Metagenome Family F010031

Basic Information
Family ID	F010031
Family Type	Metagenome
Number of Sequences	309
Average Sequence Length	44 residues
Representative Sequence	MEYDGYDEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Number of Associated Samples	84
Number of Associated Scaffolds	309

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	7.14 %
% of genes near scaffold ends (potentially truncated)	29.13 %
% of genes from short scaffolds (< 2000 bps)	95.15 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.40

Most Common Taxonomy
Group	Unclassified (99.353 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (93.204 % of family members)
Environment Ontology (ENVO)	Unclassified (93.528 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (93.204 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 309 Family Scaffolds
PF01484	Col_cuticle_N	0.32

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
All Organisms	root	All Organisms	0.65 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
cellular organisms	root	All Organisms → cellular organisms	0.32 %
Viruses	superkingdom	All Organisms → Viruses	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.35 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	0.32 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.32 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459019\|G14TP7Y01B9MF6	Not Available	621	Open in IMG/M
3300005459\|Ga0068867_101694966	Not Available	592	Open in IMG/M
3300005718\|Ga0068866_10816320	Not Available	650	Open in IMG/M
3300006358\|Ga0068871_101402747	Not Available	659	Open in IMG/M
3300009098\|Ga0105245_12592692	Not Available	560	Open in IMG/M
3300009098\|Ga0105245_13076530	Not Available	517	Open in IMG/M
3300009148\|Ga0105243_12318319	Not Available	574	Open in IMG/M
3300011119\|Ga0105246_12271240	Not Available	529	Open in IMG/M
3300013296\|Ga0157374_12139513	Not Available	586	Open in IMG/M
3300013297\|Ga0157378_11276554	Not Available	775	Open in IMG/M
3300013297\|Ga0157378_11483975	Not Available	722	Open in IMG/M
3300013297\|Ga0157378_12759903	Not Available	544	Open in IMG/M
3300014745\|Ga0157377_10926407	Not Available	653	Open in IMG/M
3300014745\|Ga0157377_11718213	Not Available	507	Open in IMG/M
3300014745\|Ga0157377_11749739	Not Available	503	Open in IMG/M
3300015267\|Ga0182122_1014340	Not Available	780	Open in IMG/M
3300015267\|Ga0182122_1029572	Not Available	645	Open in IMG/M
3300015268\|Ga0182154_1026536	Not Available	667	Open in IMG/M
3300015268\|Ga0182154_1041407	Not Available	593	Open in IMG/M
3300015268\|Ga0182154_1042613	Not Available	588	Open in IMG/M
3300015268\|Ga0182154_1056497	Not Available	543	Open in IMG/M
3300015268\|Ga0182154_1070340	Not Available	509	Open in IMG/M
3300015269\|Ga0182113_1033698	Not Available	691	Open in IMG/M
3300015269\|Ga0182113_1057330	Not Available	592	Open in IMG/M
3300015269\|Ga0182113_1072506	Not Available	551	Open in IMG/M
3300015269\|Ga0182113_1083423	Not Available	528	Open in IMG/M
3300015269\|Ga0182113_1085227	Not Available	524	Open in IMG/M
3300015274\|Ga0182188_1021835	Not Available	661	Open in IMG/M
3300015274\|Ga0182188_1032436	Not Available	597	Open in IMG/M
3300015274\|Ga0182188_1036707	Not Available	579	Open in IMG/M
3300015274\|Ga0182188_1048091	Not Available	540	Open in IMG/M
3300015275\|Ga0182172_1005125	Not Available	1054	Open in IMG/M
3300015275\|Ga0182172_1012948	Not Available	821	Open in IMG/M
3300015275\|Ga0182172_1017025	Not Available	763	Open in IMG/M
3300015275\|Ga0182172_1054714	Not Available	557	Open in IMG/M
3300015275\|Ga0182172_1056271	Not Available	552	Open in IMG/M
3300015275\|Ga0182172_1060247	Not Available	541	Open in IMG/M
3300015275\|Ga0182172_1063681	Not Available	532	Open in IMG/M
3300015276\|Ga0182170_1010987	Not Available	863	Open in IMG/M
3300015276\|Ga0182170_1013004	Not Available	824	Open in IMG/M
3300015276\|Ga0182170_1022206	Not Available	716	Open in IMG/M
3300015276\|Ga0182170_1031270	Not Available	653	Open in IMG/M
3300015276\|Ga0182170_1045786	Not Available	587	Open in IMG/M
3300015276\|Ga0182170_1055585	Not Available	555	Open in IMG/M
3300015277\|Ga0182128_1022848	Not Available	715	Open in IMG/M
3300015277\|Ga0182128_1032012	Not Available	653	Open in IMG/M
3300015277\|Ga0182128_1042913	Not Available	602	Open in IMG/M
3300015279\|Ga0182174_1021177	Not Available	750	Open in IMG/M
3300015279\|Ga0182174_1038784	Not Available	636	Open in IMG/M
3300015279\|Ga0182174_1040045	Not Available	630	Open in IMG/M
3300015279\|Ga0182174_1062366	Not Available	555	Open in IMG/M
3300015281\|Ga0182160_1046216	Not Available	599	Open in IMG/M
3300015281\|Ga0182160_1049599	Not Available	587	Open in IMG/M
3300015281\|Ga0182160_1060654	Not Available	554	Open in IMG/M
3300015281\|Ga0182160_1060821	Not Available	554	Open in IMG/M
3300015281\|Ga0182160_1060969	Not Available	553	Open in IMG/M
3300015282\|Ga0182124_1056430	Not Available	563	Open in IMG/M
3300015282\|Ga0182124_1066827	Not Available	535	Open in IMG/M
3300015282\|Ga0182124_1069865	Not Available	529	Open in IMG/M
3300015283\|Ga0182156_1041816	Not Available	626	Open in IMG/M
3300015285\|Ga0182186_1047116	Not Available	596	Open in IMG/M
3300015285\|Ga0182186_1049569	Not Available	587	Open in IMG/M
3300015285\|Ga0182186_1062896	Not Available	546	Open in IMG/M
3300015285\|Ga0182186_1080719	Not Available	507	Open in IMG/M
3300015287\|Ga0182171_1048793	Not Available	601	Open in IMG/M
3300015287\|Ga0182171_1049279	Not Available	599	Open in IMG/M
3300015287\|Ga0182171_1062348	Not Available	559	Open in IMG/M
3300015287\|Ga0182171_1063425	Not Available	556	Open in IMG/M
3300015287\|Ga0182171_1077127	Not Available	524	Open in IMG/M
3300015287\|Ga0182171_1084880	Not Available	509	Open in IMG/M
3300015288\|Ga0182173_1013566	Not Available	841	Open in IMG/M
3300015288\|Ga0182173_1023876	Not Available	725	Open in IMG/M
3300015288\|Ga0182173_1040951	Not Available	625	Open in IMG/M
3300015289\|Ga0182138_1018427	Not Available	785	Open in IMG/M
3300015289\|Ga0182138_1072880	Not Available	535	Open in IMG/M
3300015289\|Ga0182138_1074077	Not Available	532	Open in IMG/M
3300015291\|Ga0182125_1015912	Not Available	836	Open in IMG/M
3300015291\|Ga0182125_1018998	Not Available	797	Open in IMG/M
3300015291\|Ga0182125_1029459	Not Available	706	Open in IMG/M
3300015291\|Ga0182125_1050193	Not Available	608	Open in IMG/M
3300015291\|Ga0182125_1051254	Not Available	604	Open in IMG/M
3300015291\|Ga0182125_1070818	Not Available	549	Open in IMG/M
3300015291\|Ga0182125_1083249	Not Available	523	Open in IMG/M
3300015291\|Ga0182125_1092331	Not Available	506	Open in IMG/M
3300015292\|Ga0182141_1026978	Not Available	723	Open in IMG/M
3300015292\|Ga0182141_1030215	Not Available	701	Open in IMG/M
3300015292\|Ga0182141_1038659	Not Available	653	Open in IMG/M
3300015292\|Ga0182141_1077802	Not Available	533	Open in IMG/M
3300015294\|Ga0182126_1031482	Not Available	697	Open in IMG/M
3300015294\|Ga0182126_1041907	Not Available	643	Open in IMG/M
3300015294\|Ga0182126_1052674	Not Available	602	Open in IMG/M
3300015294\|Ga0182126_1069807	Not Available	554	Open in IMG/M
3300015295\|Ga0182175_1066352	Not Available	568	Open in IMG/M
3300015295\|Ga0182175_1073006	Not Available	552	Open in IMG/M
3300015295\|Ga0182175_1075278	Not Available	547	Open in IMG/M
3300015295\|Ga0182175_1080384	Not Available	536	Open in IMG/M
3300015296\|Ga0182157_1013214	Not Available	910	Open in IMG/M
3300015298\|Ga0182106_1071036	Not Available	564	Open in IMG/M
3300015298\|Ga0182106_1075728	Not Available	553	Open in IMG/M
3300015299\|Ga0182107_1032684	Not Available	712	Open in IMG/M
3300015299\|Ga0182107_1074157	Not Available	560	Open in IMG/M
3300015299\|Ga0182107_1080759	Not Available	545	Open in IMG/M
3300015299\|Ga0182107_1082982	Not Available	541	Open in IMG/M
3300015299\|Ga0182107_1091492	Not Available	524	Open in IMG/M
3300015299\|Ga0182107_1095092	Not Available	518	Open in IMG/M
3300015300\|Ga0182108_1034883	Not Available	704	Open in IMG/M
3300015300\|Ga0182108_1059522	Not Available	603	Open in IMG/M
3300015302\|Ga0182143_1032200	Not Available	713	Open in IMG/M
3300015302\|Ga0182143_1077035	Not Available	553	Open in IMG/M
3300015302\|Ga0182143_1085746	Not Available	535	Open in IMG/M
3300015302\|Ga0182143_1087285	Not Available	532	Open in IMG/M
3300015303\|Ga0182123_1020942	Not Available	779	Open in IMG/M
3300015303\|Ga0182123_1069773	Not Available	558	Open in IMG/M
3300015303\|Ga0182123_1081913	Not Available	532	Open in IMG/M
3300015304\|Ga0182112_1060973	Not Available	595	Open in IMG/M
3300015305\|Ga0182158_1028965	Not Available	733	Open in IMG/M
3300015305\|Ga0182158_1050180	Not Available	628	Open in IMG/M
3300015307\|Ga0182144_1064199	Not Available	592	Open in IMG/M
3300015307\|Ga0182144_1073469	Not Available	568	Open in IMG/M
3300015307\|Ga0182144_1093830	Not Available	526	Open in IMG/M
3300015308\|Ga0182142_1012265	Not Available	968	Open in IMG/M
3300015308\|Ga0182142_1018019	Not Available	870	Open in IMG/M
3300015308\|Ga0182142_1027200	Not Available	774	Open in IMG/M
3300015308\|Ga0182142_1050124	Not Available	648	Open in IMG/M
3300015308\|Ga0182142_1050133	Not Available	648	Open in IMG/M
3300015308\|Ga0182142_1051971	Not Available	642	Open in IMG/M
3300015308\|Ga0182142_1060541	Not Available	614	Open in IMG/M
3300015308\|Ga0182142_1062610	Not Available	608	Open in IMG/M
3300015308\|Ga0182142_1077941	Not Available	568	Open in IMG/M
3300015314\|Ga0182140_1048667	Not Available	656	Open in IMG/M
3300015314\|Ga0182140_1085370	Not Available	554	Open in IMG/M
3300015314\|Ga0182140_1088652	Not Available	548	Open in IMG/M
3300015321\|Ga0182127_1039267	Not Available	718	Open in IMG/M
3300015321\|Ga0182127_1049767	Not Available	670	Open in IMG/M
3300015321\|Ga0182127_1064941	Not Available	619	Open in IMG/M
3300015321\|Ga0182127_1093655	Not Available	552	Open in IMG/M
3300015321\|Ga0182127_1100203	Not Available	540	Open in IMG/M
3300015321\|Ga0182127_1110845	Not Available	522	Open in IMG/M
3300015322\|Ga0182110_1055620	Not Available	646	Open in IMG/M
3300015323\|Ga0182129_1045013	Not Available	669	Open in IMG/M
3300015323\|Ga0182129_1093838	Not Available	537	Open in IMG/M
3300015323\|Ga0182129_1105531	Not Available	518	Open in IMG/M
3300015323\|Ga0182129_1106640	Not Available	516	Open in IMG/M
3300015323\|Ga0182129_1107787	Not Available	514	Open in IMG/M
3300015341\|Ga0182187_1048155	Not Available	827	Open in IMG/M
3300015341\|Ga0182187_1168271	Not Available	536	Open in IMG/M
3300015341\|Ga0182187_1176315	Not Available	527	Open in IMG/M
3300015341\|Ga0182187_1185937	Not Available	516	Open in IMG/M
3300015341\|Ga0182187_1200325	Not Available	502	Open in IMG/M
3300015342\|Ga0182109_1126777	Not Available	624	Open in IMG/M
3300015342\|Ga0182109_1139345	Not Available	602	Open in IMG/M
3300015342\|Ga0182109_1169422	Not Available	559	Open in IMG/M
3300015342\|Ga0182109_1176686	Not Available	550	Open in IMG/M
3300015342\|Ga0182109_1215188	Not Available	509	Open in IMG/M
3300015343\|Ga0182155_1056960	Not Available	820	Open in IMG/M
3300015343\|Ga0182155_1103019	Not Available	669	Open in IMG/M
3300015343\|Ga0182155_1107582	Not Available	659	Open in IMG/M
3300015343\|Ga0182155_1151909	Not Available	583	Open in IMG/M
3300015343\|Ga0182155_1156659	Not Available	576	Open in IMG/M
3300015343\|Ga0182155_1157606	Not Available	575	Open in IMG/M
3300015344\|Ga0182189_1057070	Not Available	835	Open in IMG/M
3300015344\|Ga0182189_1148924	Not Available	593	Open in IMG/M
3300015344\|Ga0182189_1184767	Not Available	546	Open in IMG/M
3300015344\|Ga0182189_1198532	Not Available	531	Open in IMG/M
3300015345\|Ga0182111_1135639	Not Available	632	Open in IMG/M
3300015345\|Ga0182111_1148492	Not Available	611	Open in IMG/M
3300015345\|Ga0182111_1213399	Not Available	531	Open in IMG/M
3300015345\|Ga0182111_1226734	Not Available	518	Open in IMG/M
3300015345\|Ga0182111_1232922	Not Available	512	Open in IMG/M
3300015345\|Ga0182111_1238304	Not Available	507	Open in IMG/M
3300015346\|Ga0182139_1056818	Not Available	870	Open in IMG/M
3300015346\|Ga0182139_1070727	Not Available	805	Open in IMG/M
3300015346\|Ga0182139_1169116	Not Available	582	Open in IMG/M
3300015346\|Ga0182139_1196112	Not Available	549	Open in IMG/M
3300015346\|Ga0182139_1196653	Not Available	548	Open in IMG/M
3300015346\|Ga0182139_1209250	Not Available	535	Open in IMG/M
3300015346\|Ga0182139_1225368	Not Available	520	Open in IMG/M
3300015346\|Ga0182139_1237615	Not Available	508	Open in IMG/M
3300015347\|Ga0182177_1106976	Not Available	694	Open in IMG/M
3300015347\|Ga0182177_1222863	Not Available	525	Open in IMG/M
3300015351\|Ga0182161_1152418	Not Available	630	Open in IMG/M
3300015351\|Ga0182161_1209067	Not Available	555	Open in IMG/M
3300015351\|Ga0182161_1217317	Not Available	547	Open in IMG/M
3300015351\|Ga0182161_1237513	Not Available	527	Open in IMG/M
3300015355\|Ga0182159_1113979	Not Available	814	Open in IMG/M
3300015355\|Ga0182159_1231056	Not Available	604	Open in IMG/M
3300015355\|Ga0182159_1331550	Not Available	515	Open in IMG/M
3300015355\|Ga0182159_1337328	Not Available	511	Open in IMG/M
3300015355\|Ga0182159_1350305	Not Available	503	Open in IMG/M
3300015361\|Ga0182145_1022468	Not Available	1009	Open in IMG/M
3300015361\|Ga0182145_1099544	Not Available	630	Open in IMG/M
3300015361\|Ga0182145_1109468	Not Available	610	Open in IMG/M
3300015361\|Ga0182145_1131021	Not Available	574	Open in IMG/M
3300015361\|Ga0182145_1131309	Not Available	574	Open in IMG/M
3300015361\|Ga0182145_1157054	Not Available	540	Open in IMG/M
3300015361\|Ga0182145_1190097	Not Available	506	Open in IMG/M
3300015361\|Ga0182145_1194471	Not Available	502	Open in IMG/M
3300017404\|Ga0182203_1023558	Not Available	921	Open in IMG/M
3300017404\|Ga0182203_1075301	Not Available	648	Open in IMG/M
3300017404\|Ga0182203_1161594	Not Available	504	Open in IMG/M
3300017407\|Ga0182220_1066781	Not Available	578	Open in IMG/M
3300017407\|Ga0182220_1079819	Not Available	549	Open in IMG/M
3300017407\|Ga0182220_1103540	Not Available	509	Open in IMG/M
3300017409\|Ga0182204_1046410	Not Available	669	Open in IMG/M
3300017409\|Ga0182204_1046492	Not Available	669	Open in IMG/M
3300017409\|Ga0182204_1059998	Not Available	621	Open in IMG/M
3300017409\|Ga0182204_1066023	Not Available	604	Open in IMG/M
3300017409\|Ga0182204_1077370	Not Available	576	Open in IMG/M
3300017409\|Ga0182204_1081230	Not Available	567	Open in IMG/M
3300017410\|Ga0182207_1075747	Not Available	668	Open in IMG/M
3300017410\|Ga0182207_1099965	Not Available	610	Open in IMG/M
3300017410\|Ga0182207_1132494	Not Available	555	Open in IMG/M
3300017410\|Ga0182207_1137707	Not Available	548	Open in IMG/M
3300017411\|Ga0182208_1051346	Not Available	669	Open in IMG/M
3300017411\|Ga0182208_1098463	Not Available	549	Open in IMG/M
3300017411\|Ga0182208_1123159	Not Available	510	Open in IMG/M
3300017413\|Ga0182222_1056823	Not Available	595	Open in IMG/M
3300017413\|Ga0182222_1085076	Not Available	536	Open in IMG/M
3300017413\|Ga0182222_1101867	Not Available	510	Open in IMG/M
3300017415\|Ga0182202_1057336	Not Available	668	Open in IMG/M
3300017415\|Ga0182202_1128128	Not Available	516	Open in IMG/M
3300017417\|Ga0182230_1068385	Not Available	633	Open in IMG/M
3300017420\|Ga0182228_1047604	Not Available	727	Open in IMG/M
3300017420\|Ga0182228_1086422	Not Available	582	Open in IMG/M
3300017424\|Ga0182219_1042153	Not Available	730	Open in IMG/M
3300017425\|Ga0182224_1049754	Not Available	735	Open in IMG/M
3300017425\|Ga0182224_1077954	Not Available	640	Open in IMG/M
3300017425\|Ga0182224_1089473	Not Available	614	Open in IMG/M
3300017425\|Ga0182224_1120635	Not Available	558	Open in IMG/M
3300017427\|Ga0182190_1042245	Not Available	797	Open in IMG/M
3300017427\|Ga0182190_1084425	Not Available	633	Open in IMG/M
3300017427\|Ga0182190_1123231	Not Available	557	Open in IMG/M
3300017427\|Ga0182190_1143024	Not Available	528	Open in IMG/M
3300017427\|Ga0182190_1144369	Not Available	526	Open in IMG/M
3300017430\|Ga0182192_1075206	Not Available	671	Open in IMG/M
3300017430\|Ga0182192_1093833	Not Available	622	Open in IMG/M
3300017430\|Ga0182192_1148039	Not Available	531	Open in IMG/M
3300017433\|Ga0182206_1046824	Not Available	741	Open in IMG/M
3300017433\|Ga0182206_1084130	Not Available	617	Open in IMG/M
3300017433\|Ga0182206_1098499	Not Available	587	Open in IMG/M
3300017433\|Ga0182206_1116057	Not Available	557	Open in IMG/M
3300017433\|Ga0182206_1135047	Not Available	530	Open in IMG/M
3300017433\|Ga0182206_1149503	Not Available	513	Open in IMG/M
3300017436\|Ga0182209_1017949	All Organisms → Viruses → Predicted Viral	1012	Open in IMG/M
3300017436\|Ga0182209_1092448	Not Available	618	Open in IMG/M
3300017436\|Ga0182209_1133228	Not Available	549	Open in IMG/M
3300017436\|Ga0182209_1137337	Not Available	543	Open in IMG/M
3300017438\|Ga0182191_1045757	Not Available	795	Open in IMG/M
3300017438\|Ga0182191_1094312	Not Available	629	Open in IMG/M
3300017438\|Ga0182191_1153925	Not Available	534	Open in IMG/M
3300017438\|Ga0182191_1168832	Not Available	516	Open in IMG/M
3300017442\|Ga0182221_1050303	Not Available	733	Open in IMG/M
3300017442\|Ga0182221_1143572	Not Available	531	Open in IMG/M
3300017442\|Ga0182221_1144529	Not Available	530	Open in IMG/M
3300017442\|Ga0182221_1153398	Not Available	520	Open in IMG/M
3300017443\|Ga0182193_1017097	Not Available	1104	Open in IMG/M
3300017443\|Ga0182193_1079056	Not Available	687	Open in IMG/M
3300017443\|Ga0182193_1100097	Not Available	636	Open in IMG/M
3300017443\|Ga0182193_1175675	Not Available	523	Open in IMG/M
3300017680\|Ga0182233_1058075	Not Available	686	Open in IMG/M
3300017681\|Ga0182226_1041276	Not Available	829	Open in IMG/M
3300017681\|Ga0182226_1056526	Not Available	713	Open in IMG/M
3300017682\|Ga0182229_1064300	Not Available	626	Open in IMG/M
3300017683\|Ga0182218_1072239	Not Available	635	Open in IMG/M
3300017683\|Ga0182218_1091273	Not Available	591	Open in IMG/M
3300017683\|Ga0182218_1151404	Not Available	505	Open in IMG/M
3300017684\|Ga0182225_1048689	Not Available	704	Open in IMG/M
3300017684\|Ga0182225_1052725	Not Available	686	Open in IMG/M
3300017684\|Ga0182225_1053776	Not Available	682	Open in IMG/M
3300017684\|Ga0182225_1071993	Not Available	624	Open in IMG/M
3300017684\|Ga0182225_1091328	Not Available	580	Open in IMG/M
3300017684\|Ga0182225_1102202	Not Available	560	Open in IMG/M
3300017684\|Ga0182225_1118935	Not Available	535	Open in IMG/M
3300017685\|Ga0182227_1062133	Not Available	678	Open in IMG/M
3300017685\|Ga0182227_1068433	Not Available	653	Open in IMG/M
3300017685\|Ga0182227_1070113	Not Available	646	Open in IMG/M
3300017685\|Ga0182227_1075374	Not Available	628	Open in IMG/M
3300017685\|Ga0182227_1081822	Not Available	609	Open in IMG/M
3300017685\|Ga0182227_1082034	Not Available	608	Open in IMG/M
3300017685\|Ga0182227_1101352	Not Available	561	Open in IMG/M
3300017685\|Ga0182227_1137029	Not Available	501	Open in IMG/M
3300017686\|Ga0182205_1113089	Not Available	580	Open in IMG/M
3300017686\|Ga0182205_1136836	Not Available	543	Open in IMG/M
3300017689\|Ga0182231_1033977	Not Available	950	Open in IMG/M
3300017689\|Ga0182231_1091724	Not Available	583	Open in IMG/M
3300017690\|Ga0182223_1086045	Not Available	558	Open in IMG/M
3300017690\|Ga0182223_1086169	Not Available	558	Open in IMG/M
3300017690\|Ga0182223_1093241	Not Available	545	Open in IMG/M
3300017690\|Ga0182223_1096788	Not Available	539	Open in IMG/M
3300017690\|Ga0182223_1101885	Not Available	532	Open in IMG/M
3300017690\|Ga0182223_1120495	Not Available	507	Open in IMG/M
3300025908\|Ga0207643_10101717	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1685	Open in IMG/M
3300025940\|Ga0207691_11033990	Not Available	685	Open in IMG/M
3300026118\|Ga0207675_102728512	Not Available	502	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.68%
Engineered	Engineered	0.32%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.68%
Solid Waste	Engineered → Solid Waste	0.32%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.20%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.21%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.94%
Roots	Host-Associated → Plants → Roots	0.32%
Grass	Engineered → Solid Waste → Grass	0.32%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.88%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.94%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.32%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.32%
Composting	Engineered → Solid Waste → Grass → Composting	0.32%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.94%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.32%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.32%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.32%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	93.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.62%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.29%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.32%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.32%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.32%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459019	Litter degradation MG4	Engineered	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
4MG_04019840	2170459019	Switchgrass, Maize And Mischanthus Litter	GYDEYGNITPTMVTIACYIPHVWHRLVANLEMNSYN
Ga0068867_1015531162	3300005459	Miscanthus Rhizosphere	MKHDGSDEYGITIPAMVTIVCFSIDIPHVWHRIVANLEMDSYK*
Ga0068867_1016949662	3300005459	Miscanthus Rhizosphere	NIVVTVLWNDGYDEHGIIIPAMVTIVMLLNDIPHVWHRLVTNLEMNSYN*
Ga0068867_1022875741	3300005459	Miscanthus Rhizosphere	MKHDGSDEYGIIIPAMVTIVCFSIDIPHVWHMIVANLEMDSYN*
Ga0068866_108163202	3300005718	Miscanthus Rhizosphere	MEYDGSDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0068871_1014027473	3300006358	Miscanthus Rhizosphere	MEFDGYDEHGIITLAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0105245_125926921	3300009098	Miscanthus Rhizosphere	MEYDGYDEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0105245_130765302	3300009098	Miscanthus Rhizosphere	MEFDGHIGHGNATLAMVIIVMLHNDISHVWHMLVVNLEVNSYN*
Ga0105243_123183191	3300009148	Miscanthus Rhizosphere	MEYDGYDEHGIITPTMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0105246_122712402	3300011119	Miscanthus Rhizosphere	MEHDGSDEYGIAIPAMVIIVCFQMDIPHVWHMIVANLEMDSIINLILEP*
Ga0157374_121395131	3300013296	Miscanthus Rhizosphere	LNHHLSQIVISLVEPLHCSNWIMEYDDSDEYENLTPAMVTIVMLLNDIPHVWHRLVVNLEMNSYN*
Ga0157378_112765541	3300013297	Miscanthus Rhizosphere	MEFDGYDEHGNVTPAMVIIVMLHNHISHVWHRLDANLEMNSYT*
Ga0157378_114839751	3300013297	Miscanthus Rhizosphere	YDEHVNVTLAMVIIVMLHNHTSHVWHRLDANLEMNSYNNLMTEL*
Ga0157378_127599032	3300013297	Miscanthus Rhizosphere	MQYDGFDEYENLTPFMVTIVMLLNDIPHVWHRLVANPEINSYN*
Ga0157377_109264071	3300014745	Miscanthus Rhizosphere	MKCDGYDEHGNVTPAMVIIVMLHNHTSHVWHRLDANLEINSYN*
Ga0157377_117182131	3300014745	Miscanthus Rhizosphere	MEFDGYDEHGMIIPAMVTIVMLLNDIPLVWNRLVANLEMNRYN*
Ga0157377_117497391	3300014745	Miscanthus Rhizosphere	MEYDDSDEYENLIPAMVTIVMLLNDIPHVWHRLVANLEMNSYH*
Ga0157376_122342341	3300014969	Miscanthus Rhizosphere	MEYDGSGKHGITIPAMVTIVCFEIDIPHVWHRIIANLEMDSYN*
Ga0182122_10143401	3300015267	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVIIVMLHNHTSHVWHRLDANLEMNRYN*
Ga0182122_10295721	3300015267	Miscanthus Phyllosphere	MECDGYDEHGNDTPAMVIIVMLPNHTSHVWHRLDANLEMNSYN*
Ga0182154_10265362	3300015268	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIVMLLKAIPHVWHMLVANLKMNSYN*
Ga0182154_10414071	3300015268	Miscanthus Phyllosphere	MKFDGYDEHGNVTPAMVIIVILHNPTSHVWHRLDANIEMNSYNQLGTEL*
Ga0182154_10426131	3300015268	Miscanthus Phyllosphere	VLWNDGYDEHGITTPTMVTIVMLLYDIPHVWHRLVVNLEMNSYN*
Ga0182154_10564971	3300015268	Miscanthus Phyllosphere	MEFDGYIGHGNATLAMVIIVMLHNDISHVWHMLDVNLEVNSYN*
Ga0182154_10703401	3300015268	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVIIVMRPNHTSHVWHRLDANLEMNSYN*
Ga0182113_10336981	3300015269	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIVMLLNDIPHVWHRLIANLEMNSYN*
Ga0182113_10573301	3300015269	Miscanthus Phyllosphere	MEYDDFDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182113_10725061	3300015269	Miscanthus Phyllosphere	RSNCFMEYDGSDEYENLTPAMVTIVMLLNDIQHVWHRLVVNLEMNSYN*
Ga0182113_10834231	3300015269	Miscanthus Phyllosphere	MKFDGYDEHVNVTPAMVVIVMLLIHTSHVSDMLDAKLEMNRYN*
Ga0182113_10852271	3300015269	Miscanthus Phyllosphere	MEFDGYIGYGNATPAMVIIVMLHNDISHVWHRLVVNLEVNSYN*
Ga0182188_10218351	3300015274	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIVMLLNDIPHVWHMLVANLEMNSYN*
Ga0182188_10324362	3300015274	Miscanthus Phyllosphere	HRSNCVMEHDGSEEYGITIPAMVTIVCFSINLPHVWHRIVANLELYSYI*
Ga0182188_10367071	3300015274	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHNDISHVWHRLVVNLEVISYN*
Ga0182188_10480911	3300015274	Miscanthus Phyllosphere	MEFYGYDEHGNVTLAMVIIVMLHNHTSHVWHKLDANLEMNSYN*
Ga0182172_10051251	3300015275	Miscanthus Phyllosphere	VLWNDGYDEHGIIIPAMVTIIMLLNDIPHVWHRLASNLEMNSYN*
Ga0182172_10129481	3300015275	Miscanthus Phyllosphere	MEFDGYDEHGNVTLAMVIIVMLHNHTSHVWHRLDANLEMNSYN*
Ga0182172_10170252	3300015275	Miscanthus Phyllosphere	MEYDGYAEHGIITPTMVTIVMLLNDIPHVWHRLVANLEMNNYN*
Ga0182172_10547141	3300015275	Miscanthus Phyllosphere	MEFDGYIGQGNATPAMVIIVMLHNDISHVWHMLVVNLEVNSYN*
Ga0182172_10562711	3300015275	Miscanthus Phyllosphere	MEFDGYDEHGNITPAMVIIVMLHNHASHVWHRLDANLEMSSYN*
Ga0182172_10602471	3300015275	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHKDISHVWHKLVVNLVVNSYN*
Ga0182172_10636811	3300015275	Miscanthus Phyllosphere	MEYDEHGIITPAMVTIVMLLNDIPHIWHRLVANLEM
Ga0182170_10109871	3300015276	Miscanthus Phyllosphere	MEFDGYDKHRNVTPAMVIIVMVPNHTSHVWHRLVANLEMNSYN*
Ga0182170_10130041	3300015276	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182170_10222061	3300015276	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVTIAMLHNYITLVWHRLVANLEMNSYN*
Ga0182170_10312701	3300015276	Miscanthus Phyllosphere	MEFDGYIGDGNATPAMVIIVMLHNDISHVWHRLVVNLEVNSYN*
Ga0182170_10457861	3300015276	Miscanthus Phyllosphere	MEFDCYDEHGIVTPAMVIIVILHNHISNVWHRLEANLEMNSYK*
Ga0182170_10555851	3300015276	Miscanthus Phyllosphere	MEFDGYDEHGIITLAMVTIVMLLNDIPHVWHMLVANLEMNS
Ga0182128_10228481	3300015277	Miscanthus Phyllosphere	MEYDDSDEYENLTPAMFTIIMLLNDIPHVWHRLVANAEMNSYNYLDD
Ga0182128_10320121	3300015277	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIEMLLKDIPHVWHRIVANLEVNSYN*
Ga0182128_10429132	3300015277	Miscanthus Phyllosphere	MEFDGYIGHGNATQAMVIIVMLHNDISHRLVVNLEVNSYN*
Ga0182174_10211771	3300015279	Miscanthus Phyllosphere	YDEHGNVTLAMVIIVMLHNHTSHVWHRIDANLEMNSYN*
Ga0182174_10387841	3300015279	Miscanthus Phyllosphere	VELLHRSNWIMEYDGSNDYENLTPAMVTNVMILNDIPHVCHRLVANLEMNTYN*
Ga0182174_10400451	3300015279	Miscanthus Phyllosphere	IMEYDGYDEHGIITPAMVTIVMLLNAIPHVWHRLVANLEMNSFN*
Ga0182174_10623661	3300015279	Miscanthus Phyllosphere	MDYDGYDEYGIITPAMVTIIMLLNDIPHVGHRLVANLEINRYN*
Ga0182160_10462161	3300015281	Miscanthus Phyllosphere	DEHGIITPDMVTIAMLLNDIPHVHKLVANLEMNSYN
Ga0182160_10495991	3300015281	Miscanthus Phyllosphere	MEFDGYNEHGNVTPAMLIIVMLHNYISHVWHRIDANLEMN
Ga0182160_10606541	3300015281	Miscanthus Phyllosphere	MEYDGYDEHGIIIQAMVTIVMLLKAISHVWHRLVANLEMNSYN*
Ga0182160_10608212	3300015281	Miscanthus Phyllosphere	DEHRIIRLVMVTIVMVLNDIPHVWHKLVANLEMNSYN*
Ga0182160_10609691	3300015281	Miscanthus Phyllosphere	MEFDGHIGHGNATPAMVIIVMLHNDISHVWHKLDANLEMKSYN*
Ga0182160_10846201	3300015281	Miscanthus Phyllosphere	MEHDGSDEYGITIPAMVTIVCFSIDIPHVWHRIVA
Ga0182124_10564301	3300015282	Miscanthus Phyllosphere	VVTELWNDGYDGHGIITLAMVTIVMLLTNISHVWHRLDANLEMNSYN*
Ga0182124_10668272	3300015282	Miscanthus Phyllosphere	MEFDGYDEHGNATPSMVIIVMLHNHTSHVWHMLDANIEMNGYNQLGTEL*
Ga0182124_10698651	3300015282	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIVKLLNDIPHVWHRLVANLEMNSYS*
Ga0182156_10418161	3300015283	Miscanthus Phyllosphere	MEFDGYIGHGNTTPAMVIIVMLHNDISHVWHRLVVNLEVNNYN*
Ga0182186_10471161	3300015285	Miscanthus Phyllosphere	VVSVLWNDGYDEHGITTPAMVIIDMLLNDIPHIWHRLVANLEMNSYN*
Ga0182186_10495691	3300015285	Miscanthus Phyllosphere	MEYDDSDEYENLTSTMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182186_10628961	3300015285	Miscanthus Phyllosphere	MKFDGYDEHGNVTPAMVIIVILHNPTSHVWHRLDANIEMNSYN
Ga0182186_10807191	3300015285	Miscanthus Phyllosphere	MKFDGYDEHRNITPAMVIIVMLHNHTSHVWHMLDANIEMNSYNSLGIEL*
Ga0182171_10487931	3300015287	Miscanthus Phyllosphere	MEFDGYDEHGIITPAMVSIVMLLNAIPHVWHRLVANLEMNSYN*
Ga0182171_10492792	3300015287	Miscanthus Phyllosphere	GYNENGIIISAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182171_10623481	3300015287	Miscanthus Phyllosphere	MEYDGYAEHGIIASAMVTIAMLLNYIQHVWHRLVANL*
Ga0182171_10634251	3300015287	Miscanthus Phyllosphere	MEFDGYIGHGNATPTMVIIVMLHNDISHVWHKLVVNLEVNSYN*
Ga0182171_10771271	3300015287	Miscanthus Phyllosphere	MEFDGYDENGNVIPAMVTTVMLLNDILHVWHWLIANLEINSYN*
Ga0182171_10848801	3300015287	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVIIVMLHNHTSHVWHRLDANIEMNSYNQLGTEL*
Ga0182173_10135662	3300015288	Miscanthus Phyllosphere	MEFDGYIGHGNATLTMVIIVMLHNDISHVWHRLVVNLEVNSYN*
Ga0182173_10238761	3300015288	Miscanthus Phyllosphere	MEFDGYMGHGNATPAMVIIMILHNDISHVWHRLVVNLEVNTYN*
Ga0182173_10409511	3300015288	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIVMLLNDIPHVWQILVANPEMNGYN*
Ga0182138_10184271	3300015289	Miscanthus Phyllosphere	MEYDGYAEHGIITPAILTIVMPLNDITHVWHRLVANL*
Ga0182138_10728801	3300015289	Miscanthus Phyllosphere	MEYDGSHEYENLKLTMVTIVMLLNDIPHVWHRLVTN
Ga0182138_10740771	3300015289	Miscanthus Phyllosphere	MKFDGYDEHGNVTPAMVIIVMLLNSTSHVWHRLVANLEMNTIINLMTEV*
Ga0182125_10159121	3300015291	Miscanthus Phyllosphere	MEYDGYDEYGIITPAMVTIVMLLNNIPHVWHMLVANLEKNSYN*
Ga0182125_10189981	3300015291	Miscanthus Phyllosphere	MELLHRSNWIMEYDGSDEYKNLTPAMVTIVVLLNDIPHVWHMLVANLEMNSYN*
Ga0182125_10294591	3300015291	Miscanthus Phyllosphere	ECDGYDEHGNVTPAMVIIVMLPNSASHVWHRLVANLEMNSYN*
Ga0182125_10501931	3300015291	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVTLHNDISHVWHRLVVNLEVNSYN*
Ga0182125_10512541	3300015291	Miscanthus Phyllosphere	IMEYDGYDEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182125_10708181	3300015291	Miscanthus Phyllosphere	MEYDGYAEHGIITPAMVTIVMLLNDIPHVWHRLVAN
Ga0182125_10832491	3300015291	Miscanthus Phyllosphere	MEFDGYDEHGNATPAMVIIVMLHNHTSHVWHKLDANLEINSYN*
Ga0182125_10923311	3300015291	Miscanthus Phyllosphere	MEYDGYHGHGIITPAMVTIVMLLNDIPNVWHRLVVNLEMNSYN*
Ga0182141_10269781	3300015292	Miscanthus Phyllosphere	MEFDGYIGHGNATLAMVIIMMLHNDISHVWHRLVANLEMNSYN*
Ga0182141_10302151	3300015292	Miscanthus Phyllosphere	MEFDGYDEDGNVTPAMVTIVMLHNYITLVWHRLVANLEMSSYI*
Ga0182141_10386591	3300015292	Miscanthus Phyllosphere	MEYDGYDEHGITTPAMVIIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182141_10778021	3300015292	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHNDISHVWHMLVVNLEVNSYN*
Ga0182126_10314821	3300015294	Miscanthus Phyllosphere	MKFDGYDEHGNVTPAMVIIVMLHNHTSHVWHRLDANLEMNSYN*
Ga0182126_10419071	3300015294	Miscanthus Phyllosphere	NWIMEYDGYDEHGMITLAMVTIVMPLKDIPHVWYRLVANLEMNSYN*
Ga0182126_10526741	3300015294	Miscanthus Phyllosphere	MEIDGYIGHGNATLAMVIIVMLHNDISHVWHRLVVNLEVNSYN*
Ga0182126_10698071	3300015294	Miscanthus Phyllosphere	IVRNLMELLHRSNWIMEYDGSDEYKNLTPAMVTIVILLNDIPHVWHRLVANLEMNSYN*
Ga0182175_10663521	3300015295	Miscanthus Phyllosphere	MEYDGSNEYENLTLAMVTIVMLLNDIPHVWHRLVANLEMNNCN*
Ga0182175_10730061	3300015295	Miscanthus Phyllosphere	NCVKEYDGSDAHGIIMAAMVSTGMILSDIPHVWYMLVANLELNSYN*
Ga0182175_10752781	3300015295	Miscanthus Phyllosphere	MEFDGHSGHGNATPAMVIIVMRHNDISHVWHMLDANLETNSYN*
Ga0182175_10803841	3300015295	Miscanthus Phyllosphere	LEYDGYAEHGIITPAMVTIVMLLNDIPHVWHRLVANLE
Ga0182157_10132141	3300015296	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIVMLVNDIPHVCHMLVANLEMNSYN*
Ga0182106_10710361	3300015298	Miscanthus Phyllosphere	MEYDGYDEYENLTPAMVTIVMLLNEVPHVWHRLVANLEMNGYN*
Ga0182106_10757281	3300015298	Miscanthus Phyllosphere	MDDGYDEHGIIIPAMVSIVMLLNDIPNVWHRLVANLEMNSYN*
Ga0182107_10326841	3300015299	Miscanthus Phyllosphere	MEFEGYDEHGNITLAMVIIVMLHNHTSHVWHRLDANLEMNSYN*
Ga0182107_10741571	3300015299	Miscanthus Phyllosphere	MEYDGYDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182107_10807591	3300015299	Miscanthus Phyllosphere	MEFDGYNEHGNVTPAMLIIVMLHNHTSHVWHRLDANIEMNSYNQLGTEL*
Ga0182107_10829821	3300015299	Miscanthus Phyllosphere	MEYDGYAEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182107_10914921	3300015299	Miscanthus Phyllosphere	MEFDGYIGHGNATLAMVIIVMLYNDISHVWHRLVVNLEVNSYN*
Ga0182107_10950922	3300015299	Miscanthus Phyllosphere	MELLHRSNWIMEYDGSDEYENLTLAMVTIVMLLNDIPHVWYMLVANLEMNGYN*
Ga0182108_10348831	3300015300	Miscanthus Phyllosphere	DGYDGHRIITSAMVTIVMLLNGIPHVWHRLVANLEMNIYN*
Ga0182108_10595221	3300015300	Miscanthus Phyllosphere	MEYDGSDEHGITTLAMVTIVMLLNDRPHVWHRLLANLEMNSYN*
Ga0182143_10322001	3300015302	Miscanthus Phyllosphere	MEFDGYIGHGKATPVMVIIVMLHNDISHIWYMLVVNLEVNSYN*
Ga0182143_10770351	3300015302	Miscanthus Phyllosphere	MEYDGYDEYENLTPAMVTIVMLLNDVPHVWHRLVANIEMNSYN*
Ga0182143_10857461	3300015302	Miscanthus Phyllosphere	MELLHRSNWTMECDGYDEHEKVTLAMVIIVMLPNSTSHVWHRLVA
Ga0182143_10872851	3300015302	Miscanthus Phyllosphere	MKFDGYDEHENVTPAMVTIAMLHNYITLIWHRLVANLEMNSYN*
Ga0182123_10209421	3300015303	Miscanthus Phyllosphere	MECDGYDEHGNDTMAMVIIVMLPNHTSHVWHMLDANLEMNS
Ga0182123_10697731	3300015303	Miscanthus Phyllosphere	MEFDGYNEHGNVTPAIVIIVMLPNHTSHVWHRLVANLEMNSYN*
Ga0182123_10819131	3300015303	Miscanthus Phyllosphere	MEYDGYDEYGIITPAMVTIVMLINDIPHVWHRLVANLEMNSYN*
Ga0182112_10609732	3300015304	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHNDISHVWHMLDANLEMNSYN*
Ga0182158_10289651	3300015305	Miscanthus Phyllosphere	MEFDGYDENGNVIPAMVTTIMLLNDIPYVWNRLVANLEMNSYN*
Ga0182158_10501801	3300015305	Miscanthus Phyllosphere	MEYDGSDEYENLKPAMVIIVMLLNDIPHVWHRLVTNLEMNSYN*
Ga0182144_10641991	3300015307	Miscanthus Phyllosphere	MEYDGYDEYGIITPAMVTIVMLLNDIPLVWHRLVANLESNSYN*
Ga0182144_10734691	3300015307	Miscanthus Phyllosphere	MEYDGYAEHGIIIPAMVTIVMLLNYIPHVWHKLVANLAMNSYN*
Ga0182144_10938301	3300015307	Miscanthus Phyllosphere	MEYDGYDGYENLTSAMVTIVMILNDIPHAWHRLVDNPEMNSYN*
Ga0182144_11018241	3300015307	Miscanthus Phyllosphere	MECDGSDKDGITTPAMVTIVCFENDIPHVWHRIVANLEMNSYN*
Ga0182142_10122653	3300015308	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHSDISHVWHMLVVNLEVNSYN*
Ga0182142_10180191	3300015308	Miscanthus Phyllosphere	MEYDGSNEYENLTPAMVTILKLLNDIPHVWHRVVANLEMNSYN*
Ga0182142_10272001	3300015308	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVIIVMLHNHTSHVWHMLDANLEMNSYN*
Ga0182142_10501241	3300015308	Miscanthus Phyllosphere	MEFDGYNEHGNVTLAMVIIVLLHNHTSHVWHRLDANIEMNSYNQLGTEL*
Ga0182142_10501331	3300015308	Miscanthus Phyllosphere	MKCDGYDEHGIIIPAMVTIVLLLNDIPHVWHRLVANLEMNSYN*
Ga0182142_10519711	3300015308	Miscanthus Phyllosphere	MELLHRSNWIMEYVGSDGYENITPAMVIIVMLLNDIPHVWHRLVANLEMDNYN*
Ga0182142_10605411	3300015308	Miscanthus Phyllosphere	MEYDGYDEHRIITPAMFTIIMLLNATPHVWQRLVANLEMNSYNELDDRI
Ga0182142_10626101	3300015308	Miscanthus Phyllosphere	RSNWIMESDGSNEFENLTPAMVTIVVLLNDIPHVWHRLVANLEMNSYN*
Ga0182142_10779412	3300015308	Miscanthus Phyllosphere	MEPLHGSNWIMEYDGSDEYENLTLAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182140_10486671	3300015314	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHNDISHVWYRLDANLEMNSYN*
Ga0182140_10853701	3300015314	Miscanthus Phyllosphere	SNWTMEFDGYIGHGNATPAMVIIVMLHNDISHVWHRLVVNLEVNSYN*
Ga0182140_10886522	3300015314	Miscanthus Phyllosphere	YIGHGNATPAMVIIVMLHNDISHVWHMLIVNLEVNSYN*
Ga0182127_10392671	3300015321	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVILHNDISHVWHRLVVNLEVNSYN*
Ga0182127_10497671	3300015321	Miscanthus Phyllosphere	MEYDGYDEHRIITLAMVTIVMLLNDIPHVLQRLVANLEMNSYN*
Ga0182127_10649411	3300015321	Miscanthus Phyllosphere	MKYDGYDEYDNLTPAMVTVVMLLIDVPHVWHRLVANLEMNSYN*
Ga0182127_10936551	3300015321	Miscanthus Phyllosphere	MEFDGHIGHGNATLAMVIIVMLHNDISHVWHRLVVNLEVNSYN*
Ga0182127_11002031	3300015321	Miscanthus Phyllosphere	MEFDGYDEHGIITPAMITIIMLLNDIPHVWHRLVANLEMNSYN*
Ga0182127_11108451	3300015321	Miscanthus Phyllosphere	MEFDGYDENGNVIPAMVTTIMLLNDIPYVWHRLVANLEINSYN*
Ga0182110_10556201	3300015322	Miscanthus Phyllosphere	LTELLHRSNWIMEYDGSDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182129_10323671	3300015323	Miscanthus Phyllosphere	VRNLASSNIVESVLWNDGYEEHGITTPAMVFIVMLRNDIPYVWHRLVANLEMNSDN*
Ga0182129_10450131	3300015323	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVIIVMLHNHTSHVWHRLDANLDMNSYN*
Ga0182129_10938381	3300015323	Miscanthus Phyllosphere	MEFDGHIGHGNATPAMVIIVMLHNDISHVWHWLDAYLEMNSYN*
Ga0182129_11055311	3300015323	Miscanthus Phyllosphere	MGLLHRSNWIMEYDGSDEYENLTPAMVNIVMLLNDIPLVWHRLVANLEMNSYN*
Ga0182129_11066401	3300015323	Miscanthus Phyllosphere	MEFDGHIGHGNATLAMVIIVMLHNDISHVWHMLDANLE
Ga0182129_11077871	3300015323	Miscanthus Phyllosphere	MEFDGYDEHGNATPSMVIIVMLHNHTSHVWHKLDANLEMHGYN*
Ga0182187_10481551	3300015341	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIIMLLNDIPHVWHRLVANLEMNSYN*
Ga0182187_11682711	3300015341	Miscanthus Phyllosphere	MEFDGYDEHVIITPAMVNIVMLINDIPHVWHRLVANLEMN
Ga0182187_11763152	3300015341	Miscanthus Phyllosphere	VELLHLSNWIMEYEGSDEYENLTPAMVTIVMLLNDIPHVWHMLDANLEMNSYN*
Ga0182187_11859371	3300015341	Miscanthus Phyllosphere	MEYDGYDKHGIITPAMVTIVLQLNDVPLVWHMLDANLEINSYN*
Ga0182187_12003251	3300015341	Miscanthus Phyllosphere	MEFDGYDEHGIITPAMVTIVMLLNDIPYVWHRLVANLEMNSYN*
Ga0182109_11267771	3300015342	Miscanthus Phyllosphere	MEYDGSNESKNLTSAMATIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182109_11393451	3300015342	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIMMLHNDISHVWHRLVVNLEMNSYN*
Ga0182109_11694221	3300015342	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMIIIVMLHNYISHVWQTLDAKLEMNSYN*
Ga0182109_11766861	3300015342	Miscanthus Phyllosphere	MEFDGYDEHGIITPAMVTIVMLLNDIPYVWHRLVANLEMNSCN*
Ga0182109_11898573	3300015342	Miscanthus Phyllosphere	HHSNCAMEHDGLEEYGITIPGMVTIVCFSINIPHVWHRIVANLEMYS*
Ga0182109_12151881	3300015342	Miscanthus Phyllosphere	MEFDGYDDHGNVTLDMVIIVMLHIHISHVWHMLDANLEMNSYN*
Ga0182155_10553902	3300015343	Miscanthus Phyllosphere	ECDGYDEHGKYYTSYGYFCMLLNDIPHIWHRLVANLEMNSYN*
Ga0182155_10569601	3300015343	Miscanthus Phyllosphere	MEYDGYDERGNVTPAIVTIVMLPNCISYVWHWLVANLEMNGYN*
Ga0182155_11030192	3300015343	Miscanthus Phyllosphere	MEYDGYDEHGIITLAMVTIVMLLNDIPHVWHRLVANLEMNSYN*
Ga0182155_11075821	3300015343	Miscanthus Phyllosphere	MEYDGSNEYENLTPAMVTIVMLLNDIPHVWHRLVVNLETNSYN
Ga0182155_11519091	3300015343	Miscanthus Phyllosphere	MEFVGYDEHGNVTLAMVIIVMLHNHTSHVWHRLDANLEMNSYN*
Ga0182155_11566591	3300015343	Miscanthus Phyllosphere	MECDGYDGYGHDTPVVVIIVMLPNHTPHVWHRLDANLEM
Ga0182155_11576061	3300015343	Miscanthus Phyllosphere	EHGIIIPAMVTIIMLLNDIPHVHMLVANLGMNSYN
Ga0182189_10570701	3300015344	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVIIVMLHNHTSHVWHRLDANLEVNSYN*
Ga0182189_11489241	3300015344	Miscanthus Phyllosphere	MEYDGYDKHGIITPAMVTIVMLLYDIPHFWHMLVANLEMNSYN*
Ga0182189_11847671	3300015344	Miscanthus Phyllosphere	GYDEYDNITLAMVAIVMLLKDIPHVWHMLVVNLEVNSYN*
Ga0182189_11985321	3300015344	Miscanthus Phyllosphere	MEFDGYDEHGIITPTMVTIEMLLNDIPHVWHRVVANLEVNSYN*
Ga0182111_11356392	3300015345	Miscanthus Phyllosphere	MEFDGYIGHGNATLAMVIIVMLHNDISHVWHRLDANLEMNSYN*
Ga0182111_11484921	3300015345	Miscanthus Phyllosphere	MEFDGYDEHGIITPAMVTITIVMLLNDIPHVWHRLFANLEMNSYN*
Ga0182111_12133991	3300015345	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIVMLLKYIPHVWHRLVANLEMNCNN*
Ga0182111_12267341	3300015345	Miscanthus Phyllosphere	MEFDGYDKHRNVTPAMVIIVMLHNDISHVWYRLDANLEMNSYN*
Ga0182111_12329221	3300015345	Miscanthus Phyllosphere	MKYDGSNEYENLTPAIVTIVMLLNAIPNVWHMLVANLEMNSYN*
Ga0182111_12383041	3300015345	Miscanthus Phyllosphere	MEFDGYIGHGNATLAMIIIVMLYNDISHVWHRLVVNL
Ga0182139_10568181	3300015346	Miscanthus Phyllosphere	MEFNGYDEHGNVIPAMVIIVMLHNYISHVLHRLDANLEMNSYN*
Ga0182139_10707272	3300015346	Miscanthus Phyllosphere	MEFDGYIGHGNATPAIVIIVMLHNDISHGWHRLVVNLEVNSYN*
Ga0182139_11691161	3300015346	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAVVIIIMLHNYISHVWHRLDANLEMNSYN*
Ga0182139_11961121	3300015346	Miscanthus Phyllosphere	MEYDGYGEHEIITPAIVTIGMLLNDIPHVWHRLVANLEMNSYN*
Ga0182139_11966531	3300015346	Miscanthus Phyllosphere	MKFDGYDEHGNVTPAMVIIVILHNPTSHVWHRLDANIEMNSCNQLGTEL*
Ga0182139_12092501	3300015346	Miscanthus Phyllosphere	MEFDGYDEHGIITPAMVTIVMRPNDIPHIWHMLVANLEMNSYN*
Ga0182139_12253681	3300015346	Miscanthus Phyllosphere	SQHRSNWIMEYDGYDEHGIITLAMVTIVMLLNDIPHVLHRLVANLVMNSYN*
Ga0182139_12376151	3300015346	Miscanthus Phyllosphere	MECDGYDEHGKYYLAMVTIVMLLNDIPHVCHMLVANLEMNSYN*
Ga0182177_11069761	3300015347	Miscanthus Phyllosphere	MEYDGYVEHGIITLAMVAIVMLLNDIPHVWHRLVANLE
Ga0182177_12228631	3300015347	Miscanthus Phyllosphere	MEYDGYAEHGITTTTMVTIVMLLNDISHVWHKLVANLEM
Ga0182161_11524181	3300015351	Miscanthus Phyllosphere	MEFDGYDEHGNATPAMVIIVMLHNHTSHVWHRLYANLEMNSYN*
Ga0182161_12090672	3300015351	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIGMLLNDIPHIWHMLVANLEMNSYN*
Ga0182161_12173171	3300015351	Miscanthus Phyllosphere	GSDEYENLTSAMVTIVMPLNDIPHVWHMLVANLEMNSYN*
Ga0182161_12375131	3300015351	Miscanthus Phyllosphere	MEFNSYDEHGNIIPAMVIIVMQHNYISHVWHRLDANLEMNSYN*
Ga0182159_10363441	3300015355	Miscanthus Phyllosphere	MEHDGSDEHGITTPTMVIIVLLNDILHVWHRLVANLE
Ga0182159_11139792	3300015355	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIVMLVNDIPHVCHMLVANLE
Ga0182159_12310562	3300015355	Miscanthus Phyllosphere	SNTMEFDGYDEHGNVTLAMVIIVILHNHTSHVWHRLDANIKTNSYN
Ga0182159_13315501	3300015355	Miscanthus Phyllosphere	YDGSDEHGIFIPAMVTIVMLLNDIPDVWYWLVANLEMNSYN*
Ga0182159_13373281	3300015355	Miscanthus Phyllosphere	HRSKWIIEYDGSDEYENLTPAMVTIVMLLSDIPHGWHRLVANLEMNNYN*
Ga0182159_13503051	3300015355	Miscanthus Phyllosphere	MEYDGYAEHGIITLAMVTIVMLLNDIPHVWHRLVA
Ga0182145_10224682	3300015361	Miscanthus Phyllosphere	MEYDGYDEHGIIIPAMVTIVLLLNDIPHIWHRLVANLEMNSYN*
Ga0182145_10995441	3300015361	Miscanthus Phyllosphere	ELWNDGYDEHGIITSDMVTIAMLLNDIPHVWHRLVANLEMNSYN*
Ga0182145_11094681	3300015361	Miscanthus Phyllosphere	MEFDGYDEYGNVTPAMVIIVMLHNHTSHVLHMLDANLEMNSYS*
Ga0182145_11310211	3300015361	Miscanthus Phyllosphere	MEYDGSNKYENLTLAMVTIVMILNDIPHVWHRLVANLEMNSYN*
Ga0182145_11313091	3300015361	Miscanthus Phyllosphere	DGYIGHGNATLAMVIIVMLHNDISHVWHRLVGNLEVNNYN*
Ga0182145_11570541	3300015361	Miscanthus Phyllosphere	MEYDGYDEHRIITPAMVTIVMLLNDIPHVWHRLVANPQMNNYN*
Ga0182145_11900971	3300015361	Miscanthus Phyllosphere	MEYDGSNEYENLTPTMVTIIMLLNDIPHVWHRLVANQEMNSYN*
Ga0182145_11944711	3300015361	Miscanthus Phyllosphere	MEPLHSSNWIMEYDGSNEFENLTPAMVTIVMLLNDIPYVCHRLVANLEMNSYN*
Ga0182203_10235581	3300017404	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVIIVMLPNHTSHVWHMLDANLEMNSYN
Ga0182203_10753011	3300017404	Miscanthus Phyllosphere	MEYDGYDEHRIITPAMFTIIMLLNATPHVWQRLVANLEMNSYNELDDRII
Ga0182203_11615941	3300017404	Miscanthus Phyllosphere	MEFDGYIGDGNATPAMVIIVMLHNDISHVWHRLVVNLEVNSYN
Ga0182220_10667811	3300017407	Miscanthus Phyllosphere	MEYDGYDEHGVITLAMVTIVMLLNDIPHVWHRLVANLEMNRYI
Ga0182220_10798191	3300017407	Miscanthus Phyllosphere	DGYDEHGIITPAMVTIFLLHNDRSHVWHMLVANLEMNSYN
Ga0182220_11035401	3300017407	Miscanthus Phyllosphere	MEFDGYDEHGIITPAMVTIGMLLNDIPHVWHMXVANLEMNS
Ga0182204_10464101	3300017409	Miscanthus Phyllosphere	MEFDGYIGHGNATTAMVIIVMLHNDISHVWHRLVVNLDVNIYN
Ga0182204_10464921	3300017409	Miscanthus Phyllosphere	MELLHRSNWIMEYDGSDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182204_10599981	3300017409	Miscanthus Phyllosphere	GYDEHGIIIPAMVTIIMLLNDIPHVXHMLVANLGMNSYN
Ga0182204_10660231	3300017409	Miscanthus Phyllosphere	STCIMKYDDYDEHRIITPAMVTIVMLLNDIPYIWHMLVPNLEMNSYN
Ga0182204_10773701	3300017409	Miscanthus Phyllosphere	MASPNIVVIVLWNDGYDEHGIIIPAMVTIVMLLNDIPHVWHRLFANLEMNSYN
Ga0182204_10812301	3300017409	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIVMLLNDIPHVWHMLVANPEMNSYN
Ga0182204_10888772	3300017409	Miscanthus Phyllosphere	MKHDGSDEYGITIPAMVTIVCFSIDIPHVWQGIVANLEMDSYN
Ga0182207_10757471	3300017410	Miscanthus Phyllosphere	NEYENLTPAMVTIVMLLNEVPHVWHRLVANLEMNGYN
Ga0182207_10999651	3300017410	Miscanthus Phyllosphere	IMEYDGYDEYENLTPAMVTIVMLLNDVTHVWNRLVANLEMNSYN
Ga0182207_11324941	3300017410	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHIDISHVWHKLVVNLEVNSYN
Ga0182207_11377072	3300017410	Miscanthus Phyllosphere	MECEGYDEHGNDTPAMVIIVMLPNHTSHVWHRLDANLEMNSYN
Ga0182208_10513461	3300017411	Miscanthus Phyllosphere	MEFDGYIGHGNATSAMVIIVMLHNDISHVWHGLVVNLEVNSYN
Ga0182208_10984631	3300017411	Miscanthus Phyllosphere	MEYDGYNEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182208_11231591	3300017411	Miscanthus Phyllosphere	MEFDVYIGHGNATPAMVIIVMLHNDISHVWHKLVVNLEVNNYN
Ga0182222_10568231	3300017413	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHNDISHVWHRLVVNLEVNSYN
Ga0182222_10850762	3300017413	Miscanthus Phyllosphere	MELLYRSNWIMEYDGCDEYENLTLAMVTIVMLLNDIPHIWHRLVANLEMNSYN
Ga0182222_11018671	3300017413	Miscanthus Phyllosphere	MEYDGYAEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182202_10573361	3300017415	Miscanthus Phyllosphere	MECDGYVEHGNVTPAMVIIAMLTNSTSHVWHRLVANLEMNSYN
Ga0182202_11281281	3300017415	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHNDISHVWHRLVINLEVNSYN
Ga0182230_10683851	3300017417	Miscanthus Phyllosphere	LIMEYDGYDEREKVTLAMVTIVLLQNGRSYVWHRLVANLEMNSYN
Ga0182228_10476041	3300017420	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVIIVMLLNDISHVWHRLVANLEMNSCN
Ga0182228_10864221	3300017420	Miscanthus Phyllosphere	MEYNGYDEHGIITSAMVTIVMLLNDIPHVCYRLVANLEMNSYN
Ga0182219_10421531	3300017424	Miscanthus Phyllosphere	MEFNGYDEHGNVTPAMVIIVMLPNHTSHVWHMLDDNLVMNSYN
Ga0182219_10808811	3300017424	Miscanthus Phyllosphere	MEHDGSHEHGFTIPAMVTIVCSSNDIPHVWHRIVANLEMDSHN
Ga0182224_10497541	3300017425	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIVMLLNDIPHIWHWLVANIEMNSYN
Ga0182224_10779541	3300017425	Miscanthus Phyllosphere	MEYDGSNEYENLTPAMVIIVMLHNYISHVWHMLDVNLEMNNYN
Ga0182224_10894732	3300017425	Miscanthus Phyllosphere	MEFDGYDEHGNVILAMVIIVMRPNHTSHVWHRLYANLEMNSYN
Ga0182224_11206351	3300017425	Miscanthus Phyllosphere	LNRYLSQIVRNLTELLHRSNWIMEYDGSDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182190_10422451	3300017427	Miscanthus Phyllosphere	MEFDGYIRHGNATPAMTIIEMIHNDISHVWHRLVVNLEVNSYN
Ga0182190_10844252	3300017427	Miscanthus Phyllosphere	MEYDGYAKHGIITMAMVTIIMQLNDIPHVWHKLVANLVIYCYN
Ga0182190_11232311	3300017427	Miscanthus Phyllosphere	MEYGGNDEHGIITPAMVTIGMLLNDIPHVWHMLVANLEMSSYN
Ga0182190_11430241	3300017427	Miscanthus Phyllosphere	MDFDGYVEHGIITPAMVTIVMLLNDIPHIWHRLVANLE
Ga0182190_11443691	3300017427	Miscanthus Phyllosphere	MEYDGYDEHGIITPVMVTIVMLLNDIAHVWHRIVANLEVN
Ga0182192_10752062	3300017430	Miscanthus Phyllosphere	MEPLRHSNWIMEYDGSDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182192_10938331	3300017430	Miscanthus Phyllosphere	MKYNGSDEYENLTPAMVTIVMLLNDIPHVWLMLVANPEMNNYN
Ga0182192_11480391	3300017430	Miscanthus Phyllosphere	YDGSDEYENLTPAMVTIVMLLNDIPHVWHMLVANPEMNSYN
Ga0182206_10468241	3300017433	Miscanthus Phyllosphere	MELDGYDEHGNVIPAMVTIVMLLNDIPHVWHRLVANLEINSYN
Ga0182206_10841301	3300017433	Miscanthus Phyllosphere	HIGHGNATTAMVIIVMLYNDIPHVWHRLDANLELNSYN
Ga0182206_10984991	3300017433	Miscanthus Phyllosphere	MEPFHRSNWIMEYDGSDEYENLTPAMVTIVILLNDIPHVWHRLVANLEMNSYN
Ga0182206_11160571	3300017433	Miscanthus Phyllosphere	MEYDDYDEYENLTPAMVTIGMLLNDVPHVWHRLVANLEMNSYN
Ga0182206_11350471	3300017433	Miscanthus Phyllosphere	EYDGSDKYENLTPVMVTIVMLLNDIPHVWHMLLANLEMNIYN
Ga0182206_11495031	3300017433	Miscanthus Phyllosphere	MEFDGHIGHGNATPAMVIIVMLHNDISHVWYRLDANLEMNSYN
Ga0182209_10179491	3300017436	Miscanthus Phyllosphere	IMEYDGSDEYENLTPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182209_10924481	3300017436	Miscanthus Phyllosphere	MEYDGYDEHGIITPDMVTIAMLLNDIPHVCHILVANLEMNSYN
Ga0182209_11033891	3300017436	Miscanthus Phyllosphere	MKHDGYDEHGIIIVAVVIIVMIQNDIPHVWHRLVANLEMNSYN
Ga0182209_11332281	3300017436	Miscanthus Phyllosphere	MEFDGHNGHGNGTLAMVIIVMLHNDISHVWHRLDANLEMNSNN
Ga0182209_11373371	3300017436	Miscanthus Phyllosphere	VRNLIEPLHRSNWIMEYDGSDEYENLTPAMVITIMLLNDIPHVWHRLITNLEMNSYN
Ga0182191_10457571	3300017438	Miscanthus Phyllosphere	MEFDGYDEYGIITPAMVTIVMLLNDIAHIWHRLDANLEMNSYN
Ga0182191_10943121	3300017438	Miscanthus Phyllosphere	NCIMEYDGYGEHGIITQAMVTIIMLLNDIPHVWHRLVANLEMNSYN
Ga0182191_11539251	3300017438	Miscanthus Phyllosphere	MEFDGYDEQGNVTLAMVIIVMQHNHTSHVWHRLDANLEMNSYN
Ga0182191_11688321	3300017438	Miscanthus Phyllosphere	MEYDGSDEYENFTPAMVTIVMLLSDIPHVWHMLVANLEMNRYNY
Ga0182221_10503031	3300017442	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIVMLLNDVPHVWHMLVANLEMNSYN
Ga0182221_11435721	3300017442	Miscanthus Phyllosphere	MEFDGYDEQGNVTPAMVIIVMLCNHTSHVWHRLDANLEMNSYN
Ga0182221_11445292	3300017442	Miscanthus Phyllosphere	HRSNSTMEFDGSDKHGNVTLAMVIIVMLDNPTSHAWHRLDANL
Ga0182221_11533981	3300017442	Miscanthus Phyllosphere	MEFDGYDEHGNVTPAMVIIVMLHNHTSHVWHMLDANLEMNSYN
Ga0182193_10170971	3300017443	Miscanthus Phyllosphere	MEFDGHIGHGNATSAMVIIVMLHNDISHVWHMLDANLEMNSYN
Ga0182193_10790561	3300017443	Miscanthus Phyllosphere	MEFDGYIGHGNATPVMVIIVMLHNVISHVWHRLVINLEVNSYK
Ga0182193_11000971	3300017443	Miscanthus Phyllosphere	MEYDGSDEYKNLTPAMVTIVMLLNDIPHVWHMLVANLEMNSYN
Ga0182193_11756751	3300017443	Miscanthus Phyllosphere	MEYDGYDEYDNITLAMVAIVMLLKDIPHVWHRILANLEVNSYN
Ga0182233_10580751	3300017680	Miscanthus Phyllosphere	MEYDVSDEYENLTLAMVTIVMLLNNIPHVWHMLVANLELNSYN
Ga0182226_10412761	3300017681	Miscanthus Phyllosphere	MEYDGYDEHGNVTPAMVIIVMLHNHTSHVWHRLDANLEMNSYN
Ga0182226_10565262	3300017681	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMLHNDISHVWHRLVVNLEVNSYNCLDTEL
Ga0182229_10643001	3300017682	Miscanthus Phyllosphere	MEFGGYDEYGNVTPAMVIIVMLHNHTSHVWHRIDANLEMNSYN
Ga0182218_10722391	3300017683	Miscanthus Phyllosphere	DGSDEYENLTPAMVTIVMLLNDIPHVWLMLVANPEMNNYN
Ga0182218_10846741	3300017683	Miscanthus Phyllosphere	MEHDGSDEYGITIPMVTIVCFEIDIPHVWHRIVANLEMDRYN
Ga0182218_10912731	3300017683	Miscanthus Phyllosphere	MEYDGLDEHGITTLAMVTIVMLLNDIPHVWHRLVTNLEMNVYN
Ga0182218_11107481	3300017683	Miscanthus Phyllosphere	LDKHGITTLAMVTIVCSKNDTSHVWHRIVTNLEMDSYN
Ga0182218_11514041	3300017683	Miscanthus Phyllosphere	MEFNGYDEHGNVILVMVIIVLLYNYISHVWHRLHANLEIN
Ga0182225_10486891	3300017684	Miscanthus Phyllosphere	VRNLTELLHRSNWIMEYDGSDEYENLTPAMVTIVILINDIPHVWHRLVTNLEMNVYN
Ga0182225_10527252	3300017684	Miscanthus Phyllosphere	MEYDGSDEYENLTPAMVTIVMLLNYITHVWHGLVANLEMNSYN
Ga0182225_10537762	3300017684	Miscanthus Phyllosphere	GYDEHGIIIPAMVTIVMLLNNIPHVWHRLVTNLEMNRYI
Ga0182225_10719931	3300017684	Miscanthus Phyllosphere	MEFDGYDEHGIITSAMVTIVMLLNDVPHVWHMLVANLEINNYN
Ga0182225_10825671	3300017684	Miscanthus Phyllosphere	NIVISVLWNDGYEEHEITTPAMVIIVILLNVIPYVWHRLVANLEINSYN
Ga0182225_10913281	3300017684	Miscanthus Phyllosphere	MEFDGYIGHGNATPAMVIIVMVHNDISHVWHRLVVNLEVNSYN
Ga0182225_11022021	3300017684	Miscanthus Phyllosphere	MEFDGYDEHRNVTPAMVIIVMLHNYISHVWHRIDANLEMNSYN
Ga0182225_11189352	3300017684	Miscanthus Phyllosphere	MEYDGYAEHGIITMAMVTIVMLLNDIPHVWHKLVANLEMNCYN
Ga0182227_10621331	3300017685	Miscanthus Phyllosphere	MEYDGYDEHGIITLAMVTIVMLLKAIPHVWHRLVANLEMNSYN
Ga0182227_10684331	3300017685	Miscanthus Phyllosphere	VVSVLWNDGYEEHGITIPAMVIIVMLPNDIPHVWHMLVVNREMNSYN
Ga0182227_10701131	3300017685	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIVMLLNDIPHVWYMLVANL
Ga0182227_10753741	3300017685	Miscanthus Phyllosphere	MEYDGSDEYENLTLAMVTIVMLLNDIPHVWHRLVAN
Ga0182227_10818221	3300017685	Miscanthus Phyllosphere	EYDGSDEYENLTPDMATIIMLLNDIPHLWHRLVANLEMNSYN
Ga0182227_10820341	3300017685	Miscanthus Phyllosphere	IMEYDGYDEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0182227_11013521	3300017685	Miscanthus Phyllosphere	MEFDGSDEHGIITPAMVTIVILLNNIPHVWYRLVGNLEMNSYN
Ga0182227_11370291	3300017685	Miscanthus Phyllosphere	VTILWNNGYDEHGIMIPAMVTIVILLNDIPHVWHRLDANLEMNSYN
Ga0182205_11130891	3300017686	Miscanthus Phyllosphere	MEYDGYDEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNNY
Ga0182205_11368361	3300017686	Miscanthus Phyllosphere	TVRNIASTNIVVTVLWNGCYDEHGIIIPAMVTIVMLLNDIPHVWHMLVANLEMNSYN
Ga0182231_10339771	3300017689	Miscanthus Phyllosphere	MEFDGYIGHGNATLAMVIIVMLHNDISHVWHRLDANLEMNSYN
Ga0182231_10917241	3300017689	Miscanthus Phyllosphere	MECDGYDEHGNVTPAMVIIVMLPNSMSHVWHRLVANLEMNSYN
Ga0182223_10860451	3300017690	Miscanthus Phyllosphere	MEFDGYVEHENVTLAMVIIVMLSNFTSHVWHRLDANLEMNSYN
Ga0182223_10861691	3300017690	Miscanthus Phyllosphere	MEYDGYDEYDNITLAMAAIIMLLNDIPHVWYMLVANLEMNSYN
Ga0182223_10932411	3300017690	Miscanthus Phyllosphere	MEFDGYIGHGNATLAMVIIVMLHNDISHVWHRLVVNLEVNSYN
Ga0182223_10967882	3300017690	Miscanthus Phyllosphere	MDFDGYMGHGNATLAIVIIVMLHNDISHVWHRLVVNLEVNSYN
Ga0182223_11018852	3300017690	Miscanthus Phyllosphere	MEYDGFDEYENLTPAMVTIVMLLNDIPHVWHKLVANLEMKSYN
Ga0182223_11204951	3300017690	Miscanthus Phyllosphere	DEYGNVTPAMVIIIIMLHNHTSHVWHRLDANLEVNSYN
Ga0207643_101017171	3300025908	Miscanthus Rhizosphere	MEYDGYDEHGIITPAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0207691_110339901	3300025940	Miscanthus Rhizosphere	MEYDGYDEHGIITLAMVTIVMLLNDIPHVWHRLVANLEMNSYN
Ga0207675_1027285121	3300026118	Switchgrass Rhizosphere	MEYDGSDEYENLTPAMVTIVILLNDIPHVWHRLVANLEMNSYN

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.40
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.40
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F010031

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign