/M
3300010398|Ga0126383_11840261All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300010398|Ga0126383_12055201All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300010399|Ga0134127_12188812All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300010400|Ga0134122_11547368All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300010401|Ga0134121_11262492All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300010430|Ga0118733_108767108All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300011119|Ga0105246_12348114All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium522Open in IMG/M
3300011270|Ga0137391_11010536All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300012200|Ga0137382_10238184All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1259Open in IMG/M
3300012202|Ga0137363_10513787All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1007Open in IMG/M
3300012351|Ga0137386_10473012All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300012353|Ga0137367_10170134All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300012355|Ga0137369_10079810All Organisms → cellular organisms → Bacteria2747Open in IMG/M
3300012357|Ga0137384_10149274All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1956Open in IMG/M
3300012360|Ga0137375_10267029All Organisms → cellular organisms → Bacteria1569Open in IMG/M
3300012362|Ga0137361_10710856All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium917Open in IMG/M
3300012487|Ga0157321_1018305All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300012582|Ga0137358_10368569All Organisms → cellular organisms → Bacteria → Proteobacteria972Open in IMG/M
3300012582|Ga0137358_10582680All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300012900|Ga0157292_10321011All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300012922|Ga0137394_10223523All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300012922|Ga0137394_11066069All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300012923|Ga0137359_10502744Not Available1069Open in IMG/M
3300012929|Ga0137404_10933297All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium RIFCSPLOWO2_12_FULL_61_40792Open in IMG/M
3300012948|Ga0126375_10552181All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium870Open in IMG/M
3300012948|Ga0126375_11386487All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012971|Ga0126369_12094902All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium653Open in IMG/M
3300012971|Ga0126369_12222950All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300012971|Ga0126369_12243583All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter633Open in IMG/M
3300012971|Ga0126369_13398466All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300012989|Ga0164305_10549074Not Available919Open in IMG/M
3300013102|Ga0157371_10139646All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1726Open in IMG/M
3300013105|Ga0157369_10888148All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium914Open in IMG/M
3300013297|Ga0157378_11715823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae675Open in IMG/M
3300013307|Ga0157372_10024769All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → Rubrivivax benzoatilyticus6521Open in IMG/M
3300013307|Ga0157372_10192926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2359Open in IMG/M
3300013307|Ga0157372_11291076Not Available842Open in IMG/M
3300014325|Ga0163163_11457383All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300014325|Ga0163163_11509248All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300014326|Ga0157380_10600775All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300014326|Ga0157380_13549679All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300014502|Ga0182021_11238941All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300014968|Ga0157379_10611382All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300014968|Ga0157379_11784295All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium604Open in IMG/M
3300015241|Ga0137418_10304570All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300015371|Ga0132258_10517254All Organisms → cellular organisms → Bacteria → Proteobacteria2987Open in IMG/M
3300015371|Ga0132258_10663062All Organisms → cellular organisms → Bacteria2624Open in IMG/M
3300015371|Ga0132258_13147992All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300015372|Ga0132256_101293199All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium842Open in IMG/M
3300015372|Ga0132256_101934463All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300015373|Ga0132257_101365716All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300015373|Ga0132257_101840155All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales778Open in IMG/M
3300015373|Ga0132257_102643976All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300015373|Ga0132257_104251493All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300015374|Ga0132255_102486926All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300015374|Ga0132255_106015113All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium513Open in IMG/M
3300016341|Ga0182035_10684170All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300016341|Ga0182035_10907999All Organisms → cellular organisms → Bacteria → Proteobacteria777Open in IMG/M
3300016371|Ga0182034_10740309All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300016422|Ga0182039_10296585All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300017792|Ga0163161_10021611All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4522Open in IMG/M
3300017965|Ga0190266_10288574All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11848Open in IMG/M
3300017965|Ga0190266_11342153All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11505Open in IMG/M
3300018000|Ga0184604_10345585All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300018058|Ga0187766_10891735All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium627Open in IMG/M
3300018060|Ga0187765_10516412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii758Open in IMG/M
3300018071|Ga0184618_10043631All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300018084|Ga0184629_10033989Not Available2228Open in IMG/M
3300018084|Ga0184629_10692848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Aldersonia → unclassified Aldersonia → Aldersonia sp.513Open in IMG/M
3300019879|Ga0193723_1105564All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300020082|Ga0206353_11841651All Organisms → cellular organisms → Bacteria → Proteobacteria1654Open in IMG/M
3300020596|Ga0163149_10472233All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300021082|Ga0210380_10265533All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11779Open in IMG/M
3300021088|Ga0210404_10694285All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium580Open in IMG/M
3300021168|Ga0210406_11213319All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300021170|Ga0210400_10021730All Organisms → cellular organisms → Bacteria5006Open in IMG/M
3300021403|Ga0210397_11197869All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium590Open in IMG/M
3300021445|Ga0182009_10168355All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY111051Open in IMG/M
3300021474|Ga0210390_10674075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales863Open in IMG/M
3300021560|Ga0126371_10590251All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1260Open in IMG/M
3300021560|Ga0126371_12920458All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300022694|Ga0222623_10226029All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300023261|Ga0247796_1047412All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300024056|Ga0124853_1160109All Organisms → cellular organisms → Bacteria2176Open in IMG/M
3300025321|Ga0207656_10633540All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11546Open in IMG/M
3300025907|Ga0207645_11086818Not Available540Open in IMG/M
3300025912|Ga0207707_10724470All Organisms → cellular organisms → Bacteria → Proteobacteria834Open in IMG/M
3300025916|Ga0207663_10998452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria671Open in IMG/M
3300025916|Ga0207663_11038088All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300025917|Ga0207660_11724156All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025920|Ga0207649_10828731All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium723Open in IMG/M
3300025920|Ga0207649_11472473All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300025923|Ga0207681_10620185All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300025924|Ga0207694_10120532All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2094Open in IMG/M
3300025930|Ga0207701_11434694All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300025931|Ga0207644_10779269All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300025933|Ga0207706_10345023All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1295Open in IMG/M
3300025935|Ga0207709_10500841All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300025938|Ga0207704_10801476All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales786Open in IMG/M
3300025941|Ga0207711_10122165All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2326Open in IMG/M
3300025941|Ga0207711_10387604All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1297Open in IMG/M
3300025941|Ga0207711_11769747All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium561Open in IMG/M
3300025945|Ga0207679_11364157Not Available651Open in IMG/M
3300025981|Ga0207640_11370940All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11633Open in IMG/M
3300025986|Ga0207658_10018172All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4851Open in IMG/M
3300025986|Ga0207658_10371189All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300026023|Ga0207677_10032884All Organisms → cellular organisms → Bacteria3339Open in IMG/M
3300026023|Ga0207677_12232554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 3P27F8509Open in IMG/M
3300026088|Ga0207641_10151967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2097Open in IMG/M
3300026088|Ga0207641_10864908All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium897Open in IMG/M
3300026088|Ga0207641_12260417Not Available544Open in IMG/M
3300026116|Ga0207674_11052673All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium783Open in IMG/M
3300026121|Ga0207683_10141671All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2167Open in IMG/M
3300026121|Ga0207683_10900199All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300026142|Ga0207698_10378974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1345Open in IMG/M
3300026142|Ga0207698_11349967All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales728Open in IMG/M
3300026342|Ga0209057_1232647All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300026354|Ga0257180_1005857Not Available1352Open in IMG/M
3300026369|Ga0257152_1029386All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium591Open in IMG/M
3300026489|Ga0257160_1035976All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium830Open in IMG/M
3300026538|Ga0209056_10083586All Organisms → cellular organisms → Bacteria2681Open in IMG/M
3300027169|Ga0209897_1006077All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300027384|Ga0209854_1022146All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300027577|Ga0209874_1011622All Organisms → cellular organisms → Bacteria2576Open in IMG/M
3300027654|Ga0209799_1139332All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium552Open in IMG/M
3300027727|Ga0209328_10160192All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium683Open in IMG/M
3300027775|Ga0209177_10157695All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300027846|Ga0209180_10615585All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.599Open in IMG/M
3300027899|Ga0209668_10118330Not Available1567Open in IMG/M
3300027909|Ga0209382_10540346All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1278Open in IMG/M
3300027910|Ga0209583_10000056All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales34920Open in IMG/M
(restricted) 3300028043|Ga0233417_10639213All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium509Open in IMG/M
3300028790|Ga0307283_10191177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria582Open in IMG/M
3300028870|Ga0302254_10108514All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1015Open in IMG/M
3300028878|Ga0307278_10359343All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300029907|Ga0311329_10611337All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium721Open in IMG/M
3300029987|Ga0311334_11843695All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300029989|Ga0311365_11852932All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300029990|Ga0311336_10249961All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1456Open in IMG/M
3300030019|Ga0311348_10289254Not Available1222Open in IMG/M
3300030339|Ga0311360_10843452Not Available727Open in IMG/M
3300030838|Ga0311335_10666265Not Available731Open in IMG/M
3300031231|Ga0170824_117268238Not Available711Open in IMG/M
3300031232|Ga0302323_100419068All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300031232|Ga0302323_103049371All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300031562|Ga0310886_10384687Not Available824Open in IMG/M
3300031640|Ga0318555_10215903All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1035Open in IMG/M
3300031640|Ga0318555_10399247All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300031716|Ga0310813_12001217All Organisms → cellular organisms → Bacteria → Acidobacteria → Holophagae → unclassified Holophagae → Holophagae bacterium546Open in IMG/M
3300031720|Ga0307469_11791370All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica593Open in IMG/M
3300031726|Ga0302321_102847692All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia eurypsychrophila565Open in IMG/M
3300031730|Ga0307516_10367790All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1101Open in IMG/M
3300031731|Ga0307405_10260513All Organisms → cellular organisms → Bacteria → Proteobacteria1295Open in IMG/M
3300031740|Ga0307468_100690139All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300031740|Ga0307468_100909948All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium764Open in IMG/M
3300031740|Ga0307468_101029227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium727Open in IMG/M
3300031740|Ga0307468_101612644All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Fluviicoccus → Fluviicoccus keumensis607Open in IMG/M
3300031770|Ga0318521_10454270All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300031792|Ga0318529_10455322All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300031819|Ga0318568_10523144All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300031820|Ga0307473_10055748All Organisms → cellular organisms → Bacteria1901Open in IMG/M
3300031820|Ga0307473_10133490All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300031820|Ga0307473_11033978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium602Open in IMG/M
3300031824|Ga0307413_11281990All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria640Open in IMG/M
3300031897|Ga0318520_10512434All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales741Open in IMG/M
3300031903|Ga0307407_11410195All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300031912|Ga0306921_11294665All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300031941|Ga0310912_10893570All Organisms → cellular organisms → Bacteria → Proteobacteria684Open in IMG/M
3300031943|Ga0310885_10918478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae502Open in IMG/M
3300031995|Ga0307409_100999766All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300031996|Ga0308176_12551682All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium545Open in IMG/M
3300032002|Ga0307416_100322267All Organisms → cellular organisms → Bacteria → Proteobacteria1548Open in IMG/M
3300032004|Ga0307414_11142620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus720Open in IMG/M
3300032005|Ga0307411_10614649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium936Open in IMG/M
3300032008|Ga0318562_10439224All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300032009|Ga0318563_10279947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium902Open in IMG/M
3300032025|Ga0318507_10442751All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300032064|Ga0318510_10507657All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300032068|Ga0318553_10542489All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium609Open in IMG/M
3300032074|Ga0308173_11334514All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300032074|Ga0308173_11600713All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → unclassified Piscinibacter → Piscinibacter sp. HJYY11613Open in IMG/M
3300032143|Ga0315292_11713095All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300032144|Ga0315910_11614994All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300032180|Ga0307471_100453662All Organisms → cellular organisms → Bacteria1422Open in IMG/M
3300032205|Ga0307472_102533540All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300032256|Ga0315271_10821465All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300032261|Ga0306920_101075522All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1168Open in IMG/M
3300032782|Ga0335082_10284160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1530Open in IMG/M
3300032782|Ga0335082_10446653All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300032782|Ga0335082_11125755Not Available651Open in IMG/M
3300032829|Ga0335070_10344007All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300032893|Ga0335069_12098821All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300033289|Ga0310914_10306812All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300033406|Ga0316604_10238296All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300033407|Ga0214472_11478492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium582Open in IMG/M
3300033418|Ga0316625_100308005All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1133Open in IMG/M
3300033418|Ga0316625_101437099All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales648Open in IMG/M
3300033434|Ga0316613_10053736All Organisms → cellular organisms → Bacteria → Proteobacteria2335Open in IMG/M
3300033481|Ga0316600_10050804All Organisms → cellular organisms → Bacteria → Proteobacteria2329Open in IMG/M
3300033482|Ga0316627_101466678Not Available688Open in IMG/M
3300033482|Ga0316627_101638755All Organisms → cellular organisms → Bacteria → Proteobacteria656Open in IMG/M
3300033488|Ga0316621_11212090All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium571Open in IMG/M
3300033551|Ga0247830_11733863All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300034147|Ga0364925_0404328All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300034160|Ga0370510_0126372All Organisms → cellular organisms → Bacteria781Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.49%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.86%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.22%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.22%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.59%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.59%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.59%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.27%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.27%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.95%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.63%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.63%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.63%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.63%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.63%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.63%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.32%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.32%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.32%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.32%
Coalbed WaterEnvironmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water0.32%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.32%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.32%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil0.32%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.32%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.32%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.32%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.32%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.32%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.32%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.32%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.32%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.32%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.32%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.32%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.32%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.32%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.32%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003669Coalbed water microbial communities from the Lithgow State Coal Mine, New South Wales, Australia (LSCM4 Early Sample 3)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009095Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010029Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020596Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026369Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-AEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027169Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027384Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034160Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
deeps_007847202199352024SoilMRAWTVDADDIRVADDFDESLLHRTPEIDAFLNSSRDDKFVVIGTKGFGK
deeps_025669902199352024SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIIIGTKGFGKT
ICChiseqgaiiDRAFT_047826233300000033SoilMRAWTVDADDIRVAEDLDEALLHRTPEIDNFLGLDRDDKFI
INPhiseqgaiiFebDRAFT_10039430413300000364SoilMRAWTVDADDIRVAEXFDEALLHRTPEIDSFLRQDRDDKFIVSATKG
INPhiseqgaiiFebDRAFT_10182319543300000364SoilMRAWTVDADDIRVAEDFDDALLHRTPEIDAFLNLDRDDKFIVIGTKGFGKTLLLK
F14TB_10070654213300001431SoilMRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGKT
F14TB_10089809113300001431SoilMRAWTVDADDIRVAEDFNESLLHHTPEIDGFLRSDRD
F14TB_10252288113300001431SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLNLDRDDKFIVIGTKGFGKT
LSCM4E_101915723300003669Coalbed WaterMRAWTVDADDIRVAEDFDAALLHRTPEIEEFLSHGGEKFVVIGTKGFGKTLLLKAKRVLTQRGG
Ga0062589_10220676113300004156SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKTLL
Ga0066396_1009810123300004267Tropical Forest SoilMRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTK
Ga0063356_10007167513300004463Arabidopsis Thaliana RhizosphereMRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIGTKGFGKTLL
Ga0066395_1029445923300004633Tropical Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIAT
Ga0066395_1035765313300004633Tropical Forest SoilMRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTKGFG
Ga0066395_1073323313300004633Tropical Forest SoilMRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVI
Ga0062594_10131587623300005093SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRQDRDDKFIVIATKG
Ga0066677_1020506123300005171SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKT
Ga0066677_1031974513300005171SoilMRAWTVDADDIRVAEDFNDSLLHRTPEIDGFLRSDRDDKFIVIGTKGFGK
Ga0066688_1042748223300005178SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVI
Ga0065704_1031350013300005289Switchgrass RhizosphereMRAWTVDADDIRVAEDFDDALLHRTPEIDSFLRPDRDDKFIVIGTKGFGKTL
Ga0065705_1109198213300005294Switchgrass RhizosphereMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTK
Ga0070670_10038418813300005331Switchgrass RhizosphereMRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGK
Ga0066388_10201916323300005332Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLLLKA
Ga0066388_10428209113300005332Tropical Forest SoilMRAWTVDADDIRVVEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLLLKA
Ga0068869_10098629623300005334Miscanthus RhizosphereMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRPDRDDKFIVIGTKGFGKTLL
Ga0070687_10022262313300005343Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPARDDKFIVIATKGF
Ga0070669_10017724733300005353Switchgrass RhizosphereMLVASSAGGERMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDD
Ga0070671_10085423323300005355Switchgrass RhizosphereMLVAIECPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLL
Ga0070673_10206017713300005364Switchgrass RhizosphereMRAWTVDADDIRVAEDFNESLLHRTPEIDAFLRSDRDDKFI
Ga0070709_1173133123300005434Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDKFIVIGTK
Ga0070713_10045551223300005436Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVEEDFDDSLLHRTPEISAFLRPDRDDKFIVIGT
Ga0070711_10031959323300005439Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATK
Ga0070705_10112377413300005440Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVAEDLDQSLLHRTPEIDDFLSPGGEKFVVIGTKG
Ga0070700_10084281123300005441Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFG
Ga0070707_10052490023300005468Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIATKG
Ga0070707_10100945623300005468Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKF
Ga0070696_10034307023300005546Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGKTL
Ga0068855_10086407523300005563Corn RhizosphereMRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDK
Ga0066654_1055879123300005587SoilMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTAHRDDKFIVIGTKGF
Ga0068852_10189004923300005616Corn RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDDFLRSDRDDK
Ga0066905_10091393923300005713Tropical Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLNPDRDDKFIVIGTKGFGKTL
Ga0068861_10017386213300005719Switchgrass RhizosphereMRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGT
Ga0068861_10096168613300005719Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKGFGKTL
Ga0068861_10118978813300005719Switchgrass RhizosphereMRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLERDDKFIVIGTKGF
Ga0066903_10027640973300005764Tropical Forest SoilMRPWTVDADDIRAADDFDETLLHRTPEIDAFLAPDR
Ga0066903_10073546213300005764Tropical Forest SoilMRAWTVDADDIRVAEDFDDALLHRTPEIDAFLSVDRDDKFVVIGTKGFGKTLLL
Ga0066903_10165118033300005764Tropical Forest SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL
Ga0066903_10251345913300005764Tropical Forest SoilMRPWTVDADDIRAADDFDETLLHRTPEIDAFLAPDRDDKFIVIGTKG
Ga0066903_10278282033300005764Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIG
Ga0066903_10600540313300005764Tropical Forest SoilMRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGTKGFGKT
Ga0066903_10702433813300005764Tropical Forest SoilMRAWTVDADDIRVAADFDDALLHRTPEIDSFLSLERDDKFIVIGTKGFGKTL
Ga0066903_10856096323300005764Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHHTPEIDSFLAADRDD
Ga0074470_1161887713300005836Sediment (Intertidal)MRAWTVDADDIRVAEDFTESLLHRTPEIEAFLRSD
Ga0068863_10100518013300005841Switchgrass RhizosphereMRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL
Ga0068860_10096876233300005843Switchgrass RhizosphereMRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKT
Ga0068860_10155212833300005843Switchgrass RhizosphereMRAWTVDADDIRVADDFDESLLHRTPEIDGFLTPARHDKFIVIGTKG
Ga0081540_102260733300005983Tabebuia Heterophylla RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRD
Ga0075417_1002231813300006049Populus RhizosphereMRAWTVDADEIRVAEDLDETLLHRTPEIDSFLSLKRDDKF
Ga0075028_10016329913300006050WatershedsMRAWTVDADDIQVAEDFNESLLHRTTEIESFLRSDRDDKFIVIGTKGFGKT
Ga0075017_10045123523300006059WatershedsMRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTL
Ga0070715_1083460713300006163Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVADDFDDSLLHRTPEIDGFLTPSRDDKFIVIATKGF
Ga0070716_10131786113300006173Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKTLL
Ga0097621_10196430023300006237Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPG
Ga0068871_10193565623300006358Miscanthus RhizosphereMRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIGTK
Ga0075421_10065990013300006845Populus RhizosphereMRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFIVIG
Ga0075421_10093004313300006845Populus RhizosphereMCHAPRNAAMRAWTVDADDIRVAEDFDEALLHRTPEIDGFLSLDRDDKFIVIGTKGFGKT
Ga0075430_10135249013300006846Populus RhizosphereMRAWTVDADDIRVAEDLDEALLHRTPEIDSFLSLDRDDKFIVIGTKGFGKTL
Ga0075424_10066771613300006904Populus RhizosphereMRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIA
Ga0075419_1017452233300006969Populus RhizosphereMRAWTVDADDIRVAEDFDDALLHRTPEIDNFLTFDRD
Ga0066710_10244634723300009012Grasslands SoilVDADDIRVAEDFDETLLHRTPEIDSFLNLERDDKFIVIGTKGFGRRCC
Ga0105099_1036052613300009082Freshwater SedimentMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDREDKF
Ga0099827_1034622513300009090Vadose Zone SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPD
Ga0111539_1021868923300009094Populus RhizosphereMRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSD
Ga0079224_10194818113300009095Agricultural SoilMRAWTVDADDIRVAEDFDAALLHRTPEIEEFLSLGGDKFVV
Ga0075418_1193802113300009100Populus RhizosphereMRAWTVDADDIRVAEDFDEALLHHTPEIDSFLNLERDDKF
Ga0105247_1096377523300009101Switchgrass RhizosphereMRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGT
Ga0099792_1091528013300009143Vadose Zone SoilMRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDR
Ga0105243_1034386713300009148Miscanthus RhizosphereMRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTLL
Ga0105243_1099905823300009148Miscanthus RhizosphereMRAWTVDADDIHVAEDFDASLPHRTPEIDTFLSPDRDDKFIV
Ga0105243_1275665413300009148Miscanthus RhizosphereMRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRD
Ga0111538_1041329413300009156Populus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKT
Ga0105092_1072181823300009157Freshwater SedimentMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDQFIVIGTK
Ga0075423_1058595613300009162Populus RhizosphereMRAWTVDADDIRVAEDFDDALLHRTPEIDNFLTFDRDDKFIVI
Ga0105101_1065939723300009171Freshwater SedimentMRAWTVDADDIRVAEDFDDALLHRTPEIDAFLTPD
Ga0105242_1076387623300009176Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGK
Ga0105248_1017507943300009177Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLLHK
Ga0105248_1019327413300009177Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKG
Ga0105248_1121346613300009177Switchgrass RhizosphereMLVAIECPEEVAMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLL
Ga0105066_108588723300009822Groundwater SandMRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFIVIGTKGFGKTLLL
Ga0131092_1094916313300009870Activated SludgeMRAWTVDADDIRVAEDFDAAVLHRTPEIEEFLSPGG
Ga0105074_107364813300010029Groundwater SandMRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTK
Ga0126384_1210516223300010046Tropical Forest SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDHDDKF
Ga0126384_1219566123300010046Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDTFLSLD
Ga0126382_1026513823300010047Tropical Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDDFLTRDRD
Ga0126370_1061709433300010358Tropical Forest SoilMRAWTVDADDIRVADDFNESLLHRTPEIDAFLRSDRDDKFIVIGT
Ga0126370_1135211623300010358Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKGFGKT
Ga0126370_1140557523300010358Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDR
Ga0126376_1010309113300010359Tropical Forest SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLLK
Ga0126376_1092257713300010359Tropical Forest SoilMRAWTVDADDIRVAEDFDDALLHRTPEIDGFLSPDRDDKFIV
Ga0126372_1147554213300010360Tropical Forest SoilMRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTLL
Ga0126372_1160517313300010360Tropical Forest SoilMRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKT
Ga0126372_1310260313300010360Tropical Forest SoilMRAWTVDADDIRVAEDFSDSLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTLL
Ga0126378_1295403123300010361Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPD
Ga0126377_1006807633300010362Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIA
Ga0126379_1064190323300010366Tropical Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIA
Ga0126379_1187722323300010366Tropical Forest SoilMRAWTVDADDVRVAEDFDDALLHRTPEIDTFLNLDRDDKFIVIGTKGFGK
Ga0126379_1204485223300010366Tropical Forest SoilMRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIATKGFGK
Ga0126379_1222379623300010366Tropical Forest SoilMRAWTVDADDIRVAADLDDALLHRTPEIDSFLSLKRDDKFIVIGTKGF
Ga0134128_1182399623300010373Terrestrial SoilMHAWTVDADDIRVADDFNDSLLHRTPEIDGFLRSDREDKFVIIGTKGFGKT
Ga0134124_1025583423300010397Terrestrial SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRQDRD
Ga0126383_1184026113300010398Tropical Forest SoilMRAWTVDADDIRVAEDFDESLLHHTPEIDSFLNSDRDDKFIVIGTKGFGKTL
Ga0126383_1205520113300010398Tropical Forest SoilMRAWTVDADDIRVAGDFDESLLHRTPEIETFLNPDRDDKFIVIGTK
Ga0134127_1218881223300010399Terrestrial SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLAPDRDDKFIVIATK
Ga0134122_1154736813300010400Terrestrial SoilMRSWTVDADDIKIAEDFDDALLHKPPWLEAFLSAGGDEKFIVIGTKGFGKTLLLKA
Ga0134121_1126249223300010401Terrestrial SoilMRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTKGFGK
Ga0118733_10876710823300010430Marine SedimentMRPWTIDADDIRIADDFDDQLLHRTPWIEDFLDPRDDKFIVVATKGFGKTLL
Ga0105246_1234811413300011119Miscanthus RhizosphereMRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIIIGTK
Ga0137391_1101053613300011270Vadose Zone SoilMRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDK
Ga0137382_1023818423300012200Vadose Zone SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVIGTKDSARRCC*
Ga0137363_1051378713300012202Vadose Zone SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKT
Ga0137386_1047301223300012351Vadose Zone SoilMRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGK
Ga0137367_1017013433300012353Vadose Zone SoilMRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDD
Ga0137369_1007981013300012355Vadose Zone SoilMRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFIVIGTKGFGKTL
Ga0137384_1014927433300012357Vadose Zone SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGFGK
Ga0137375_1026702933300012360Vadose Zone SoilVDADDIRVADDFDESLLHRTPEIESFLTPDRDDKFIVIATKGFGKTLLLKAIAHGIT
Ga0137361_1071085633300012362Vadose Zone SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIGTKGFGKT
Ga0157321_101830523300012487Arabidopsis RhizosphereMRAWTVDADDIRVADDFDESLLHRTPEIDSFLTPDR
Ga0137358_1036856933300012582Vadose Zone SoilMRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTK
Ga0137358_1058268023300012582Vadose Zone SoilMRAWTLDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATK
Ga0157292_1032101113300012900SoilMLVASSAGGERMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKT
Ga0137394_1022352313300012922Vadose Zone SoilMRAWTVDADDIRVAEDLDDALLHHTPEIDSFLNLD
Ga0137394_1106606913300012922Vadose Zone SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKF
Ga0137359_1050274413300012923Vadose Zone SoilMRAWTVDADDIRVAEDFNESLLHRTPEIDGFLSSDRDDKFIVIGTKGFGKTLLLK
Ga0137404_1093329723300012929Vadose Zone SoilMRAWTVDADDIRVAEDFDESLLHRTAEIDNFLAPDRDDKFIIIGTKG
Ga0126375_1055218123300012948Tropical Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVI
Ga0126375_1138648713300012948Tropical Forest SoilMRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTLL
Ga0126369_1209490223300012971Tropical Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRD
Ga0126369_1222295013300012971Tropical Forest SoilMRAWTVDADDIRVAGDFNESLLHRTPEIDSFLRSDRDDKFIVIGTKD
Ga0126369_1224358323300012971Tropical Forest SoilMRAWTVDADDIRVADDFDDTLLHRTPEIDGFLSSDRDDKFIVIGT
Ga0126369_1339846613300012971Tropical Forest SoilMRAWTVDADDIRVADDFNESLLHRTPEIEAFLRSDRDDKFIVIGTKGFGKTLL
Ga0164305_1054907413300012989SoilMRAWTVDAYYIRVAEDFNESLLHRTPEIDAFLRSDRDDKF
Ga0157371_1013964613300013102Corn RhizosphereMHAWTVDADDIRVADDFNDSLLHRTPEIDGFLRSDREDKFVIIGTK
Ga0157369_1088814823300013105Corn RhizosphereMRAWTVDADDIRVADDFDESLLHRTPEIDDFLRSDRDDKFIVIGTKGF
Ga0157378_1171582313300013297Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLSPGRDDKFIVIGTKGFGKT
Ga0157372_1002476963300013307Corn RhizosphereMRAWTVGADAIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTKGFGKTLLL
Ga0157372_1019292613300013307Corn RhizosphereMRAWTVDADDIRVADDFDESLLHRTPEIDAFLNSSRDDKFVVIGTKGFGKTL
Ga0157372_1129107623300013307Corn RhizosphereMRAWTVDADDIRVAEDFNESLLHRTPEIDAFLRSDRDDKFIVIGT
Ga0163163_1145738323300014325Switchgrass RhizosphereMRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPDRDD
Ga0163163_1150924813300014325Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDK
Ga0157380_1060077523300014326Switchgrass RhizosphereMLVAIQCPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGF
Ga0157380_1354967913300014326Switchgrass RhizosphereMRAWTVDADDIRVAEDFDEALLHRTPEIDNFLGLDRDDKFIVIGTKGFGKTLL
Ga0182021_1123894133300014502FenMRPWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDD
Ga0157379_1061138213300014968Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTL
Ga0157379_1178429513300014968Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPARDDKFIVIATK
Ga0137418_1030457033300015241Vadose Zone SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIV
Ga0132258_1051725413300015371Arabidopsis RhizosphereMRAWTVDADDIRVADDFDDSLLHRTPEIDGFLTPSRDDKFIVIATK
Ga0132258_1066306263300015371Arabidopsis RhizosphereMRAWTVDADDIRVAEDFNESLLHRTPEIDGFLSSDRDDKFIVIGTKGFG
Ga0132258_1314799233300015371Arabidopsis RhizosphereMRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGK
Ga0132256_10129319923300015372Arabidopsis RhizosphereMRAWTVDADDIQVAEDLSARDLHQTPGIEAFLAPQRGDKFIVVATKGFGKTLLLKA
Ga0132256_10193446313300015372Arabidopsis RhizosphereMRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIVIATKGFGKT
Ga0132257_10136571613300015373Arabidopsis RhizosphereMRAWTVDADDIRVAEDFDAALLHRTPEIDSFLTPDRDDKFIV
Ga0132257_10184015523300015373Arabidopsis RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPD
Ga0132257_10264397623300015373Arabidopsis RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGFGK
Ga0132257_10425149313300015373Arabidopsis RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRDDKFIV
Ga0132255_10248692623300015374Arabidopsis RhizosphereMRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKFIVIGT
Ga0132255_10601511313300015374Arabidopsis RhizosphereMRAWTVDADDIRVADDFDESLLHRTPEIDGFLSSDRDDKFVVIGTKGFGKT
Ga0182035_1068417013300016341SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIV
Ga0182035_1090799923300016341SoilMRAWTVDADDIQVAEDFNESLLHRTPEIEGFLGSDRDDKFIVIGTKGFGK
Ga0182034_1074030913300016371SoilMRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDRDDKF
Ga0182039_1029658533300016422SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKF
Ga0163161_1002161113300017792Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTK
Ga0190266_1028857413300017965SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTL
Ga0190266_1134215313300017965SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKF
Ga0184604_1034558513300018000Groundwater SedimentMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIGTKG
Ga0187766_1089173523300018058Tropical PeatlandMRAWTVDADDIRVVEDFDESLLCRTPEIDSFLTPD
Ga0187765_1051641223300018060Tropical PeatlandMRAWTVDADDIRVAEDFDESLLHHTPEIDGFLRSDRDD
Ga0184618_1004363123300018071Groundwater SedimentMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDDKFIVI
Ga0184629_1003398933300018084Groundwater SedimentMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDD
Ga0184629_1069284823300018084Groundwater SedimentMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLTPDRDD
Ga0193723_110556423300019879SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVI
Ga0206353_1184165113300020082Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIHVAEDFDASLLHRTPEIDTFLSPDRDDKFI
Ga0163149_1047223323300020596Freshwater Microbial MatMRAWTVDADDIRVAEDFDAGLLHRTPEIDDFLSPGGEKFVVIGTK
Ga0210380_1026553323300021082Groundwater SedimentMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIG
Ga0210404_1069428523300021088SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFI
Ga0210406_1121331923300021168SoilMRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKCIVIGTKGFGKTLLLK
Ga0210400_1002173063300021170SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIV
Ga0210397_1119786913300021403SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGF
Ga0182009_1016835523300021445SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLL
Ga0210390_1067407513300021474SoilMRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGK
Ga0126371_1059025133300021560Tropical Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATK
Ga0126371_1292045823300021560Tropical Forest SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTK
Ga0222623_1022602923300022694Groundwater SedimentMRAWTVDADDIRVAEDFDEALLHRTPEIDNFLGVDRDDKFIV
Ga0247796_104741213300023261SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFV
Ga0124853_116010913300024056Freshwater WetlandsMRAWTVDADDIRVAADFNEALLHRTPEIEGFLRADRDDKFIIIGTKGF
Ga0207656_1063354023300025321Corn RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGF
Ga0207645_1108681813300025907Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDNFLTPGHDDKFVVIGT
Ga0207707_1072447013300025912Corn RhizosphereMHAWTVDADDIRVADDFNDSLLHRTPEIDAFLRSDRDDKFVIIGTKGFGKTL
Ga0207663_1099845223300025916Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVAEDFSESLLHRTPEIEGFLRSDRDDKFIVIGTKGFG
Ga0207663_1103808823300025916Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVAEDFNESLLHRTPEIEGFLRSDRDDKFIVIGTKGFGKTLLL
Ga0207660_1172415623300025917Corn RhizosphereMRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTL
Ga0207649_1082873113300025920Corn RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGKTLLL
Ga0207649_1147247323300025920Corn RhizosphereMRAWTVDADDIRVPDDFDDSLLHRTPEIEGFLRSDRDDKFIVIGTKG
Ga0207681_1062018523300025923Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRD
Ga0207694_1012053233300025924Corn RhizosphereMRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPDRDDKFIVI
Ga0207701_1143469423300025930Corn, Switchgrass And Miscanthus RhizosphereMRAWTVDADDIRVADDFDDSLLHRTPEIDAFLTESRDDKFIVIATKGFGKTLLL
Ga0207644_1077926923300025931Switchgrass RhizosphereMRAWTVDADDIRVADDFDDSLLHRTPEIDAFLTESR
Ga0207706_1034502323300025933Corn RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFG
Ga0207709_1050084123300025935Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDD
Ga0207704_1080147623300025938Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKG
Ga0207711_1012216543300025941Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDK
Ga0207711_1038760423300025941Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPD
Ga0207711_1176974713300025941Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDD
Ga0207679_1136415723300025945Corn RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLAPGRDDKFIVIGTKGFGKTLLL
Ga0207640_1137094013300025981Corn RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDTFVVI
Ga0207658_1001817213300025986Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDDKFIVIGTKGFGKTLL
Ga0207658_1037118923300025986Switchgrass RhizosphereMRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPERDDKFIIIGTK
Ga0207677_1003288413300026023Miscanthus RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVI
Ga0207677_1223255413300026023Miscanthus RhizosphereMRAWTVDADDIRVEEDFDDSLLHRTPEISGFLRPDRDDKFIVIGTKGF
Ga0207641_1015196733300026088Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLRSDRD
Ga0207641_1086490823300026088Switchgrass RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIA
Ga0207641_1226041723300026088Switchgrass RhizosphereVASGSLEECMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIAT
Ga0207674_1105267323300026116Corn RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFIVIATKGF
Ga0207683_1014167113300026121Miscanthus RhizosphereMLVAIQCPGEVAMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVVIGTKGFGK
Ga0207683_1090019913300026121Miscanthus RhizosphereMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLSLD
Ga0207698_1037897413300026142Corn RhizosphereMRAWTVDADDIRVPEDFDDSLLHRTPEIEGFLRSDRDDKF
Ga0207698_1134996713300026142Corn RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGTKGF
Ga0209057_123264713300026342SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKGFGKTLLLKA
Ga0257180_100585723300026354SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDKFI
Ga0257152_102938613300026369SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRD
Ga0257160_103597623300026489SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKG
Ga0209056_1008358633300026538SoilMRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDD
Ga0209897_100607743300027169Groundwater SandMRAWTVDADDIRVAEDFDDALLHRTPEIDGFLTLDRDDKFIVIGTKGFGKTLL
Ga0209854_102214623300027384Groundwater SandMRAWTVDADDIRVAEDFDDALLHRTPEIDSFLNLDRDDKFI
Ga0209874_101162253300027577Groundwater SandMRAWTVDADDIRVAEDFDDALLHRTPEIDNFLNLDRDDKF
Ga0209799_113933213300027654Tropical Forest SoilMRAWTVDADDIRVAADFDDALLHRTPEIDSFLSLERDDKFIVIGTKGFGKTLLLKA
Ga0209328_1016019213300027727Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPG
Ga0209177_1015769513300027775Agricultural SoilMRAWTVDADDIRVAADFDEALLHRTPEIDSFLSVER
Ga0209180_1061558513300027846Vadose Zone SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLSPDRDDKFIVI
Ga0209668_1011833023300027899Freshwater Lake SedimentMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFI
Ga0209382_1054034623300027909Populus RhizosphereMRAWTVDADDIHVAEDFDASLLHRTPEIDAFLSPDRDDKFIVIG
Ga0209583_10000056373300027910WatershedsMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLAPERDDKFIVTGTKGFGKTLL
(restricted) Ga0233417_1063921323300028043SedimentMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLNPDRDDQFVVIGTKGFG
Ga0307283_1019117713300028790SoilMRAWTVDADDIQVAEDFNESLLHRTPEIEGFLRSDRDD
Ga0302254_1010851413300028870FenMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIVIGTKGFGKTLLL
Ga0307278_1035934313300028878SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGKTL
Ga0311329_1061133733300029907BogMRAWTVDADDIQVAEDFDESLLHRTPEIDGFLRSDRDGKFIVIGTKGFGKTLLLK
Ga0311334_1184369513300029987FenMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPDRDDKFIVIGT
Ga0311365_1185293213300029989FenMRAWTVDADDIRVAEDFDETLLHRTPEIDSFLAPDRDDKFIVIGT
Ga0311336_1024996113300029990FenMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRDDKFIV
Ga0311348_1028925423300030019FenMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIV
Ga0311360_1084345223300030339BogMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIG
Ga0311335_1066626523300030838FenMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGF
Ga0170824_11726823813300031231Forest SoilMRAWTVDADDIRVAEDFDDSLLHRTPEIDAFLTPGRD
Ga0302323_10041906833300031232FenMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPGRD
Ga0302323_10304937113300031232FenMRAWTVDADDIRVAEDFDETLLHRTPEIDSFLAPDR
Ga0310886_1038468713300031562SoilMRAWTVDADDIRVAEDFDEALLHRTPEIEAFLTPDR
Ga0318555_1021590333300031640SoilMRAWTVDADDIRVADDFDESLLHRTPEIDAFLTPGRDDKFIVIGTKGFGKT
Ga0318555_1039924713300031640SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLD
Ga0310813_1200121713300031716SoilMRPWTIDADDIQVAEDFDASLLHRTNWIDDFLAHGRDERFIVTGTKGFGKTL
Ga0307469_1179137023300031720Hardwood Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLRPDRDDKFIV
Ga0302321_10284769223300031726FenMRAWTVDADDIRVADDLDEALLHRTPEIEAFLSPE
Ga0307516_1036779023300031730EctomycorrhizaMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDREDKFIV
Ga0307405_1026051333300031731RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIDGFLTPDRDD
Ga0307468_10069013913300031740Hardwood Forest SoilMRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIGTKG
Ga0307468_10090994823300031740Hardwood Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDSFLTPDRDDK
Ga0307468_10102922713300031740Hardwood Forest SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDDFLTRDRDDKFIVIGTKGFGKTL
Ga0307468_10161264423300031740Hardwood Forest SoilMRAWTVDADDIRVADDFDESLLHRTPEIDAFLAPS
Ga0318521_1045427023300031770SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKG
Ga0318529_1045532223300031792SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRNDKFI
Ga0318568_1052314423300031819SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLTPDRDDKFIVIATKGF
Ga0307473_1005574823300031820Hardwood Forest SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIG
Ga0307473_1013349013300031820Hardwood Forest SoilMRAWTVDADDIRVAEDFDDTLLHHTPEIDSFLNLD
Ga0307473_1103397813300031820Hardwood Forest SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLNLERDD
Ga0307413_1128199023300031824RhizosphereMRAWTVDADDIRVAEDFDDALLHRTPEIEGFLTPGS
Ga0318520_1051243413300031897SoilMRAWTVDADDIRVADDFDESLLHRTPEIDAFLTPGRDDKF
Ga0307407_1141019513300031903RhizosphereMRAWTVDADDIRIAEDFDESLLHRTPEIDAFLRSDRDEKFI
Ga0306921_1129466523300031912SoilMRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDR
Ga0310912_1089357013300031941SoilMRAWTVDADDIQVAEDFNESLLHRTPEIDGFLRSDRDDKFIV
Ga0310885_1091847813300031943SoilMRAWTVDADDIRVAEDLDEALLHRTPEIDNFLSLDRDDKFIVIG
Ga0307409_10099976613300031995RhizosphereMRAWTVDADDIRVAEDFDEALLHRTPEIDSFLNLERDDKFIVIG
Ga0308176_1255168223300031996SoilMRAWTVDADDIRVAEDFDEALLHRTPEIVAFLTPDRDDKFI
Ga0307416_10032226733300032002RhizosphereMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPDRDDKFIVIGTKGFGKTLL
Ga0307414_1114262023300032004RhizosphereMRAWTVDADDIRIAEDFDESLLHRTPEIDAFLRSDRDEKFIVIGTK
Ga0307411_1061464913300032005RhizosphereMRAWTVDADDIHVADDFDESLLHRTPEIDGFLRLDRDD
Ga0318562_1043922423300032008SoilMRAWTVDADDIRVADDFNDSLLHRTPEIDGFLSSDRDDKFIVIG
Ga0318563_1027994713300032009SoilMRAWTVDADDIQVAEDFNESLLHRTAEIEGFLHSDRDD
Ga0318507_1044275123300032025SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFI
Ga0318510_1050765713300032064SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDDKFIVIGTKG
Ga0318553_1054248923300032068SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDAFLTPERDDKFIVIGTK
Ga0308173_1133451423300032074SoilMRAWTVDADDIRVAEDFDESLLHRTPEIDAFLTPGRDDKFVV
Ga0308173_1160071323300032074SoilMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLTPGRDDKFVVIGTKGFGKTLLL
Ga0315292_1171309523300032143SedimentMRAWTVDADDIRVAEDFNESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKT
Ga0315910_1161499423300032144SoilMRAWTVDADDIRVTEDFDDSLLHRTPEIEAFLRSDRDDKFIVIGTKGFGKTLLL
Ga0307471_10045366233300032180Hardwood Forest SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRDD
Ga0307472_10253354013300032205Hardwood Forest SoilMRAWTVDADDIRVAEDFDDALLHETPEITSFLNLDG
Ga0315271_1082146513300032256SedimentMRAWTVDADDIRVADDFDESLLHRTPEIDGFLSPGRDDKFIVIGTKGF
Ga0306920_10107552213300032261SoilMRAWTVDADDIRVADDFDESLLHRTPEIDGFLRSDRDDKFIVIGTKGFGKTL
Ga0335082_1028416023300032782SoilMKAWTVDADDIRVTEDFDESLLHRTPEIDDFLSQDRDDKFV
Ga0335082_1044665323300032782SoilMRAWTVDADDIRVAEDFNESLLHRTPEIEGFLRSDRD
Ga0335082_1112575513300032782SoilMRAWTVDADDIRVAEDFDDTLLHRTPEIDAFLSPERDDKFVVIGTKGF
Ga0335070_1034400713300032829SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPNRDDKFIVIGTK
Ga0335069_1209882113300032893SoilMRAWTVDADDIHVAEDFDESLLHRTPEIDSFLSPDRDDKFIVIGTKGFGKTL
Ga0310914_1030681233300033289SoilMRAWTVDADDIRVAEDFDDALLHHTPEIDSFLNLDRD
Ga0316604_1023829623300033406SoilMRAWTVDADDIRVAEDFDEALLHRTVEIDAFLTPGRDDKFIVIGTKGF
Ga0214472_1147849213300033407SoilMRAWTVDADDIRVAEDFDAALLHRTPEIDEFLSHGGEKFVVVGTK
Ga0316625_10030800523300033418SoilMRAWTVDADDIRVAEDFDDTLLHRTPEIDAFLTPDRDDKFIVIGTK
Ga0316625_10143709923300033418SoilMRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKT
Ga0316613_1005373613300033434SoilMRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDQF
Ga0316600_1005080413300033481SoilMRAWTVDADDIRVAEDLDESLLHRTPEIDAFLTPDRDDKFIVIGTKGFGKTL
Ga0316627_10146667823300033482SoilMRAWTVDADDIRVAEDFDETLLHRTAEIDVFLTPGRDDKFIVI
Ga0316627_10163875523300033482SoilMRAWTVDADDIRVAEDFDETLLHRTPEIEAFLAPDREDKFIVIGTKGFGKTL
Ga0316621_1121209013300033488SoilMRAWTVDADDIRVAEDFDESLLHRTPEIEAFLSPDREDKFIV
Ga0247830_1173386313300033551SoilMRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDDKFIVIGTKGFGK
Ga0364925_0404328_2_1153300034147SedimentMRAWTVDADDIRVAEDFDEALLHRTPEIDNFLSLDRDD
Ga0370510_0126372_621_7793300034160Untreated Peat SoilMRAWTVDADDIRVADDFDDSLLHRTPEIDAFLSPDRDDKFIVVGTKGFGKTLL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.