NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F010131

Metagenome / Metatranscriptome Family F010131

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F010131
Family Type Metagenome / Metatranscriptome
Number of Sequences 308
Average Sequence Length 47 residues
Representative Sequence KVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKPALPAVK
Number of Associated Samples 248
Number of Associated Scaffolds 308

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.97 %
% of genes near scaffold ends (potentially truncated) 97.40 %
% of genes from short scaffolds (< 2000 bps) 92.21 %
Associated GOLD sequencing projects 230
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.442 % of family members)
Environment Ontology (ENVO) Unclassified
(35.390 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.104 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.73%    β-sheet: 0.00%    Coil/Unstructured: 70.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 308 Family Scaffolds
PF00753Lactamase_B 10.06
PF13360PQQ_2 5.19
PF02771Acyl-CoA_dh_N 2.92
PF13442Cytochrome_CBB3 2.92
PF13378MR_MLE_C 2.27
PF01845CcdB 1.95
PF07995GSDH 1.95
PF12796Ank_2 1.30
PF13857Ank_5 0.97
PF13460NAD_binding_10 0.97
PF16980CitMHS_2 0.97
PF03781FGE-sulfatase 0.65
PF08309LVIVD 0.65
PF08439Peptidase_M3_N 0.65
PF13531SBP_bac_11 0.65
PF02746MR_MLE_N 0.65
PF04402SIMPL 0.65
PF07519Tannase 0.65
PF02585PIG-L 0.32
PF04307YdjM 0.32
PF02627CMD 0.32
PF13091PLDc_2 0.32
PF03724META 0.32
PF11746DUF3303 0.32
PF13637Ank_4 0.32
PF13426PAS_9 0.32
PF06736TMEM175 0.32
PF10637Ofd1_CTDD 0.32
PF08281Sigma70_r4_2 0.32
PF02239Cytochrom_D1 0.32
PF01019G_glu_transpept 0.32
PF01741MscL 0.32
PF02410RsfS 0.32
PF12833HTH_18 0.32
PF11253DUF3052 0.32
PF03544TonB_C 0.32
PF00135COesterase 0.32
PF05199GMC_oxred_C 0.32
PF02371Transposase_20 0.32
PF00012HSP70 0.32
PF13090PP_kinase_C 0.32
PF08450SGL 0.32
PF17185NlpE_C 0.32
PF00067p450 0.32
PF07969Amidohydro_3 0.32
PF00144Beta-lactamase 0.32
PF02803Thiolase_C 0.32
PF12543DUF3738 0.32
PF01833TIG 0.32
PF09980DUF2214 0.32
PF01808AICARFT_IMPCHas 0.32
PF01894UPF0047 0.32
PF01261AP_endonuc_2 0.32
PF07589PEP-CTERM 0.32
PF07676PD40 0.32
PF05559DUF763 0.32
PF13533Biotin_lipoyl_2 0.32
PF013675_3_exonuc 0.32
PF12681Glyoxalase_2 0.32
PF12740Chlorophyllase2 0.32
PF13709DUF4159 0.32
PF01345DUF11 0.32
PF00069Pkinase 0.32
PF02687FtsX 0.32
PF08241Methyltransf_11 0.32
PF12704MacB_PCD 0.32
PF03972MmgE_PrpD 0.32
PF00202Aminotran_3 0.32
PF00171Aldedh 0.32
PF10576EndIII_4Fe-2S 0.32
PF12867DinB_2 0.32
PF07040DUF1326 0.32
PF01906YbjQ_1 0.32
PF13419HAD_2 0.32
PF00561Abhydrolase_1 0.32
PF02789Peptidase_M17_N 0.32

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 308 Family Scaffolds
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 2.92
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 1.95
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 1.30
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.30
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.65
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.65
COG2859Outer membrane channel-forming protein BP26/OMP28, SIMPL familyCell wall/membrane/envelope biogenesis [M] 0.65
COG2968Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domainFunction unknown [S] 0.65
COG3471Predicted secreted (periplasmic) proteinFunction unknown [S] 0.65
COG5276Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domainFunction unknown [S] 0.65
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.32
COG0138AICAR transformylase/IMP cyclohydrolase PurHNucleotide transport and metabolism [F] 0.32
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.32
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.32
COG0260Leucyl aminopeptidaseAmino acid transport and metabolism [E] 0.32
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.32
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.32
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.32
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.32
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.32
COG0799Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunitsTranslation, ribosomal structure and biogenesis [J] 0.32
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.32
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.32
COG1415Uncharacterized conserved protein, DUF763 domainFunction unknown [S] 0.32
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.32
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.32
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.32
COG1988Membrane-bound metal-dependent hydrolase YbcI, DUF457 familyGeneral function prediction only [R] 0.32
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.32
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.32
COG2124Cytochrome P450Defense mechanisms [V] 0.32
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.32
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.32
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.32
COG2367Beta-lactamase class ADefense mechanisms [V] 0.32
COG3187Heat shock protein HslJPosttranslational modification, protein turnover, chaperones [O] 0.32
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.32
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.32
COG3547TransposaseMobilome: prophages, transposons [X] 0.32
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.32
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.32
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.32

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.47 %
UnclassifiedrootN/A17.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035918006|FACEMD_F1OL2UU01EH697All Organisms → cellular organisms → Bacteria514Open in IMG/M
2124908009|FWIRA_GRAM18402GPDFUAll Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
2170459012|GOYVCMS01BH4D7All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
2170459016|G1P06HT02IRPOQAll Organisms → cellular organisms → Bacteria747Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0396660All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium542Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0546289All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300000559|F14TC_100615911All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300000881|JGI10215J12807_1290955All Organisms → cellular organisms → Bacteria → Acidobacteria1138Open in IMG/M
3300000956|JGI10216J12902_122487542All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300001849|RCM26_1190294Not Available566Open in IMG/M
3300003267|soilL1_10034153All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1694Open in IMG/M
3300003319|soilL2_10071914All Organisms → cellular organisms → Bacteria → Proteobacteria1380Open in IMG/M
3300003991|Ga0055461_10193421All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium549Open in IMG/M
3300004022|Ga0055432_10029442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1207Open in IMG/M
3300004024|Ga0055436_10287921All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium529Open in IMG/M
3300004058|Ga0055498_10110074All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300004114|Ga0062593_100455382All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300004157|Ga0062590_103012693All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium505Open in IMG/M
3300004479|Ga0062595_100024479All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300004643|Ga0062591_100017701All Organisms → cellular organisms → Bacteria3350Open in IMG/M
3300004643|Ga0062591_101096159All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005331|Ga0070670_102225177Not Available505Open in IMG/M
3300005332|Ga0066388_102058586All Organisms → cellular organisms → Bacteria → Proteobacteria1025Open in IMG/M
3300005333|Ga0070677_10119007All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1190Open in IMG/M
3300005335|Ga0070666_10125104All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300005336|Ga0070680_100072834All Organisms → cellular organisms → Bacteria → Proteobacteria2824Open in IMG/M
3300005336|Ga0070680_100877521Not Available774Open in IMG/M
3300005337|Ga0070682_101087876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300005340|Ga0070689_100203710All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300005340|Ga0070689_100816295All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300005365|Ga0070688_100589852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium849Open in IMG/M
3300005456|Ga0070678_100951209All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005530|Ga0070679_101971137All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium533Open in IMG/M
3300005535|Ga0070684_100678797All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium960Open in IMG/M
3300005538|Ga0070731_10102617All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300005538|Ga0070731_10229608All Organisms → cellular organisms → Bacteria → Acidobacteria1232Open in IMG/M
3300005544|Ga0070686_100414066All Organisms → cellular organisms → Bacteria → Acidobacteria1028Open in IMG/M
3300005544|Ga0070686_101495618All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300005544|Ga0070686_101702807All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium535Open in IMG/M
3300005547|Ga0070693_101188629All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium585Open in IMG/M
3300005548|Ga0070665_102078545All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300005564|Ga0070664_100880609All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300005578|Ga0068854_101423348All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium627Open in IMG/M
3300005614|Ga0068856_101070039Not Available824Open in IMG/M
3300005617|Ga0068859_102748562All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005718|Ga0068866_10239555All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300005719|Ga0068861_100873459All Organisms → cellular organisms → Bacteria → Proteobacteria850Open in IMG/M
3300005764|Ga0066903_106723993All Organisms → cellular organisms → Bacteria → Proteobacteria598Open in IMG/M
3300005764|Ga0066903_107750921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales552Open in IMG/M
3300005836|Ga0074470_10640775All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300005840|Ga0068870_10145024All Organisms → cellular organisms → Bacteria → Proteobacteria1393Open in IMG/M
3300005840|Ga0068870_11047816Not Available584Open in IMG/M
3300005841|Ga0068863_101719272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300005842|Ga0068858_100985402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300005844|Ga0068862_100076208Not Available2902Open in IMG/M
3300005844|Ga0068862_102333245All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300006052|Ga0075029_101131269Not Available545Open in IMG/M
3300006163|Ga0070715_10578537All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300006176|Ga0070765_101157036All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300006196|Ga0075422_10065289All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300006237|Ga0097621_100116267All Organisms → cellular organisms → Bacteria2265Open in IMG/M
3300006358|Ga0068871_100053932All Organisms → cellular organisms → Bacteria3260Open in IMG/M
3300006358|Ga0068871_100680479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium941Open in IMG/M
3300006577|Ga0074050_11473994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300006755|Ga0079222_11517757All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300006844|Ga0075428_100183484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.2264Open in IMG/M
3300006853|Ga0075420_101471664All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium584Open in IMG/M
3300006854|Ga0075425_102349741All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300006854|Ga0075425_102566982All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300006876|Ga0079217_11422129All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium543Open in IMG/M
3300006903|Ga0075426_10417357All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium991Open in IMG/M
3300006903|Ga0075426_11314866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300006914|Ga0075436_101540166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300006954|Ga0079219_12460988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300007004|Ga0079218_12096348All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium651Open in IMG/M
3300007562|Ga0102915_1279091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium540Open in IMG/M
3300007603|Ga0102921_1081261All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300007992|Ga0105748_10233874All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium769Open in IMG/M
3300009012|Ga0066710_104705172All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300009053|Ga0105095_10292913All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium894Open in IMG/M
3300009056|Ga0102860_1076055All Organisms → cellular organisms → Bacteria → Acidobacteria920Open in IMG/M
3300009094|Ga0111539_12162289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium646Open in IMG/M
3300009094|Ga0111539_13429462All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium509Open in IMG/M
3300009098|Ga0105245_12021251All Organisms → cellular organisms → Bacteria → Proteobacteria630Open in IMG/M
3300009100|Ga0075418_10768877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1040Open in IMG/M
3300009101|Ga0105247_10933337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium673Open in IMG/M
3300009148|Ga0105243_10534943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea basaltis1117Open in IMG/M
3300009162|Ga0075423_10067608All Organisms → cellular organisms → Bacteria3707Open in IMG/M
3300009176|Ga0105242_10461309All Organisms → cellular organisms → Bacteria → Proteobacteria1200Open in IMG/M
3300009176|Ga0105242_11926503All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300009176|Ga0105242_12562198All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300009176|Ga0105242_13124352All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium513Open in IMG/M
3300009177|Ga0105248_10282536All Organisms → cellular organisms → Bacteria → Proteobacteria1869Open in IMG/M
3300009177|Ga0105248_12307104All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300009527|Ga0114942_1284778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium628Open in IMG/M
3300009553|Ga0105249_12866417All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300010047|Ga0126382_11373116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300010166|Ga0126306_10553731Not Available913Open in IMG/M
3300010359|Ga0126376_10724650All Organisms → cellular organisms → Bacteria → Acidobacteria960Open in IMG/M
3300010359|Ga0126376_11346072All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300010360|Ga0126372_10418036All Organisms → cellular organisms → Bacteria → Acidobacteria1230Open in IMG/M
3300010362|Ga0126377_10880573All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300010362|Ga0126377_10916018All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300010397|Ga0134124_11217227All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300010398|Ga0126383_11558691Not Available750Open in IMG/M
3300010398|Ga0126383_11619504Not Available737Open in IMG/M
3300010399|Ga0134127_10480110All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300010400|Ga0134122_10953695All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium836Open in IMG/M
3300010401|Ga0134121_10088878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales2579Open in IMG/M
3300010412|Ga0136852_10470432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300012172|Ga0137320_1083889Not Available678Open in IMG/M
3300012173|Ga0137327_1044866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium964Open in IMG/M
3300012212|Ga0150985_113345116All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300012212|Ga0150985_120195274All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium560Open in IMG/M
3300012285|Ga0137370_10858859All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300012514|Ga0157330_1022994All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300012891|Ga0157305_10294166All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium506Open in IMG/M
3300012893|Ga0157284_10040798All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1017Open in IMG/M
3300012902|Ga0157291_10076014All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300012915|Ga0157302_10355776Not Available589Open in IMG/M
3300012971|Ga0126369_13078724Not Available546Open in IMG/M
3300012985|Ga0164308_11792888All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300012986|Ga0164304_11174835All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300013096|Ga0157307_1021798All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300013296|Ga0157374_11464765All Organisms → cellular organisms → Bacteria → Proteobacteria706Open in IMG/M
3300013297|Ga0157378_11040029All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium854Open in IMG/M
3300013306|Ga0163162_10134845All Organisms → cellular organisms → Bacteria2579Open in IMG/M
3300013306|Ga0163162_12339575All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300014269|Ga0075302_1082974All Organisms → cellular organisms → Bacteria → Proteobacteria697Open in IMG/M
3300014307|Ga0075304_1017246All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300014321|Ga0075353_1152628All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium584Open in IMG/M
3300014325|Ga0163163_10525204Not Available1246Open in IMG/M
3300014325|Ga0163163_11571162All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300014325|Ga0163163_13103300All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium518Open in IMG/M
3300014326|Ga0157380_10247951Not Available1610Open in IMG/M
3300014745|Ga0157377_10699375All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium736Open in IMG/M
3300014881|Ga0180094_1037646All Organisms → cellular organisms → Bacteria → Proteobacteria1003Open in IMG/M
3300014969|Ga0157376_12066576All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium608Open in IMG/M
3300015200|Ga0173480_11210372Not Available511Open in IMG/M
3300015256|Ga0180073_1095274All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300015371|Ga0132258_12659214Not Available1249Open in IMG/M
3300015371|Ga0132258_13794447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1029Open in IMG/M
3300015373|Ga0132257_100473185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.1533Open in IMG/M
3300015373|Ga0132257_101099833All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300015373|Ga0132257_103915642Not Available542Open in IMG/M
3300015374|Ga0132255_100555735All Organisms → cellular organisms → Bacteria1692Open in IMG/M
3300015374|Ga0132255_103271692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300016319|Ga0182033_11446853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium619Open in IMG/M
3300016387|Ga0182040_11979575All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium500Open in IMG/M
3300016422|Ga0182039_11402271Not Available635Open in IMG/M
3300016445|Ga0182038_10121144All Organisms → cellular organisms → Bacteria1943Open in IMG/M
3300016445|Ga0182038_11900469All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300016737|Ga0182047_1474041All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium893Open in IMG/M
3300017792|Ga0163161_10047057All Organisms → cellular organisms → Bacteria3114Open in IMG/M
3300017792|Ga0163161_11771855All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300017927|Ga0187824_10374058All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300017936|Ga0187821_10369387All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300017955|Ga0187817_10127208All Organisms → cellular organisms → Bacteria1613Open in IMG/M
3300017965|Ga0190266_10088346Not Available1236Open in IMG/M
3300017965|Ga0190266_11072756All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300017966|Ga0187776_10480735Not Available846Open in IMG/M
3300017969|Ga0181585_10089734Not Available2324Open in IMG/M
3300018036|Ga0181600_10155200All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300018055|Ga0184616_10064189Not Available1255Open in IMG/M
3300018073|Ga0184624_10127277Not Available1107Open in IMG/M
3300018416|Ga0181553_10017892All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5345Open in IMG/M
3300018423|Ga0181593_10024282All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5239Open in IMG/M
3300018432|Ga0190275_12752708All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium568Open in IMG/M
3300018469|Ga0190270_10083065All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300018476|Ga0190274_12359973All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium629Open in IMG/M
3300018476|Ga0190274_12897597All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium575Open in IMG/M
3300018476|Ga0190274_13816280All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium510Open in IMG/M
3300018481|Ga0190271_11232310All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Chlorobium → Chlorobium limicola → Chlorobium limicola DSM 245870Open in IMG/M
3300018481|Ga0190271_13399615All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300019262|Ga0182066_1662979All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300019361|Ga0173482_10520596All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300019362|Ga0173479_10190744All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300020052|Ga0181554_1256185All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria679Open in IMG/M
3300020184|Ga0181573_10006971All Organisms → cellular organisms → Bacteria9061Open in IMG/M
3300020583|Ga0210401_10195372All Organisms → cellular organisms → Bacteria → Acidobacteria1881Open in IMG/M
3300021178|Ga0210408_11249784All Organisms → cellular organisms → Bacteria → Proteobacteria565Open in IMG/M
3300021181|Ga0210388_10082947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium2722Open in IMG/M
3300021384|Ga0213876_10178090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1131Open in IMG/M
3300021404|Ga0210389_10589443Not Available874Open in IMG/M
3300021404|Ga0210389_10721981All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300021406|Ga0210386_11444980Not Available575Open in IMG/M
3300021433|Ga0210391_10680295Not Available807Open in IMG/M
3300021477|Ga0210398_10161473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae1824Open in IMG/M
3300022756|Ga0222622_10697542All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300022906|Ga0247766_1025432All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300022917|Ga0247777_1287356All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300022934|Ga0255781_10187499All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1029Open in IMG/M
3300023102|Ga0247754_1178296All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium533Open in IMG/M
3300024550|Ga0255266_1114180Not Available622Open in IMG/M
3300024557|Ga0255283_1086798All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium673Open in IMG/M
3300025165|Ga0209108_10563026Not Available538Open in IMG/M
3300025861|Ga0209605_1259611All Organisms → cellular organisms → Archaea → Euryarchaeota630Open in IMG/M
3300025900|Ga0207710_10483435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium641Open in IMG/M
3300025901|Ga0207688_10446874Not Available805Open in IMG/M
3300025903|Ga0207680_10573933Not Available806Open in IMG/M
3300025903|Ga0207680_11008192All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300025903|Ga0207680_11378825Not Available500Open in IMG/M
3300025907|Ga0207645_10462023Not Available857Open in IMG/M
3300025909|Ga0207705_10820311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium722Open in IMG/M
3300025911|Ga0207654_10209532All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300025911|Ga0207654_11181620All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300025917|Ga0207660_10555935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium933Open in IMG/M
3300025918|Ga0207662_11206458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium538Open in IMG/M
3300025918|Ga0207662_11327489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300025920|Ga0207649_11449066All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300025923|Ga0207681_10265919All Organisms → cellular organisms → Bacteria → Acidobacteria1344Open in IMG/M
3300025923|Ga0207681_10801192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia787Open in IMG/M
3300025925|Ga0207650_10309293All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1292Open in IMG/M
3300025927|Ga0207687_10160867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1723Open in IMG/M
3300025927|Ga0207687_11182492Not Available657Open in IMG/M
3300025928|Ga0207700_11689787Not Available558Open in IMG/M
3300025929|Ga0207664_10930869Not Available780Open in IMG/M
3300025931|Ga0207644_10198199All Organisms → cellular organisms → Bacteria1583Open in IMG/M
3300025933|Ga0207706_10194757All Organisms → cellular organisms → Bacteria1778Open in IMG/M
3300025936|Ga0207670_10019006All Organisms → cellular organisms → Bacteria4188Open in IMG/M
3300025936|Ga0207670_10353482All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300025937|Ga0207669_11918094All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium506Open in IMG/M
3300025938|Ga0207704_11211064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300025940|Ga0207691_10073593All Organisms → cellular organisms → Bacteria3082Open in IMG/M
3300025940|Ga0207691_11391875All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium577Open in IMG/M
3300025945|Ga0207679_10299275All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300025960|Ga0207651_10436009All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300025960|Ga0207651_10459289Not Available1094Open in IMG/M
3300025960|Ga0207651_11134078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300025972|Ga0207668_10666747Not Available912Open in IMG/M
3300025986|Ga0207658_11839501All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium552Open in IMG/M
3300026023|Ga0207677_11277769All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300026035|Ga0207703_10324080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1412Open in IMG/M
3300026041|Ga0207639_10601993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1014Open in IMG/M
3300026067|Ga0207678_10017038All Organisms → cellular organisms → Bacteria → Proteobacteria6380Open in IMG/M
3300026075|Ga0207708_10208837All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1560Open in IMG/M
3300026075|Ga0207708_11454306All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium602Open in IMG/M
3300026078|Ga0207702_10258971All Organisms → cellular organisms → Bacteria → Proteobacteria1637Open in IMG/M
3300026078|Ga0207702_12493940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium504Open in IMG/M
3300026088|Ga0207641_12157527All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae558Open in IMG/M
3300026088|Ga0207641_12298476All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium539Open in IMG/M
3300026089|Ga0207648_11365705All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium666Open in IMG/M
3300026089|Ga0207648_11814111All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300026095|Ga0207676_11934544Not Available588Open in IMG/M
3300026118|Ga0207675_100194380All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300027395|Ga0209996_1059779All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium584Open in IMG/M
3300027787|Ga0209074_10178809All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium783Open in IMG/M
3300027869|Ga0209579_10249561All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300027874|Ga0209465_10526998All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium589Open in IMG/M
3300027880|Ga0209481_10010819All Organisms → cellular organisms → Bacteria3929Open in IMG/M
3300027880|Ga0209481_10193631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1014Open in IMG/M
3300027884|Ga0209275_10324071All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300027884|Ga0209275_10794669Not Available546Open in IMG/M
3300027895|Ga0209624_10246640Not Available1187Open in IMG/M
3300027905|Ga0209415_10901823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium601Open in IMG/M
3300027907|Ga0207428_10293518All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1204Open in IMG/M
3300028380|Ga0268265_10766158Not Available938Open in IMG/M
3300028380|Ga0268265_11039213All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium811Open in IMG/M
3300028381|Ga0268264_11392863Not Available712Open in IMG/M
3300028803|Ga0307281_10294743Not Available604Open in IMG/M
3300028906|Ga0308309_10284585All Organisms → cellular organisms → Bacteria → Acidobacteria1394Open in IMG/M
3300030058|Ga0302179_10034402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2346Open in IMG/M
3300030399|Ga0311353_11120932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300030618|Ga0311354_11796571All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis533Open in IMG/M
3300031226|Ga0307497_10637129Not Available543Open in IMG/M
3300031231|Ga0170824_117596912All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300031238|Ga0265332_10171957All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300031455|Ga0307505_10311854Not Available739Open in IMG/M
3300031538|Ga0310888_10356077All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300031538|Ga0310888_10533301All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium706Open in IMG/M
3300031546|Ga0318538_10277290All Organisms → cellular organisms → Bacteria → Acidobacteria902Open in IMG/M
3300031681|Ga0318572_10906079Not Available524Open in IMG/M
3300031708|Ga0310686_102816641All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300031708|Ga0310686_116108265All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium816Open in IMG/M
3300031740|Ga0307468_102234779All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300031847|Ga0310907_10425638All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. KM1697Open in IMG/M
3300031847|Ga0310907_10702034All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300031854|Ga0310904_11402453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300031858|Ga0310892_10047476Not Available2108Open in IMG/M
3300031858|Ga0310892_10222047All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300031879|Ga0306919_11384104All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300031892|Ga0310893_10578723All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031908|Ga0310900_10693943All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium814Open in IMG/M
3300031908|Ga0310900_10889543Not Available726Open in IMG/M
3300031938|Ga0308175_101563390All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300031943|Ga0310885_10726575All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium560Open in IMG/M
3300031947|Ga0310909_10854965Not Available749Open in IMG/M
3300031996|Ga0308176_11875884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300032000|Ga0310903_10639743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300032000|Ga0310903_10774374All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300032005|Ga0307411_11554751All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium609Open in IMG/M
3300032012|Ga0310902_10487955All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium801Open in IMG/M
3300032075|Ga0310890_11722934All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300032179|Ga0310889_10079089Not Available1355Open in IMG/M
3300032179|Ga0310889_10586640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300032211|Ga0310896_10304283All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300032515|Ga0348332_10433525All Organisms → cellular organisms → Bacteria3801Open in IMG/M
3300032892|Ga0335081_10752749All Organisms → cellular organisms → Bacteria → Acidobacteria1172Open in IMG/M
3300032898|Ga0335072_10490337All Organisms → cellular organisms → Bacteria → Acidobacteria1278Open in IMG/M
3300032955|Ga0335076_10852511Not Available793Open in IMG/M
3300033412|Ga0310810_10244439All Organisms → cellular organisms → Bacteria1980Open in IMG/M
3300033417|Ga0214471_10232505All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1510Open in IMG/M
3300033432|Ga0326729_1070213Not Available534Open in IMG/M
3300033486|Ga0316624_10560769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium987Open in IMG/M
3300033500|Ga0326730_1014244All Organisms → cellular organisms → Bacteria → Proteobacteria1711Open in IMG/M
3300034090|Ga0326723_0456998All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300034116|Ga0335068_0547044All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium529Open in IMG/M
3300034151|Ga0364935_0039548Not Available1349Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.25%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.27%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.62%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.62%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.62%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.30%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.30%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.30%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.65%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.65%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.65%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.65%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.32%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.32%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.32%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.32%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.32%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.32%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.32%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.32%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.32%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.32%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.32%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.32%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.32%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.32%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.32%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.32%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.32%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.32%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.32%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.32%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.32%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.32%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.32%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.97%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.97%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.97%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.97%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.97%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2035918006Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2+EnvironmentalOpen in IMG/M
2124908009Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2EnvironmentalOpen in IMG/M
2170459012Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grassEnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001849Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2bEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003991Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007562Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02EnvironmentalOpen in IMG/M
3300007603Estuarine microbial communities from the Columbia River estuary - metaG 1568-02EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300012172Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020052Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020184Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101409BT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300022917Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5EnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300024550Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024557Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025861Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027395Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033432Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fractionEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACEMDE_13339202035918006SoilDLVAVMSTYAVSGFYAIAVDEHMPAGQPTLERTAK
FWIRA_037167802124908009SoilELWGKRGTMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK
N56_010108202170459012Grass SoilMDMVAVMNTYAVSGYFAIAVDERSPEGKPQLPAVK
2ZMR_006172502170459016Switchgrass, Maize And Mischanthus LitterMDMVAAMTTYAVSGYFAIAVDEHAAEGKPELPAVK
ICChiseqgaiiDRAFT_039666013300000033SoilMLHDNKMDSQTFAKAAQLFGRRGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRP*
ICChiseqgaiiDRAFT_054628923300000033SoilRMSSDTFAKAAQLYGKKGALDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPK*
F14TC_10061591113300000559SoilVVELFGQRGAMDIVAVMNTYAVSGFYAIAVDEHPPSGKPSLPSK*
JGI10215J12807_129095533300000881SoilGRRGAMDVVAVMSTYAVSGLFAIAVDEHMPPGRADLEPAAR*
JGI10216J12902_12248754213300000956SoilISIPRISATFAKAVEQLGQRGAMDLVAVMNTHAVSGFYAIAVDEHAPANRPSLEPLK*
RCM26_119029413300001849Marine PlanktonTFKKAVHFWGKRGVMDMVAVMNTYAVSGYFAIAVDEQAAAGKTPLPAVK*
soilL1_1003415313300003267Sugarcane Root And Bulk SoilLFGEKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARK*
soilL2_1007191413300003319Sugarcane Root And Bulk SoilTDKKVDSATFAKLSEIYGKKGAMDVVAVMITYADSGFYGIAVNEQPAAGKQPL*
Ga0055461_1019342123300003991Natural And Restored WetlandsAVIRFGRELLRDRKMSSATFAKAKEPYGAHGAMDLVAVMSTYAVSGFFAIAVDEHVEPRMPR*
Ga0055432_1002944223300004022Natural And Restored WetlandsFHDKEVESATFAKAVELWGKRGTMDMVAVMNTYAVSGHFAIAVHELSPEHAQR*
Ga0055436_1028792123300004024Natural And Restored WetlandsATFAKVVELFGQRGAMDLVAVMNTYAVSGFYAIAVDEQPAAGKTALEPLK*
Ga0055498_1011007433300004058Natural And Restored WetlandsAKAKELYGAKGAMDLVAVMSTYAVSGFYAIAVDEHPAPGAKTLPK*
Ga0062593_10045538223300004114SoilKVDSATFAKVAQLLGRRGAMDLVAVMNTYAVSGFYALAVDEHMPPGRADLR*
Ga0062590_10301269323300004157SoilFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESVPRQ*
Ga0062595_10002447933300004479SoilAKATQLFGRRGAMDMVAVMSTYAVSGFFAIAADEHMPPGRPDFESVSR*
Ga0062591_10001770133300004643SoilAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPARQ*
Ga0062591_10109615923300004643SoilRFGRQMLSDKKMDAATFARVAQLFGQRGAMDMVAVMNTYAVSGFYAIAVDEHMPPGRPDLR*
Ga0070670_10222517723300005331Switchgrass RhizosphereAKAKELYGDHGAMDLVAVMSTYAVSGFYAIAVDQHMPAGQPMLPPAH*
Ga0066388_10205858623300005332Tropical Forest SoilDSATFAKAVQFFGQRGVMDLVAVMNTYAVSGFYAIAVDEQPAAGGRALPKSK*
Ga0070677_1011900733300005333Miscanthus RhizosphereKVVELFGRKGAMDMVAVMNTYAVSGFYAIAVDERPPAGRPDLLAAPVR*
Ga0070666_1012510453300005335Switchgrass RhizosphereLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ*
Ga0070680_10007283443300005336Corn RhizosphereLNDRKMSSATFAKAKQLYGAKGAMDLVAVMSTYAVSGFYAIAVDEHAASGQPTLPK*
Ga0070680_10087752113300005336Corn RhizosphereFGRRGAMDMVAVMNTYAVSGFYAIAVDEHPAAGQPTLPPVAAH*
Ga0070682_10108787623300005337Corn RhizosphereTFAKVVELYGQRGAMDVVAVMNTYAVSGFYAIAVDEHPQAGKPALERTK*
Ga0070689_10020371013300005340Switchgrass RhizosphereVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK*
Ga0070689_10081629523300005340Switchgrass RhizosphereLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPAR*
Ga0070688_10058985213300005365Switchgrass RhizosphereVDSAVFAKAVELWGKRGTMDMVGVMNTYAVSGYFAIAVDERSPEGRPELPVIK*
Ga0070678_10095120913300005456Miscanthus RhizosphereKAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ*
Ga0070679_10197113723300005530Corn RhizosphereAKQLYGAKGAMDLVAVMSTYAVSGFYAIAVDEHAASGQPTLPK*
Ga0070684_10067879723300005535Corn RhizosphereDSATYAKVVELYGKKGAMDIVAVMITYADSGFYGIAVNEQPAPGKSPL*
Ga0070731_1010261743300005538Surface SoilMIDMVAAMNTYAVSGYFAIAVDEHSPEGKPELPPMK*
Ga0070731_1022960823300005538Surface SoilKAVELWGKRGTMDLVAVMNTYAVSGFFAIAVDEHTPEGKSELPAVK*
Ga0070686_10041406623300005544Switchgrass RhizosphereATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKPELPAVK*
Ga0070686_10149561823300005544Switchgrass RhizosphereATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKAALPAVK*
Ga0070686_10170280713300005544Switchgrass RhizosphereATFAKAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ*
Ga0070693_10118862913300005547Corn, Switchgrass And Miscanthus RhizosphereTFAKIVEVYGRRGAMDMVAVMNTYAVSGFYAIAVDEQPAPGKSPL*
Ga0070665_10207854513300005548Switchgrass RhizosphereMDMVAVMNTYAISGYFAIAVDERSPEGKPELPAVK*
Ga0070664_10088060913300005564Corn RhizosphereSQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ*
Ga0068854_10142334813300005578Corn RhizosphereQLYGAKGAMDLVAVMSTYAVSGFYAIAVDEHAAPGQPTLPK*
Ga0068856_10107003913300005614Corn RhizosphereWGKRGAMDMVAVMNTYAVSGYFAIAVDEHSPEGKPELPAIK*
Ga0068859_10274856213300005617Switchgrass RhizosphereYTDRKVDSATFAKIVELYGQRGAMDMVAVMNTYAVSGFYGIAVDEHAQAGKTSLRK*
Ga0068866_1023955513300005718Miscanthus RhizosphereQLFHDNKMDAATFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP*
Ga0068861_10087345923300005719Switchgrass RhizosphereATFAKAVELFGRRGAMDLVAVMNTYAASGFYAIAVNEQAAAGKPPL*
Ga0066903_10672399313300005764Tropical Forest SoilKAVQLFGQRGVMDMVAVMNTYAVSGFYAIAVDEHAPAGKTALEPIKQK*
Ga0066903_10775092123300005764Tropical Forest SoilFHDKKVDSATFGKAVELWGKRGTMDVVAVMNTYAVSGYFAIAVNERAPEGKVDLSAIK*
Ga0074470_1064077533300005836Sediment (Intertidal)RGAMDMVSAMSTYAVSGFFAIAVDEQPAAGAAALPK*
Ga0068870_1014502413300005840Miscanthus RhizosphereRQMFRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH*
Ga0068870_1104781613300005840Miscanthus RhizosphereHGAMDLVAVMSTYAVSGFYAIAVDQHMPAGQPMLPPAH*
Ga0068863_10171927213300005841Switchgrass RhizosphereVELFGRRGAMDMVAVMSTYAVSGFFAIAVDERMPAGRPELVRVPQ*
Ga0068858_10098540213300005842Switchgrass RhizosphereKAVELFGRRGTMDMVAVMNTYAVSGFFAIAVDEHMPAGRPDLK*
Ga0068862_10007620813300005844Switchgrass RhizosphereKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERGARP*
Ga0068862_10233324533300005844Switchgrass RhizosphereMDLVAVMSTYAVSGFYATAVDERMPSGRPDLERTPR*
Ga0075029_10113126913300006052WatershedsDMVAVMSTYAVSGYFVIAVDERSPEGKPELPTVK*
Ga0070715_1057853743300006163Corn, Switchgrass And Miscanthus RhizosphereAKIVELFGKRGAMDMVAVMNTYAVSGFYAIAVDEQAAPGKPSF*
Ga0070765_10115703623300006176SoilELWGKRGAMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK*
Ga0075422_1006528943300006196Populus RhizosphereKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQKTLPPVAAH*
Ga0097621_10011626743300006237Miscanthus RhizosphereATFAKAVQLFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH*
Ga0068871_10005393213300006358Miscanthus RhizosphereAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGKPVLPAVK*
Ga0068871_10068047913300006358Miscanthus RhizosphereMDMVAVMNTYAVSGFFGIAVNEQAAVGKTSLEKK*
Ga0074050_1147399413300006577SoilELFGRRGAMDMVAVMNTYAVSGFFAIAVDEHMPAGQPDLKPDLK*
Ga0079222_1151775723300006755Agricultural SoilTFAKAVALWGKRATMDMVAVMNTYAVSGFFAIAVDEHPAEGKPALPAVK*
Ga0075428_10018348413300006844Populus RhizosphereFAKAVELLTQRGVMDMVAVMNTYAVSGFYAIAVDEQPPVNKAGLERLNR*
Ga0075420_10147166423300006853Populus RhizosphereVGRRGAMDMVAVMNTYAVSGFYAVAVDEHMAPGRPDLQPLR*
Ga0075425_10234974123300006854Populus RhizosphereFAKAVEVLGKRGVMDMVAVMNTYAVSGFYAIAVDEHMPPGRPELTRAAR*
Ga0075425_10256698213300006854Populus RhizosphereQLFGQRGAMDLVAVMNTYAVSGFYAIAVDEQPAPGRPALERNK*
Ga0079217_1142212923300006876Agricultural SoilGRKGAMDMVAVMNTYAVSGFYAIAVDERAPEGRLDLLSSPVH*
Ga0075426_1041735713300006903Populus RhizosphereLYGAKGTMDLVAVMSTYAVSGFYAIAVDEHAPAGKPSLPSLK*
Ga0075426_1131486623300006903Populus RhizosphereSATFAKAVELFGQRGTMDLVAVMNTYAVSGFYAIAVDEHPPAGKPALERTK*
Ga0075436_10154016623300006914Populus RhizosphereLYTDRKVDSATFAKAVELLTQRGVMDMVAVMNTYAVSGFYAIAVDEQPPVNKAGLERLNR
Ga0079219_1246098813300006954Agricultural SoilKAVELLNQRGVMDMVAVMNTYAVSGFYAIAVDEHPPAGKTALETLK*
Ga0079218_1209634823300007004Agricultural SoilAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ*
Ga0102915_127909113300007562EstuarineKGAMDLVAVMSTYAVSGFYAIAVDEHVPADKPQLPR*
Ga0102921_108126113300007603EstuarineMSSATFAKAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHVPADKPQLPR*
Ga0105748_1023387413300007992Estuary WaterRELLRDSKMSSATFAKGAMDLVAVMSTYAVSGFYAIAVDEHVPADQPQLPR*
Ga0066710_10470517213300009012Grasslands SoilRRGAMDLVAVMNTYAASGFYAIAVNEQPAAGKPPL
Ga0105095_1029291313300009053Freshwater SedimentGKRGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRPDLQPLKR*
Ga0102860_107605513300009056EstuarineKMSSATFAKAKELFGDKGAMDLVAVMSTYAVSGFYAIAVDEHVPADQPQLPR*
Ga0111539_1216228923300009094Populus RhizosphereVELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPEGRLDLLSAPVH*
Ga0111539_1342946223300009094Populus RhizosphereVELLGQRGAMDLVAVMNTYAVSGFYAIAVDEQPAPGRTALERLK*
Ga0105245_1202125123300009098Miscanthus RhizosphereDKKVDAATFAKAVQLWGKRGAMDMVAVMNTYAVSGFFAIAVDEHSGEGKPELPVAK*
Ga0075418_1076887723300009100Populus RhizosphereVELLTQRGVMDMVAVMNTYAVSGFYAIAVDEQPPVNKAGLERLNR*
Ga0105247_1093333713300009101Switchgrass RhizosphereTFAKAVELWGKRGTMDMVAAMNTYAVSGFFAIAVDEHSAQGKPELPPVK*
Ga0105243_1053494323300009148Miscanthus RhizosphereHDNRMESETFAKAAQLFGKKGAMDLVAVMSTYAVSGFYATAVDERMPSGRPDLERTPR*
Ga0075423_1006760853300009162Populus RhizosphereGDKGAMDLVAVMSTYAVSGFYAIAVDEHMPAGRPTLPR*
Ga0105242_1046130913300009176Miscanthus RhizosphereLNDKKVDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKAALPAVK*
Ga0105242_1192650323300009176Miscanthus RhizosphereLWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK*
Ga0105242_1256219813300009176Miscanthus RhizosphereELFGQRGTIDLVAVMNTYAVSGFFAIAVDEHAPAGKPSF*
Ga0105242_1312435213300009176Miscanthus RhizosphereMDSGTFAKAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ*
Ga0105248_1028253633300009177Switchgrass RhizosphereDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKAALPAVK*
Ga0105248_1230710423300009177Switchgrass RhizosphereATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHSAEGKPQLPATK*
Ga0114942_128477823300009527GroundwaterEMSSATFAKSVELFGERGAMDLVAVMMTYAVSGYYAIAVDEHPPGQTLLAPLP*
Ga0105249_1286641713300009553Switchgrass RhizosphereFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAAK*
Ga0126382_1137311623300010047Tropical Forest SoilVQFFGQRGVMDLVAVMNTYAVSGFYAIAVDEQPAAGQTGLQGTK*
Ga0126306_1055373113300010166Serpentine SoilTFAKVVELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPDGRLDLLSSPVH*
Ga0126376_1072465013300010359Tropical Forest SoilLLNDKKVDSAAFAKIVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHSAEGKPELPAVK*
Ga0126376_1134607213300010359Tropical Forest SoilQRGAMDILAIMNTYAVSGFYAIAVDEQPPAGKPPLGRAR*
Ga0126372_1041803623300010360Tropical Forest SoilTFAKIVELFGKRGAMDMVAVMNTYAVSGFFGIAVDEQAAPGKPSF*
Ga0126377_1088057333300010362Tropical Forest SoilDSATFAKAVQFFGQRGVTDLVAVMNTYAVSGFYAIAVDEQPAAGGRALPKSK*
Ga0126377_1091601813300010362Tropical Forest SoilTFAKASQLFGRRGAMDMVAVMSTYAVSGFFAIAVDEHMPPGRLDLESVTR*
Ga0134124_1121722713300010397Terrestrial SoilAMDLVAVMSTYAVSGFYATAVDEHMPAGRVDLDRPSRTQ*
Ga0126383_1155869123300010398Tropical Forest SoilGQRGVMDMVAVMNTYAVSGFYAIAVDEQPAPGKPALERSK*
Ga0126383_1161950413300010398Tropical Forest SoilATFAKIVELYGKRGAMDMVAVMNTYAASGFFAIAVDEQPAPGKSPL*
Ga0134127_1048011013300010399Terrestrial SoilKMDSATFARAVELFGRRGAMDLVAVMTTYAASGFYAIAVNEQAAPGKPPL*
Ga0134122_1095369513300010400Terrestrial SoilVAKLYGNKGAMDVVAVMSTYAVSGFYAIAVDEHAPAGKTSLTK*
Ga0134121_1008887813300010401Terrestrial SoilKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHPAEGKPALPAVK*
Ga0136852_1047043213300010412Mangrove SedimentRSMRSGTFADAVRHFGEHGAMDLVAVMSTYAVSGFYAIAVNEHPPGEEILAPLAR*
Ga0137320_108388923300012172SoilVELFGQHGAMDLVAVMSTYAVSGFYAIAVDEHMPAGQPTLH*
Ga0137327_104486613300012173SoilTFAKAVELFGQRGTMDLVAVMNTYAVSGFYAIVVDEHPPAGKPALSQSK*
Ga0150985_11334511613300012212Avena Fatua RhizosphereVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGRPELPAVK*
Ga0150985_12019527423300012212Avena Fatua RhizosphereYAKVVEAFGKRGAMDLVAVMITYADSGFYGIAVDEQPAQGKQPL*
Ga0137370_1085885913300012285Vadose Zone SoilMVAVMNTYAVSGFFAIAVDEHMPAGRPEFERVPR*
Ga0157330_102299423300012514SoilAVMSTYAVSGFYATAVDEHMPAGRVDLDRPSRSQ*
Ga0157305_1029416613300012891SoilQMFRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDEHAPAGKPSF*
Ga0157284_1004079823300012893SoilGAMDIVAVMNTYAVSGFYAIAVDEQPAAGKPTLRSK*
Ga0157291_1007601413300012902SoilKMDSATFAKVKEFWGARGAMDMVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR*
Ga0157302_1035577623300012915SoilATFAKAKELYGDHGAMDLVAVMSTYAVSGFYAIAVDEHMPAGQPMLPPAH*
Ga0126369_1307872413300012971Tropical Forest SoilGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPTLKK*
Ga0164308_1179288823300012985SoilSATFAKAVELWGKRGTMDMVAAMSTYAVSGFFAIAVDEHPAEGKPALPAVK*
Ga0164304_1117483513300012986SoilMDMVAVMNTYAISGYFAIAVDEHPAEGKPALPAVK*
Ga0157307_102179813300013096SoilAQAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ*
Ga0157374_1146476513300013296Miscanthus RhizosphereKRGTMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK*
Ga0157378_1104002913300013297Miscanthus RhizosphereSATFAKAVQLLGQRGVMDMVAVMNTYAVSGFFGIAVDEHAAAGKPQF*
Ga0163162_1013484513300013306Switchgrass RhizosphereNDKKVDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK*
Ga0163162_1233957513300013306Switchgrass RhizosphereKIVELYGQRGAMDMVAVMNTYAVSGFFGIAVNEQAAVGKTSLEKK*
Ga0075302_108297423300014269Natural And Restored WetlandsRKMSSATFAKAKELYGDHGAMDLVAVMGTYAVSGFFAIAVDEHAPPGKPSF*
Ga0075304_101724613300014307Natural And Restored WetlandsHFGEHGAMDLVAVMSTYAVSGFYAIAVDEHPPGAELLEPIAH*
Ga0075353_115262813300014321Natural And Restored WetlandsKGALDVVAVMSTYAVSGFYAIAVDEHAPAGKSSLPSLSK*
Ga0163163_1052520413300014325Switchgrass RhizosphereTFGKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERGARP*
Ga0163163_1157116213300014325Switchgrass RhizosphereTFAKAVELFGRRGTMDMVAVMNTYAVSGLFAIAVDEHMPAGRPDLK*
Ga0163163_1310330023300014325Switchgrass RhizosphereREMFRDKKMAPATFAKAVGLFGRKGTMDMVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR*
Ga0157380_1024795113300014326Switchgrass RhizosphereTFAKAKQLFGDKGAMDLVAVMSTYAVRGFYAIAVDEHPAAGQPTLPTVAAH*
Ga0157377_1069937523300014745Miscanthus RhizosphereMDIVAVMNTYAVSGFYAIAVDEQPQAGKPTLRSK*
Ga0180094_103764613300014881SoilMDLVAVMMTYAVSGFYAIAVDEHPPGQTLLEPLP*
Ga0157376_1206657613300014969Miscanthus RhizosphereTFAKVVEAFGRNGAMNVVAVMNTYAVSGFYAIAVDERAAAGKLDLASK*
Ga0173480_1121037213300015200SoilTFAKAKELYGDHGAMDLVAVMSTYAVSGFYAIAVDQHMPAGQPMLPPAH*
Ga0180073_109527413300015256SoilFGRELLDDRTMNSATFAKAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHMPAGRPDL*
Ga0132258_1265921413300015371Arabidopsis RhizosphereRELIGDRKMSSATFAKAVHLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPALKK*
Ga0132258_1379444713300015371Arabidopsis RhizosphereKMVQLFGQRGAMNVVAVMNTYAVSGFYALAVDEHMPPGRPDLR*
Ga0132257_10047318533300015373Arabidopsis RhizosphereKLDSATFAKAVELLTQRSVMDMVAVMNTYAVSGFYAIAVDEQPPANKAGLERLNR*
Ga0132257_10109983323300015373Arabidopsis RhizosphereFGRRGAMDMVAVMNTYAVSGFFAIAVDEHMPPGRADLH*
Ga0132257_10391564213300015373Arabidopsis RhizosphereMDSATFAKVVELFGRRGAMDMVAVMNTYAVSGFFAIAVDEHSAPGRAEF*
Ga0132255_10055573513300015374Arabidopsis RhizosphereKKVDSATFAKVVELYGQRGAMDIVAVMNTYAVSGFYGIAVDEQAAAGKTPLEPLKK*
Ga0132255_10327169223300015374Arabidopsis RhizosphereMYSDRKIDSATFAKAVEQLGQRGVMDLVTVMDTYAVSGFYAIAVDERAPA
Ga0182033_1144685323300016319SoilPTFAKAVELFGQRGVMDIVAVMNTYAVSGFYAIAVDEHPAAGKPALERLK
Ga0182040_1197957513300016387SoilAVEFFGQRGVMDMVALMNTYAVSGFYAIAVDEHPPAGRPALERTK
Ga0182039_1140227113300016422SoilMDIVAVMNTYAVSGFYGIAVDEQAAAGKTPLERLK
Ga0182038_1012114423300016445SoilMDMVAVMNTYAVSGYFAIAVDERSPEGRPELPAAK
Ga0182038_1190046913300016445SoilRQLFTDKKVDRATFAKIVDFYGKRGAMDLVAVMNTYAVSGFYAIAVDEQAGAGKPAL
Ga0182047_147404123300016737Salt MarshFANVQELFGDAGAMDLVAIMVTYIASGYYAIAVDEHMANGQNLE
Ga0163161_1004705743300017792Switchgrass RhizosphereRGAMDMVAVMNTYAVSGFFGIAVNEQAAVGKTSLEKK
Ga0163161_1177185523300017792Switchgrass RhizosphereSAAFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPARP
Ga0187824_1037405813300017927Freshwater SedimentKKVDSTTFAKIAELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHSAEGKPELPAVK
Ga0187821_1036938713300017936Freshwater SedimentWGKRGAMDMVAAMSTYAVSGFFAIAVDEHAAEGKPELPAVK
Ga0187817_1012720813300017955Freshwater SedimentGKRGAMDMVAAMNTYAVSGFFAIAVDEHAAEGKPELPPVK
Ga0190266_1008834623300017965SoilMSSSKFKKAKQLLGDKGAMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPPVAPH
Ga0190266_1107275623300017965SoilTFAKAVEAFGRRGAMDLVAVMTTYAASGFYAIAVDEHMPPGRPDLTPVN
Ga0187776_1048073523300017966Tropical PeatlandAMDLVAVMSTYAVSGFYAIAVDEHMPAGKPTLPPLAK
Ga0181585_1008973413300017969Salt MarshKDRKVDSATFANVQELFGDAGAMDLVAIMVTYIASGFYAIAVDEHMANGQNLE
Ga0181600_1015520013300018036Salt MarshRKVDSATFANVQELFGDDGAMDLVAIMVTYIASGYYAIAVDEHMANGQNLE
Ga0184616_1006418913300018055Groundwater SedimentAVEAFGRRGAMDLVAVMTTYAASGFYAIAVDEHMPPGRPDLTPVN
Ga0184624_1012727723300018073Groundwater SedimentGAMDLVAVMSTYAVSGFYAIAVDEHMPAGQPMLPPAH
Ga0181553_1001789213300018416Salt MarshAVDSVTFAKAVDYFGKKGVMDIVAVMNTYAVSGFFAATVDERVPADEIDLK
Ga0181593_1002428213300018423Salt MarshKKGVMDIVAVMNTYAVSGFFAATVDERVPADEIDLK
Ga0190275_1275270813300018432SoilKMSSATFAKAKELCGAKGTMDLVAVMSTYAVSGFYAIAVDEHMAPGQPMLPAMAAH
Ga0190270_1008306513300018469SoilGTMDLVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVH
Ga0190274_1235997323300018476SoilFRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH
Ga0190274_1289759713300018476SoilVELFGKKGAMDMVAVMVTYAASGFYAIAVDEHMPAGRPDLIPVN
Ga0190274_1381628013300018476SoilTFAKAVQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ
Ga0190271_1123231013300018481SoilLFGRKGAMDMVAVMNTYAVSGFYAIAVDERPPAGRLDLLAAPVR
Ga0190271_1339961513300018481SoilGAMDMVAVMNTYAVSGFYAIAVDERPPAGRPDLLAAPVR
Ga0182066_166297913300019262Salt MarshLFGDAGAMDLVAIMVTYIASGFYAIAVDEHMANGQNLE
Ga0173482_1052059623300019361SoilGRKGTMDLVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR
Ga0173479_1019074413300019362SoilTFAKAAQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ
Ga0181554_125618523300020052Salt MarshVDSVTFAKAVDYFGKKGVMDIVAVMNTYAVSGFFAATVDERVPADEIDLK
Ga0181573_10006971103300020184Salt MarshVDSATFANVQELFGDAGAMDLVAIMVTYIASGYYAIAVDEHMANGQNLE
Ga0210401_1019537223300020583SoilTTFAKAVELWGKRGAMDMVAVMSTYAVSGYFAIAVDERSPEGKPELPPLK
Ga0210408_1124978413300021178SoilATFAKAVELWGKRGTMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK
Ga0210388_1008294713300021181SoilMDMVAAMSTYAVSGFFAIAVDERSPEGKPELPPLK
Ga0213876_1017809013300021384Plant RootsFAKVQEIYGKKGAMDIVAVMITYADSGFYGIAVNEQPAAGKKPL
Ga0210389_1058944313300021404SoilAVDMVSVMTTYAVSGYFAIAVDERSPEGKPELPAVK
Ga0210389_1072198113300021404SoilDSATFSKAVEFWSKRGAMDMVSVMTTYAVSGYFAIAVDERSPEGKPELPPIK
Ga0210386_1144498013300021406SoilTFAKAVELWGKRGAMDMVAVMSTYAVSGYFAIAVDERSPEGKPELPAIK
Ga0210391_1068029513300021433SoilKAVDLWGKRGTMDMVAVMNTYAVSGYFAIAVNEQSPEGKPELPGVK
Ga0210398_1016147343300021477SoilATFAKSVDPWGKRGTMDMVAAMNTYAVSGYFAIAVDEHSPEGKPELPPTK
Ga0222622_1069754223300022756Groundwater SedimentKELYGDHGAMDLVAVMSTYAVSGFYAIAVDQHMPAGQPMLPPAH
Ga0247766_102543233300022906Plant LitterTFAKAVELFGRKGTMDLVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR
Ga0247777_128735623300022917Plant LitterEKGTMDLVAVMSTYAVSGFYAIAVDEHAPAGKPSF
Ga0255781_1018749923300022934Salt MarshGKAVDYFGKKGVMDIVAVMNTYAVSGFFAATVDERVPADEIDLK
Ga0247754_117829613300023102SoilATFAKAVELFGRKGTMDLVAVMNTYAVSGFYAIAVDERAPAGRLDLLSAPVR
Ga0255266_111418023300024550FreshwaterAAAKQLFGAAGTMDLVAVMNTYAVSGFFAIAVDEQPAEGSVALP
Ga0255283_108679813300024557FreshwaterFGHELFDDRKVSAATFAAAKQLFGAAGTMDLVAVMNTYAVSGFFAIAVDEQPAEGSVALP
Ga0209108_1056302623300025165SoilELLDDRKMSSATFAKAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHLPAGQPTLPR
Ga0209605_125961113300025861Anaerobic Digestor SludgeGATGAMDIVAVMSTYAVSGFYAIAVDEHPGGKKLEPLPRH
Ga0207710_1048343513300025900Switchgrass RhizosphereRGTMDMVAAMNTYAVSGFFAIAVDEHSAQGKPELPPVK
Ga0207688_1044687413300025901Corn, Switchgrass And Miscanthus RhizosphereLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ
Ga0207680_1057393313300025903Switchgrass RhizosphereAKVAELFGKKGAMDMAAVMNTYAVSGFFAIAVDERAPEGRTDLLSSPIH
Ga0207680_1100819213300025903Switchgrass RhizosphereAKAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGKPELPAVK
Ga0207680_1137882513300025903Switchgrass RhizosphereGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPALKK
Ga0207645_1046202313300025907Miscanthus RhizosphereVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEQAAEGKTALPAAK
Ga0207705_1082031113300025909Corn RhizosphereGTMDMVAVMNTYAVSGYFAIAVDERSPEGKPELPAVK
Ga0207654_1020953223300025911Corn RhizosphereAKAVELWSKRGTMDMVAVMNTYAVSGYFAIAVDEHSPEGKPELPAVK
Ga0207654_1118162023300025911Corn RhizosphereNDKKVDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDERSAEGRPELPAVK
Ga0207660_1055593523300025917Corn RhizosphereRQLFHDNKMDAATFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP
Ga0207662_1120645813300025918Switchgrass RhizosphereKVDSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK
Ga0207662_1132748913300025918Switchgrass RhizosphereTFAKIVELYGQRGAMDIVAVMNTYAVSGFYAIAVDEQPAAGKPTLRSK
Ga0207649_1144906623300025920Corn RhizosphereGKRGAMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK
Ga0207681_1026591933300025923Switchgrass RhizosphereAKATQLFGRRGAMDMVAVMSTYAVSGFFAIAADEHMPPGRPDLESVNR
Ga0207681_1080119213300025923Switchgrass RhizosphereSAVFAEAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGRPELPMIK
Ga0207650_1030929313300025925Switchgrass RhizosphereDRKMSSATFAKAVQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGTPSLPRLGK
Ga0207687_1016086723300025927Miscanthus RhizosphereTFAKAVQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPSLPRLGK
Ga0207687_1118249223300025927Miscanthus RhizosphereRELIGDRKMSSATFAKAEQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPALKK
Ga0207700_1168978713300025928Corn, Switchgrass And Miscanthus RhizosphereAKAVQLFGQRGTMDILAIMNTYAVSGFYAIAVDEQPAAGKSPLGRAK
Ga0207664_1093086933300025929Agricultural SoilTMDILAIMNTYAVSGFYAIAVDEQPAAGKSPLGRAK
Ga0207644_1019819943300025931Switchgrass RhizosphereGRKGAMDMVAVMNTYAVSGFYAIAVDEHMPPGRQDLR
Ga0207706_1019475713300025933Corn RhizosphereKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ
Ga0207670_1001900653300025936Switchgrass RhizosphereGRQMFRDKKMEPATFAKVAELFGKKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH
Ga0207670_1035348233300025936Switchgrass RhizosphereATFAKASQLFGKKGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ
Ga0207669_1191809413300025937Miscanthus RhizosphereTFAKAVELFGRKGTMDLVAVMNTYAVSGFFAIAVDERAAAGRLDLLSSPVH
Ga0207704_1121106413300025938Miscanthus RhizosphereAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAEGKAALPAAK
Ga0207691_1007359313300025940Miscanthus RhizosphereAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH
Ga0207691_1139187513300025940Miscanthus RhizosphereAKAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGRPELPVIK
Ga0207679_1029927513300025945Corn RhizosphereKKVDSATVEKVVELWGKRGAMDIVAVMNTYAVSGFFAIAVDEHAAEGKAALPAVK
Ga0207651_1043600913300025960Switchgrass RhizosphereGAMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ
Ga0207651_1045928923300025960Switchgrass RhizosphereMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP
Ga0207651_1113407823300025960Switchgrass RhizosphereATFAKAVELFGRRGTMDMVAVMNTYAVSGFFAIAVDEHMPAGQSDLK
Ga0207668_1066674713300025972Switchgrass RhizosphereDMVAVMNTYAVSGFFAIAVDERAPDGRLDLLSSPIR
Ga0207658_1183950123300025986Switchgrass RhizosphereFAKVAELFGKKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH
Ga0207677_1127776923300026023Miscanthus RhizosphereAKVVELWGKRGAMDMVAVMNTYAVSGYFAIAVDERSPEGKPELPAVK
Ga0207703_1032408023300026035Switchgrass RhizosphereTFAKAVELFGRRGVMDMVAVMSTYAVSGFFAIAVDEHLPAGRPELVTR
Ga0207639_1060199323300026041Corn RhizosphereFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDERSAEGRPELPAVK
Ga0207678_1001703883300026067Corn RhizosphereLFGKKGAMDMVALMNTYAVSGFFAIAVDERAPEGRLDLLSSPVH
Ga0207708_1020883723300026075Corn, Switchgrass And Miscanthus RhizosphereMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPVH
Ga0207708_1145430623300026075Corn, Switchgrass And Miscanthus RhizosphereMDLVAVMSTYAVSGFYAIAVDEHMPPGRQDLESAPRQ
Ga0207702_1025897113300026078Corn RhizosphereAMDMVAVMNTYAVSGFFAIAVDEHSGEGKPELPVAK
Ga0207702_1249394023300026078Corn RhizosphereTFAKAVELWGKRGAMDMVAVMNTYAVSGYFAIAVDEHSPEGKPELPAIK
Ga0207641_1215752723300026088Switchgrass RhizosphereQRGVMDMVAVMNTYAVSGFYGIAVDEQAAAGKTPLEKIK
Ga0207641_1229847613300026088Switchgrass RhizosphereKAVELWGKRGTMDMVAVMNTYAISGFFAIAVDEHAAEGKAALPAVK
Ga0207648_1136570513300026089Miscanthus RhizosphereSATFAKVVELWGKRGAMDMVAVMNTYAVSGFFAIAVDEQAAEGKTALPAAK
Ga0207648_1181411123300026089Miscanthus RhizosphereRFGRQMLTDKKMDAATFAKAAQLFGRKGAMDLVAVMNTYAVSGFYAIAVDERMPPGRQDL
Ga0207676_1193454413300026095Switchgrass RhizosphereAMDMAAVMNTYAVSGFFAIAVDERAPEGRTDLLSSPIH
Ga0207675_10019438033300026118Switchgrass RhizosphereGVMDMVAVMNTYAVSGFYAIAVDEHMPPGRPELARPAR
Ga0209996_105977913300027395Arabidopsis Thaliana RhizosphereAKGAMDLVAVMSTYAVSGFYAIAVDEHAAPGQPTLPR
Ga0209074_1017880913300027787Agricultural SoilLWGKRGAMDIVAVMSTYAVSGFFAIAVDEHPAEGKAELPAVK
Ga0209579_1024956113300027869Surface SoilMIDMVAAMNTYAVSGYFAIAVDEHSPEGKPELPPMK
Ga0209465_1052699813300027874Tropical Forest SoilVFTDKKVSPDAFAKVVEFYGKRGAMDLVAVMVTYADSGFYGIAVDEQPAAGKSPL
Ga0209481_1001081913300027880Populus RhizosphereKMDPQTFAKAAQLFGRRGAMDLVAVMSTYAVSGFYATAVDEHMPPGRPDLDR
Ga0209481_1019363143300027880Populus RhizosphereTMDLVAVMSTYAVSGFYAIAVDEHPAAGQKTLPPVAAH
Ga0209275_1032407113300027884SoilRGTMDMVAVMSAYAVSGYFAIAVDERSPEGKPELPAVK
Ga0209275_1079466913300027884SoilRGTMDMVAVMSTYAVSGYFAIAVDERSPEGKPELPAVK
Ga0209624_1024664013300027895Forest SoilATFAKAVEFWGKPGTMDIVSVMATYAVSGYFAIAVDERSAEGKPELPLVK
Ga0209415_1090182313300027905Peatlands SoilKAVDLWGKRGTMDMVAAMNTYAVSGYFAIAVDEHSPEGKPELPPMK
Ga0207428_1029351813300027907Populus RhizosphereFAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQKTLPPVAAH
Ga0268265_1076615813300028380Switchgrass RhizosphereMDMVAVMNTYAVSGFYAIAVDERAPEGRLDLLSSPVH
Ga0268265_1103921313300028380Switchgrass RhizosphereMDLVAVMSTYAVSGFYATAVDERMPSGRPDLERTPR
Ga0268264_1139286313300028381Switchgrass RhizosphereFRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFFAIAVDERAPEGRTDLLSSPVH
Ga0307281_1029474323300028803SoilKAVGLFGQHGAMDLVAVMSTYAISGFYAIAVDEHMPTGQPMLEPRAK
Ga0308309_1028458523300028906SoilFAKVAELWGKRGAMDMVAAMNTYAVSGFFAIAVDEHSAEGKPELPAVK
Ga0302179_1003440233300030058PalsaWGKRGAMDMVAVMTTYAVSGYFAIAVDERSPEGKPELPPVK
Ga0311353_1112093233300030399PalsaKRGTMDMVAVMNTYAVSGYFAIAVNERSPEGKPELPAVK
Ga0311354_1179657123300030618PalsaKRGTMDMVAVMNTYAVSGYFAIAVNERSPEGKPELPAMK
Ga0307497_1063712913300031226SoilFGRKGAMDMAAVMNTYAVSGFFAIAVDERAPEGRLDLLSSPIH
Ga0170824_11759691223300031231Forest SoilATFAKIVELFGKRGAMDMVAVMNTYAVSGFFGIAVDEHAAPGKPSF
Ga0265332_1017195723300031238RhizosphereSATFAKAVEFFGKRGAMDMVAVMNTYAVSGFFAIAVDEHAAAGKPPL
Ga0307505_1031185413300031455SoilAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHLPAGQSTLPR
Ga0310888_1035607713300031538SoilKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP
Ga0310888_1053330123300031538SoilAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPPVAAH
Ga0318538_1027729013300031546SoilKKVDSATFAKVVEFYGKRGAMDMVAVMNTYAVSGFYGIAVDEHAAPGKPSL
Ga0318572_1090607923300031681SoilGKKGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKSALPTLKK
Ga0310686_10281664113300031708SoilRGTMDMVAVMSAYVVSGYFAIAVDERSPEGKPELPPVK
Ga0310686_11610826523300031708SoilMFHDRKVDSSTFAKAVELWSKRGTMDMVAVMSTYAVSGYFAIAVDERSPDGKPELPPVK
Ga0307468_10223477923300031740Hardwood Forest SoilFTDKKVDSATYAKIVEIYGKKGAMDLVAVMITYADSGFYGIAVNEQPAPGKPAL
Ga0310907_1042563823300031847SoilVGQRGAMDIVAVMNTYAVSGFYAIAVDEQPPAGKPALEQSK
Ga0310907_1070203413300031847SoilGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP
Ga0310904_1140245313300031854SoilFGPRGAMDMVAVMNTYAVSGFYAIAVDEHMAPGRPDLR
Ga0310892_1004747623300031858SoilLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPARQ
Ga0310892_1022204723300031858SoilLFHDNRMDTATFGKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERGAR
Ga0306919_1138410423300031879SoilVEFYGKRGAMDMVAVMNTYAVSGFYGIAVDEHAAPGKPSL
Ga0310893_1057872313300031892SoilTFAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPPVAAH
Ga0310900_1069394323300031908SoilNDRKVSSATFAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPPVAAH
Ga0310900_1088954313300031908SoilELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPEGRLDLLSAPVH
Ga0308175_10156339013300031938SoilATFAKAVQFWGKRGTMDMVAAMNTYAVSGFFAIAVDEHAAEGKAELPGVK
Ga0310885_1072657523300031943SoilATFAKVVELFGQRGAMDIVAVMNTYAVSGFYAIAVDEQPPAGKPALEQSK
Ga0310909_1085496513300031947SoilYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPMLKK
Ga0308176_1187588413300031996SoilKKVVDLFGRRGAMDIVAVMNTYAVSGFYALAVDEHMPAGRPDLQRVSE
Ga0310903_1063974313300032000SoilRRGAMDLVAVMNTYAVSGFYALAVDEHMPPGRADLR
Ga0310903_1077437423300032000SoilMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERPARQ
Ga0307411_1155475113300032005RhizosphereFGRQMFRDKKMEPATFAKVVELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPEGRPDLLSSPVH
Ga0310902_1048795533300032012SoilELLNDRKMSSATFATAKQLYGAKGAMDLVAVMSTYAVSGFYAIAVDEHAAPGQPTLPK
Ga0310890_1172293433300032075SoilDRKVSSATFAKAKELYGAKGTMDLVAVMSTYAVSGFYAIAVDEHPAAGQPTLPK
Ga0310889_1007908923300032179SoilQLFHDNKMDAATFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERAARP
Ga0310889_1058664013300032179SoilQMFGDKKTDAATFAAVKQFFGPRGAMDMVAVMNTYAVSGFYAIAVDERMPPGRPDLKP
Ga0310896_1030428313300032211SoilHDNKMDAATFAKAVQLFGKKGAMDLVAVMSTYAVSGFYATAVDEHMPAGRPDLERGARP
Ga0348332_1043352513300032515Plant LitterVEFWGKRGTMDMVAVMSAYVVSGYFAIAVDERSPEGKPELPPVK
Ga0335081_1075274913300032892SoilKRGTMDMVAVMTTYAVSGYFAIAVDERTPEGRPELPPVK
Ga0335072_1049033723300032898SoilFWGKRGTMDLVAVMTTYAVSGYFAIAVDERSAEGKPELPPVK
Ga0335076_1085251113300032955SoilSATFAKAVQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPPAGKPALPALKK
Ga0310810_1024443933300033412SoilSATFAKAVALFGKQGAMDLVAVMSTYAVSGFYAIAVDEHMPAGRADLERVRQ
Ga0214471_1023250513300033417SoilFGQRGAMDLVAVMNTYAVSGFYAIAVDEHAQAGKPTLKR
Ga0326729_107021313300033432Peat SoilDTFAKVAKLYGNKGAMDVVAVMSTYAVSGFFAVAVDEHAPAGKPSLPSLTK
Ga0316624_1056076913300033486SoilFAKAVELWGKRGTMDMVAVMNTYAVSGYFAIAVDERSPEGKPELPAVK
Ga0326730_101424433300033500Peat SoilATFAKAVQLYGKNGAMDLVAVMSTYAVSGFYAIAVDEHPAAGKPALPALKK
Ga0326723_0456998_440_5683300034090Peat SoilLWGKRGTMDMVAAMNTYAVSGFFAIAVDERSPEGKPELPAVK
Ga0335068_0547044_2_1423300034116FreshwaterFAKAKQLFGDKGAMDLVAVMSTYAVSGFYAIAVDEHVPADKPQLPR
Ga0364935_0039548_5_1453300034151SedimentVELFGRKGAMDMVAVMNTYAVSGFYAIAVDERAPDGRLDLLSSPVH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.