Metagenome / Metatranscriptome Family F010698

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F010698
Family Type	Metagenome / Metatranscriptome
Number of Sequences	300
Average Sequence Length	39 residues
Representative Sequence	MGIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA
Number of Associated Samples	196
Number of Associated Scaffolds	300

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	91.00 %
% of genes near scaffold ends (potentially truncated)	13.00 %
% of genes from short scaffolds (< 2000 bps)	92.67 %
Associated GOLD sequencing projects	174
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (50.333 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.333 % of family members)
Environment Ontology (ENVO)	Unclassified (33.667 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (48.667 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 300 Family Scaffolds
PF02738	MoCoBD_1	5.00
PF00211	Guanylate_cyc	3.00
PF13416	SBP_bac_8	1.67
PF00072	Response_reg	1.33
PF00578	AhpC-TSA	1.00
PF00486	Trans_reg_C	0.67
PF13751	DDE_Tnp_1_6	0.67
PF13343	SBP_bac_6	0.67
PF02627	CMD	0.33
PF07568	HisKA_2	0.33
PF05635	23S_rRNA_IVP	0.33
PF04392	ABC_sub_bind	0.33
PF00873	ACR_tran	0.33
PF00903	Glyoxalase	0.33
PF01546	Peptidase_M20	0.33
PF12796	Ank_2	0.33
PF00135	COesterase	0.33
PF07978	NIPSNAP	0.33
PF05050	Methyltransf_21	0.33
PF02371	Transposase_20	0.33
PF03814	KdpA	0.33
PF03176	MMPL	0.33
PF12146	Hydrolase_4	0.33
PF03404	Mo-co_dimer	0.33
PF06568	DUF1127	0.33
PF06067	DUF932	0.33
PF04909	Amidohydro_2	0.33
PF12849	PBP_like_2	0.33
PF00916	Sulfate_transp	0.33
PF13683	rve_3	0.33
PF12840	HTH_20	0.33
PF02518	HATPase_c	0.33
PF12974	Phosphonate-bd	0.33
PF12697	Abhydrolase_6	0.33
PF03466	LysR_substrate	0.33
PF13185	GAF_2	0.33

COG ID	Name	Functional Category	% Frequency in 300 Family Scaffolds
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	3.00
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.33
COG0659	Sulfate permease or related transporter, MFS superfamily	Inorganic ion transport and metabolism [P]	0.33
COG1033	Predicted exporter protein, RND superfamily	General function prediction only [R]	0.33
COG2060	K+-transporting ATPase, KdpA subunit	Inorganic ion transport and metabolism [P]	0.33
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.33
COG2233	Xanthine/uracil permease	Nucleotide transport and metabolism [F]	0.33
COG2252	Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family	Nucleotide transport and metabolism [F]	0.33
COG2272	Carboxylesterase type B	Lipid transport and metabolism [I]	0.33
COG2409	Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily	General function prediction only [R]	0.33
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.33
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.33
COG3920	Two-component sensor histidine kinase, HisKA and HATPase domains	Signal transduction mechanisms [T]	0.33
COG5457	Uncharacterized conserved protein YjiS, DUF1127 family	Function unknown [S]	0.33

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
All Organisms	root	All Organisms	49.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
cellular organisms	root	All Organisms → cellular organisms	49.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	49.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	42.67 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.67 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	37.00 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.33 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	24.33 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	5.00 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.33 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.67 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.67 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.67 %
Alphaproteobacteria bacterium MarineAlpha10_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha10_Bin2	0.33 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	0.33 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.33 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.33 %
Hyphomicrobiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis	0.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.33 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.67 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	0.67 %
Beijerinckia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia	0.67 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.33 %
Enhydrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter	0.33 %
Alphaproteobacteria bacterium MarineAlpha10_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha10_Bin2	0.33 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.33 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.33 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.67 %
Microvirga massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis	0.67 %
unclassified Beijerinckia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia	0.67 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.33 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.33 %
Alphaproteobacteria bacterium MarineAlpha10_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha10_Bin2	0.33 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.33 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.33 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	50.33 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.67 %
Beijerinckia sp. 28-YEA-48	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48	0.67 %
Microvirga massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis	0.67 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.33 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	0.33 %
Alphaproteobacteria bacterium MarineAlpha10_Bin2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha10_Bin2	0.33 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.33 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.33 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.33 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.33 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.33 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002245\|JGIcombinedJ26739_101189396	Not Available	651	Open in IMG/M
3300005166\|Ga0066674_10356378	Not Available	686	Open in IMG/M
3300005167\|Ga0066672_10361365	All Organisms → cellular organisms → Bacteria → Proteobacteria	948	Open in IMG/M
3300005171\|Ga0066677_10064660	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1865	Open in IMG/M
3300005171\|Ga0066677_10374804	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	815	Open in IMG/M
3300005175\|Ga0066673_10092060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1614	Open in IMG/M
3300005175\|Ga0066673_10332758	Not Available	886	Open in IMG/M
3300005176\|Ga0066679_10215345	Not Available	1228	Open in IMG/M
3300005178\|Ga0066688_10404665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	885	Open in IMG/M
3300005179\|Ga0066684_10065627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2132	Open in IMG/M
3300005179\|Ga0066684_10361887	Not Available	971	Open in IMG/M
3300005179\|Ga0066684_10460585	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	855	Open in IMG/M
3300005179\|Ga0066684_11037084	Not Available	528	Open in IMG/M
3300005179\|Ga0066684_11089458	Not Available	511	Open in IMG/M
3300005184\|Ga0066671_10419753	Not Available	857	Open in IMG/M
3300005184\|Ga0066671_11023511	Not Available	519	Open in IMG/M
3300005187\|Ga0066675_11207314	Not Available	561	Open in IMG/M
3300005329\|Ga0070683_101132996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	752	Open in IMG/M
3300005330\|Ga0070690_100917646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	686	Open in IMG/M
3300005331\|Ga0070670_101647012	Not Available	590	Open in IMG/M
3300005336\|Ga0070680_101737858	Not Available	541	Open in IMG/M
3300005343\|Ga0070687_100381116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	919	Open in IMG/M
3300005345\|Ga0070692_10808744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	641	Open in IMG/M
3300005435\|Ga0070714_101508361	Not Available	657	Open in IMG/M
3300005436\|Ga0070713_101199014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	735	Open in IMG/M
3300005436\|Ga0070713_101948994	Not Available	570	Open in IMG/M
3300005445\|Ga0070708_101460315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	637	Open in IMG/M
3300005450\|Ga0066682_10377509	Not Available	911	Open in IMG/M
3300005451\|Ga0066681_10280278	All Organisms → cellular organisms → Bacteria	1016	Open in IMG/M
3300005451\|Ga0066681_10382287	Not Available	865	Open in IMG/M
3300005451\|Ga0066681_10689839	Not Available	622	Open in IMG/M
3300005454\|Ga0066687_10190252	Not Available	1113	Open in IMG/M
3300005454\|Ga0066687_10936283	Not Available	516	Open in IMG/M
3300005459\|Ga0068867_101748966	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300005467\|Ga0070706_100375365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1325	Open in IMG/M
3300005467\|Ga0070706_100412276	Not Available	1258	Open in IMG/M
3300005468\|Ga0070707_100430138	All Organisms → cellular organisms → Bacteria	1280	Open in IMG/M
3300005468\|Ga0070707_101899161	Not Available	563	Open in IMG/M
3300005518\|Ga0070699_100417331	Not Available	1214	Open in IMG/M
3300005536\|Ga0070697_100198364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1705	Open in IMG/M
3300005547\|Ga0070693_101151023	Not Available	594	Open in IMG/M
3300005549\|Ga0070704_102231257	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	509	Open in IMG/M
3300005554\|Ga0066661_10656287	Not Available	618	Open in IMG/M
3300005555\|Ga0066692_11017704	Not Available	507	Open in IMG/M
3300005560\|Ga0066670_11017593	Not Available	507	Open in IMG/M
3300005561\|Ga0066699_10929430	Not Available	605	Open in IMG/M
3300005566\|Ga0066693_10059715	Not Available	1295	Open in IMG/M
3300005569\|Ga0066705_10442153	All Organisms → cellular organisms → Bacteria → Proteobacteria	814	Open in IMG/M
3300005569\|Ga0066705_10551575	Not Available	714	Open in IMG/M
3300005569\|Ga0066705_10601319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	674	Open in IMG/M
3300005575\|Ga0066702_10771910	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	572	Open in IMG/M
3300005576\|Ga0066708_10099627	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1724	Open in IMG/M
3300005576\|Ga0066708_10160215	Not Available	1389	Open in IMG/M
3300005576\|Ga0066708_10208863	Not Available	1227	Open in IMG/M
3300005576\|Ga0066708_10313257	Not Available	1005	Open in IMG/M
3300005576\|Ga0066708_10833205	Not Available	577	Open in IMG/M
3300005586\|Ga0066691_10324136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	910	Open in IMG/M
3300005602\|Ga0070762_11062108	Not Available	557	Open in IMG/M
3300005610\|Ga0070763_10532353	All Organisms → cellular organisms → Bacteria → Proteobacteria	675	Open in IMG/M
3300005614\|Ga0068856_101664368	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	651	Open in IMG/M
3300005618\|Ga0068864_101258064	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	740	Open in IMG/M
3300005841\|Ga0068863_101980144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	593	Open in IMG/M
3300005843\|Ga0068860_101264195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	759	Open in IMG/M
3300005844\|Ga0068862_100756910	All Organisms → cellular organisms → Bacteria	945	Open in IMG/M
3300005921\|Ga0070766_11233680	Not Available	518	Open in IMG/M
3300006028\|Ga0070717_11141261	Not Available	709	Open in IMG/M
3300006028\|Ga0070717_11982613	Not Available	525	Open in IMG/M
3300006031\|Ga0066651_10275808	Not Available	894	Open in IMG/M
3300006031\|Ga0066651_10442929	Not Available	690	Open in IMG/M
3300006031\|Ga0066651_10810192	Not Available	508	Open in IMG/M
3300006032\|Ga0066696_10724455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	638	Open in IMG/M
3300006034\|Ga0066656_10396940	All Organisms → cellular organisms → Bacteria	893	Open in IMG/M
3300006034\|Ga0066656_11128637	Not Available	504	Open in IMG/M
3300006046\|Ga0066652_100349435	Not Available	1331	Open in IMG/M
3300006046\|Ga0066652_100369206	Not Available	1298	Open in IMG/M
3300006046\|Ga0066652_101608752	Not Available	597	Open in IMG/M
3300006176\|Ga0070765_100318509	All Organisms → cellular organisms → Bacteria	1441	Open in IMG/M
3300006176\|Ga0070765_101151041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	733	Open in IMG/M
3300006791\|Ga0066653_10673670	Not Available	532	Open in IMG/M
3300006794\|Ga0066658_10333514	All Organisms → cellular organisms → Bacteria	810	Open in IMG/M
3300006794\|Ga0066658_10499302	Not Available	662	Open in IMG/M
3300006794\|Ga0066658_10769650	Not Available	539	Open in IMG/M
3300006796\|Ga0066665_11004681	Not Available	640	Open in IMG/M
3300006797\|Ga0066659_10688352	Not Available	835	Open in IMG/M
3300006797\|Ga0066659_10871959	All Organisms → cellular organisms → Bacteria	750	Open in IMG/M
3300006800\|Ga0066660_10368792	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1173	Open in IMG/M
3300006800\|Ga0066660_10378048	Not Available	1161	Open in IMG/M
3300006800\|Ga0066660_11595106	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	517	Open in IMG/M
3300006854\|Ga0075425_101267906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	836	Open in IMG/M
3300007258\|Ga0099793_10575694	Not Available	563	Open in IMG/M
3300007265\|Ga0099794_10749275	Not Available	521	Open in IMG/M
3300007788\|Ga0099795_10162172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	923	Open in IMG/M
3300007788\|Ga0099795_10337222	Not Available	671	Open in IMG/M
3300009012\|Ga0066710_100534062	All Organisms → cellular organisms → Bacteria	1772	Open in IMG/M
3300009012\|Ga0066710_102476270	Not Available	751	Open in IMG/M
3300009012\|Ga0066710_104127316	Not Available	543	Open in IMG/M
3300009038\|Ga0099829_11223790	All Organisms → cellular organisms → Bacteria → Proteobacteria	622	Open in IMG/M
3300009089\|Ga0099828_11926210	Not Available	518	Open in IMG/M
3300009094\|Ga0111539_10247085	Not Available	2077	Open in IMG/M
3300009094\|Ga0111539_11161814	Not Available	897	Open in IMG/M
3300009094\|Ga0111539_11710033	Not Available	729	Open in IMG/M
3300009137\|Ga0066709_100787079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1377	Open in IMG/M
3300009137\|Ga0066709_101681350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	902	Open in IMG/M
3300009137\|Ga0066709_103857673	Not Available	544	Open in IMG/M
3300009143\|Ga0099792_10581450	Not Available	712	Open in IMG/M
3300009143\|Ga0099792_10950669	Not Available	571	Open in IMG/M
3300009148\|Ga0105243_12211483	Not Available	587	Open in IMG/M
3300009156\|Ga0111538_11670408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	802	Open in IMG/M
3300009156\|Ga0111538_12357749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	668	Open in IMG/M
3300009156\|Ga0111538_13954836	Not Available	512	Open in IMG/M
3300009176\|Ga0105242_11271173	All Organisms → cellular organisms → Bacteria → Proteobacteria	758	Open in IMG/M
3300009176\|Ga0105242_11735091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	661	Open in IMG/M
3300009177\|Ga0105248_11302071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	822	Open in IMG/M
3300009553\|Ga0105249_10493743	Not Available	1268	Open in IMG/M
3300010118\|Ga0127465_1080029	Not Available	590	Open in IMG/M
3300010159\|Ga0099796_10011097	All Organisms → cellular organisms → Bacteria	2501	Open in IMG/M
3300010166\|Ga0126306_11168104	Not Available	632	Open in IMG/M
3300010303\|Ga0134082_10261670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	719	Open in IMG/M
3300010320\|Ga0134109_10156291	All Organisms → cellular organisms → Bacteria → Proteobacteria	823	Open in IMG/M
3300010321\|Ga0134067_10496336	Not Available	505	Open in IMG/M
3300010325\|Ga0134064_10308573	Not Available	605	Open in IMG/M
3300010326\|Ga0134065_10025229	All Organisms → cellular organisms → Bacteria → Proteobacteria	1706	Open in IMG/M
3300010326\|Ga0134065_10320176	Not Available	600	Open in IMG/M
3300010333\|Ga0134080_10622064	Not Available	528	Open in IMG/M
3300010335\|Ga0134063_10453992	Not Available	635	Open in IMG/M
3300010337\|Ga0134062_10390647	Not Available	679	Open in IMG/M
3300010337\|Ga0134062_10530467	Not Available	596	Open in IMG/M
3300010364\|Ga0134066_10093068	Not Available	862	Open in IMG/M
3300010373\|Ga0134128_10426697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1480	Open in IMG/M
3300010373\|Ga0134128_11250849	Not Available	818	Open in IMG/M
3300010373\|Ga0134128_11317067	Not Available	796	Open in IMG/M
3300010375\|Ga0105239_11799189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	710	Open in IMG/M
3300010397\|Ga0134124_12691645	Not Available	541	Open in IMG/M
3300010397\|Ga0134124_13150540	Not Available	505	Open in IMG/M
3300010399\|Ga0134127_12889590	All Organisms → cellular organisms → Bacteria	559	Open in IMG/M
3300010400\|Ga0134122_10280194	Not Available	1422	Open in IMG/M
3300010401\|Ga0134121_12448732	Not Available	563	Open in IMG/M
3300010403\|Ga0134123_12519876	Not Available	581	Open in IMG/M
3300011271\|Ga0137393_11064366	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	688	Open in IMG/M
3300012096\|Ga0137389_10780252	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	821	Open in IMG/M
3300012177\|Ga0153943_1149974	Not Available	511	Open in IMG/M
3300012189\|Ga0137388_10837260	Not Available	852	Open in IMG/M
3300012199\|Ga0137383_10504105	Not Available	886	Open in IMG/M
3300012200\|Ga0137382_10081800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2095	Open in IMG/M
3300012200\|Ga0137382_10447025	Not Available	914	Open in IMG/M
3300012202\|Ga0137363_10113228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2081	Open in IMG/M
3300012203\|Ga0137399_11150206	Not Available	653	Open in IMG/M
3300012205\|Ga0137362_10715020	Not Available	860	Open in IMG/M
3300012208\|Ga0137376_10017545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis	5388	Open in IMG/M
3300012208\|Ga0137376_10460924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1103	Open in IMG/M
3300012208\|Ga0137376_10558711	Not Available	991	Open in IMG/M
3300012208\|Ga0137376_10743632	Not Available	845	Open in IMG/M
3300012210\|Ga0137378_10353278	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1365	Open in IMG/M
3300012211\|Ga0137377_10022798	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis	5565	Open in IMG/M
3300012211\|Ga0137377_11507497	Not Available	598	Open in IMG/M
3300012211\|Ga0137377_11543077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	589	Open in IMG/M
3300012211\|Ga0137377_11878352	Not Available	517	Open in IMG/M
3300012212\|Ga0150985_122017830	Not Available	567	Open in IMG/M
3300012285\|Ga0137370_10145874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1366	Open in IMG/M
3300012285\|Ga0137370_10256877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1036	Open in IMG/M
3300012285\|Ga0137370_10439384	Not Available	794	Open in IMG/M
3300012285\|Ga0137370_10731904	Not Available	614	Open in IMG/M
3300012353\|Ga0137367_10171739	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1577	Open in IMG/M
3300012354\|Ga0137366_10338867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1102	Open in IMG/M
3300012357\|Ga0137384_10989660	All Organisms → cellular organisms → Bacteria	676	Open in IMG/M
3300012469\|Ga0150984_101904117	Not Available	525	Open in IMG/M
3300012469\|Ga0150984_104188830	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	521	Open in IMG/M
3300012532\|Ga0137373_10168675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1831	Open in IMG/M
3300012582\|Ga0137358_10487868	Not Available	830	Open in IMG/M
3300012582\|Ga0137358_10757230	Not Available	648	Open in IMG/M
3300012683\|Ga0137398_10017237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3837	Open in IMG/M
3300012683\|Ga0137398_10271541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1134	Open in IMG/M
3300012683\|Ga0137398_11263542	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha10_Bin2	502	Open in IMG/M
3300012911\|Ga0157301_10320766	Not Available	573	Open in IMG/M
3300012917\|Ga0137395_10685911	All Organisms → cellular organisms → Bacteria → Proteobacteria	741	Open in IMG/M
3300012923\|Ga0137359_10954841	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	737	Open in IMG/M
3300012924\|Ga0137413_10524594	Not Available	875	Open in IMG/M
3300012924\|Ga0137413_11538354	Not Available	542	Open in IMG/M
3300012925\|Ga0137419_10367981	All Organisms → cellular organisms → Bacteria → Proteobacteria	1116	Open in IMG/M
3300012925\|Ga0137419_10824715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	760	Open in IMG/M
3300012925\|Ga0137419_10998937	Not Available	693	Open in IMG/M
3300012927\|Ga0137416_10703645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	888	Open in IMG/M
3300012927\|Ga0137416_11125502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	705	Open in IMG/M
3300012927\|Ga0137416_11839174	Not Available	554	Open in IMG/M
3300012929\|Ga0137404_11285545	Not Available	674	Open in IMG/M
3300012977\|Ga0134087_10800556	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	510	Open in IMG/M
3300012984\|Ga0164309_11786965	Not Available	527	Open in IMG/M
3300012987\|Ga0164307_10461323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	951	Open in IMG/M
3300012989\|Ga0164305_10882565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48	750	Open in IMG/M
3300013296\|Ga0157374_11903047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	621	Open in IMG/M
3300013306\|Ga0163162_11658272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	730	Open in IMG/M
3300013307\|Ga0157372_13323375	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	512	Open in IMG/M
3300014166\|Ga0134079_10311942	Not Available	703	Open in IMG/M
3300014166\|Ga0134079_10662644	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	527	Open in IMG/M
3300014166\|Ga0134079_10703693	Not Available	516	Open in IMG/M
3300014325\|Ga0163163_12737912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	550	Open in IMG/M
3300014326\|Ga0157380_10262706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1569	Open in IMG/M
3300014745\|Ga0157377_10152379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1430	Open in IMG/M
3300014969\|Ga0157376_11540645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48	698	Open in IMG/M
3300015200\|Ga0173480_10429829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	774	Open in IMG/M
3300015241\|Ga0137418_10026014	All Organisms → cellular organisms → Bacteria → Proteobacteria	5405	Open in IMG/M
3300015262\|Ga0182007_10194910	Not Available	706	Open in IMG/M
3300015372\|Ga0132256_102091180	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	672	Open in IMG/M
3300015373\|Ga0132257_102859963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	629	Open in IMG/M
3300015374\|Ga0132255_105069705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	558	Open in IMG/M
3300017654\|Ga0134069_1158308	Not Available	759	Open in IMG/M
3300017792\|Ga0163161_10217404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1479	Open in IMG/M
3300017792\|Ga0163161_11635160	Not Available	569	Open in IMG/M
3300018061\|Ga0184619_10028988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2321	Open in IMG/M
3300018431\|Ga0066655_10460157	Not Available	840	Open in IMG/M
3300018431\|Ga0066655_10778491	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	650	Open in IMG/M
3300018431\|Ga0066655_11307763	Not Available	521	Open in IMG/M
3300018433\|Ga0066667_10252835	All Organisms → cellular organisms → Bacteria	1337	Open in IMG/M
3300018433\|Ga0066667_10691642	Not Available	855	Open in IMG/M
3300018433\|Ga0066667_10930682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	748	Open in IMG/M
3300018433\|Ga0066667_11147676	Not Available	674	Open in IMG/M
3300018468\|Ga0066662_10920175	Not Available	860	Open in IMG/M
3300018482\|Ga0066669_10162995	All Organisms → cellular organisms → Bacteria	1657	Open in IMG/M
3300018482\|Ga0066669_10189099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1563	Open in IMG/M
3300018482\|Ga0066669_10315406	Not Available	1278	Open in IMG/M
3300018482\|Ga0066669_10388979	All Organisms → cellular organisms → Bacteria	1176	Open in IMG/M
3300018482\|Ga0066669_10497141	Not Available	1055	Open in IMG/M
3300018482\|Ga0066669_10994578	Not Available	756	Open in IMG/M
3300018482\|Ga0066669_11473675	Not Available	618	Open in IMG/M
3300018482\|Ga0066669_11549067	Not Available	603	Open in IMG/M
3300019362\|Ga0173479_10634096	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	565	Open in IMG/M
3300020583\|Ga0210401_10447657	Not Available	1154	Open in IMG/M
3300020583\|Ga0210401_10765084	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	826	Open in IMG/M
3300020583\|Ga0210401_10978851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	705	Open in IMG/M
3300021170\|Ga0210400_10052613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3171	Open in IMG/M
3300021170\|Ga0210400_10078040	All Organisms → cellular organisms → Bacteria → Proteobacteria	2600	Open in IMG/M
3300021170\|Ga0210400_10758351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	796	Open in IMG/M
3300021170\|Ga0210400_11220944	Not Available	605	Open in IMG/M
3300021358\|Ga0213873_10174627	Not Available	657	Open in IMG/M
3300021420\|Ga0210394_11218739	All Organisms → cellular organisms → Bacteria → Proteobacteria	646	Open in IMG/M
3300022557\|Ga0212123_10050289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	3831	Open in IMG/M
3300025899\|Ga0207642_10738543	Not Available	622	Open in IMG/M
3300025901\|Ga0207688_10434133	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	817	Open in IMG/M
3300025908\|Ga0207643_10129261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	1502	Open in IMG/M
3300025910\|Ga0207684_10106853	All Organisms → cellular organisms → Bacteria → Proteobacteria	2395	Open in IMG/M
3300025910\|Ga0207684_10175192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1849	Open in IMG/M
3300025910\|Ga0207684_10307932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1365	Open in IMG/M
3300025910\|Ga0207684_10389905	Not Available	1197	Open in IMG/M
3300025910\|Ga0207684_10435431	Not Available	1126	Open in IMG/M
3300025910\|Ga0207684_10678115	All Organisms → cellular organisms → Bacteria	877	Open in IMG/M
3300025910\|Ga0207684_11162281	Not Available	640	Open in IMG/M
3300025910\|Ga0207684_11630241	Not Available	522	Open in IMG/M
3300025918\|Ga0207662_10160559	All Organisms → cellular organisms → Bacteria → Proteobacteria	1435	Open in IMG/M
3300025922\|Ga0207646_10008001	All Organisms → cellular organisms → Bacteria	10659	Open in IMG/M
3300025922\|Ga0207646_10015145	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	7294	Open in IMG/M
3300025922\|Ga0207646_10018440	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6509	Open in IMG/M
3300025922\|Ga0207646_10019946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6220	Open in IMG/M
3300025922\|Ga0207646_10080220	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2918	Open in IMG/M
3300025922\|Ga0207646_11258530	Not Available	647	Open in IMG/M
3300025922\|Ga0207646_11670651	Not Available	548	Open in IMG/M
3300025926\|Ga0207659_11585355	Not Available	559	Open in IMG/M
3300025926\|Ga0207659_11869258	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	509	Open in IMG/M
3300025927\|Ga0207687_10361414	Not Available	1185	Open in IMG/M
3300025929\|Ga0207664_10692312	Not Available	916	Open in IMG/M
3300025930\|Ga0207701_10542836	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	993	Open in IMG/M
3300025932\|Ga0207690_11556396	Not Available	553	Open in IMG/M
3300025934\|Ga0207686_11802544	Not Available	506	Open in IMG/M
3300025936\|Ga0207670_10888601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	746	Open in IMG/M
3300025942\|Ga0207689_11502685	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	563	Open in IMG/M
3300026023\|Ga0207677_10605169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	962	Open in IMG/M
3300026078\|Ga0207702_10972224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	842	Open in IMG/M
3300026088\|Ga0207641_11509538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	674	Open in IMG/M
3300026116\|Ga0207674_10578906	Not Available	1084	Open in IMG/M
3300026309\|Ga0209055_1214710	Not Available	589	Open in IMG/M
3300026312\|Ga0209153_1116290	Not Available	1012	Open in IMG/M
3300026316\|Ga0209155_1062848	Not Available	1418	Open in IMG/M
3300026317\|Ga0209154_1207409	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	747	Open in IMG/M
3300026323\|Ga0209472_1219675	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	622	Open in IMG/M
3300026330\|Ga0209473_1274073	Not Available	569	Open in IMG/M
3300026330\|Ga0209473_1277272	Not Available	565	Open in IMG/M
3300026530\|Ga0209807_1181585	Not Available	767	Open in IMG/M
3300026548\|Ga0209161_10117854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1575	Open in IMG/M
3300026550\|Ga0209474_10155839	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1484	Open in IMG/M
3300026557\|Ga0179587_10279500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1073	Open in IMG/M
3300027512\|Ga0209179_1147753	Not Available	525	Open in IMG/M
3300027546\|Ga0208984_1048757	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	902	Open in IMG/M
3300027565\|Ga0209219_1095442	Not Available	734	Open in IMG/M
3300027663\|Ga0208990_1000722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8808	Open in IMG/M
3300027669\|Ga0208981_1036361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1257	Open in IMG/M
3300027681\|Ga0208991_1026193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1762	Open in IMG/M
3300027738\|Ga0208989_10001160	All Organisms → cellular organisms → Bacteria	8362	Open in IMG/M
3300027903\|Ga0209488_10341723	All Organisms → cellular organisms → Bacteria → Proteobacteria	1114	Open in IMG/M
3300027907\|Ga0207428_10366989	All Organisms → cellular organisms → Bacteria → Proteobacteria	1058	Open in IMG/M
3300028047\|Ga0209526_10850739	Not Available	560	Open in IMG/M
3300028047\|Ga0209526_10957658	Not Available	515	Open in IMG/M
3300028380\|Ga0268265_11644540	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	648	Open in IMG/M
3300028536\|Ga0137415_10153723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2137	Open in IMG/M
3300028536\|Ga0137415_10925596	Not Available	682	Open in IMG/M
3300028906\|Ga0308309_11686666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	538	Open in IMG/M
3300029636\|Ga0222749_10399798	Not Available	728	Open in IMG/M
3300031720\|Ga0307469_11833366	Not Available	587	Open in IMG/M
3300031820\|Ga0307473_10881691	Not Available	645	Open in IMG/M
3300031854\|Ga0310904_11138035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	561	Open in IMG/M
3300031962\|Ga0307479_10258096	All Organisms → cellular organisms → Bacteria → Proteobacteria	1722	Open in IMG/M
3300031962\|Ga0307479_12005407	Not Available	528	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	82.33%
Host-Associated	Host-Associated	17.67%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	81.67%
Plants	Host-Associated → Plants	17.33%
Aquatic	Environmental → Aquatic	0.67%
Fungi	Host-Associated → Fungi	0.33%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	81.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere	10.00%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.00%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.33%
Sediment	Environmental → Aquatic → Sediment	0.33%
Roots	Host-Associated → Plants → Roots	0.33%
Mycelium	Host-Associated → Fungi → Mycelium	0.33%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	62.67%
Loam	Environmental → Terrestrial → Soil → Loam	19.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.67%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.00%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.33%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.00%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.33%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.33%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.33%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	30.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	28.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	12.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.00%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.33%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.67%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.00%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	0.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.33%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.33%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.33%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.33%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	20.33%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	19.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	9.67%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	7.33%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	5.67%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.00%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.00%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.00%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	2.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.00%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.67%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.33%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.33%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.00%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.00%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.67%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.67%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	0.33%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.33%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.33%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.33%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.33%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.33%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.33%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.33%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.33%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.33%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.33%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.33%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010118	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012177	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG	Host-Associated	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012911	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017654	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018061	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Host-Associated	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026316	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300026330	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)	Environmental	Open in IMG/M
3300027546	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027565	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)	Environmental	Open in IMG/M
3300027663	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)	Environmental	Open in IMG/M
3300027669	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)	Environmental	Open in IMG/M
3300027681	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300027738	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGIcombinedJ26739_1011893962	3300002245	Forest Soil	MGIVFLAGLVLLYLFSSKPGWFGCLLVLLVVSILIAGCG*
Ga0066674_103563781	3300005166	Soil	MAIALLVWLLLLYFCSNKPGPFGCLLVLLVIAVLIAGCA*
Ga0066672_103613651	3300005167	Soil	MGFAFLAWLVLLYLFSGKPGVFACLLALLIIGILVAACG*
Ga0066677_100646602	3300005171	Soil	MGLAILAWLVLLYLFSGKPGWFACLLVLLAIGILIAGCG*
Ga0066677_103748042	3300005171	Soil	MLIALLVWFMLLYFCSSKPGWFGCLLVLLVIAVLIAGCA*
Ga0066673_100920602	3300005175	Soil	MGIALLVWLVLIYFCSGKPGWFGCLVVLLVIAVLIAGCA*
Ga0066673_103327581	3300005175	Soil	MAIALLVWLLLLYFCSNKPGPFGCLLVLLVIAILITGCA*
Ga0066679_102153453	3300005176	Soil	MGVALLVWLVLLYLCSGKPGWFGCLLALLVIAVLITGCA*
Ga0066688_104046651	3300005178	Soil	MAIALLVWLVLLYFCSDKPGWFGCLLILLVIAVLIAGCA*
Ga0066684_100656272	3300005179	Soil	MAIALLVWLVLIYFCSGKPGWFGCLVVLLVIAVLIAGCA*
Ga0066684_103618872	3300005179	Soil	MAIALLVWLVLLYFCSDKPGWFGCLRVLLVIAVLITGCA*
Ga0066684_104605852	3300005179	Soil	MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIAVLIAGCA*
Ga0066684_110370841	3300005179	Soil	EGDPEMGFAILAWLVLLYLFSSKPGWFACLLVILVIGVLIAGC*
Ga0066684_110894581	3300005179	Soil	MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA*
Ga0066671_104197531	3300005184	Soil	MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLITGCA*
Ga0066671_110235111	3300005184	Soil	MLCIAFLGWLVLLYFCSSKPGWFGCLLALLLVGIILAGCG*
Ga0066675_112073142	3300005187	Soil	MAIALLVWLVLLYFCSDKPGWLGCLLVLLVIAVLIAGCA*
Ga0070683_1011329962	3300005329	Corn Rhizosphere	MCTFLLVRLVLAYFVSSRPGWFGALLVLLAMVILVAGCA*
Ga0070690_1009176462	3300005330	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAILVAGCA*
Ga0070670_1016470121	3300005331	Switchgrass Rhizosphere	MCTFLLVWLVLAYFASTRPGWFGCLLVLLVIVTLIVGGA*
Ga0070680_1017378582	3300005336	Corn Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGCFLVLLVIAVLIAGCA*
Ga0070687_1003811162	3300005343	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSKPGWFGALLVLLVIAILVAGCA*
Ga0070692_108087441	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVFLVIAVLIAGGA*
Ga0070714_1015083611	3300005435	Agricultural Soil	MAFALLAWITLLYFCSDKPGPFGCLLVLLVIAVLIAGCA*
Ga0070713_1011990142	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MAIALLVWVVLLYFCSHKPGPFGCLLVLLVIAVLIAGCVG*
Ga0070713_1019489942	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MAIELLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA*
Ga0070708_1014603152	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MSIAILAWLVLLYLFGSKPGWFGCLLVLLLVGILIAGCG*
Ga0066682_103775091	3300005450	Soil	MGVALLVWLVLVYLCSGKPGWFGCLLALLVIAVLITGCA*
Ga0066681_102802782	3300005451	Soil	MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLITGGA*
Ga0066681_103822872	3300005451	Soil	MAIALLVWMALLYLCSGRPGWFGCLFILLVAGIALKGCAG*
Ga0066681_106898392	3300005451	Soil	MGIALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA*
Ga0066687_101902521	3300005454	Soil	MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGCA*
Ga0066687_109362831	3300005454	Soil	MAIALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLITGCA*
Ga0068867_1017489662	3300005459	Miscanthus Rhizosphere	MCTFLLVWLVLAYFLVWLVLAYFVSSRPGWFGALLVLLVIAI
Ga0070706_1003753652	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MGFAILAWLMLLYLLSSRPGWFGCLLVLLVIGILVAGRG*
Ga0070706_1004122763	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	RRPRMGFVFLAGLVLLYLFSGKPGWFGCLIVLLIGILVAGR*
Ga0070707_1004301382	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MVVALLAWLVLLYLCSSKSGWFGCLFVLLLVGILVAGCG*
Ga0070707_1018991611	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MGVALLAWLVLLYLFSGKPGWFACLLVLLLVGILLAGCG*
Ga0070699_1004173311	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVVLAGLVLLYLFSSKPGPFGCLLVLLITGILVAGCA*
Ga0070697_1001983642	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MAIALLVWLVLLYFCSNKPGPFGCLLVLLITGILVAGCA*
Ga0070693_1011510232	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVILVIAILVAGCA*
Ga0070704_1022312572	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	RRPRMVVALLAWLVLLYLCSSKSGWFGCLFVLLLVGILVAGCG*
Ga0066661_106562872	3300005554	Soil	MSFALLAWLVLLYLFSSKPGWFACLLVLLVVGILIAGR*
Ga0066692_110177041	3300005555	Soil	GIGFLVWLVLLYLCSGKPGWFGCLLVLLVIVVLIAGCA*
Ga0066670_110175931	3300005560	Soil	MGIALLVWLVLLYFCSDKPGWFGWLLALLVIAVLITGCA*
Ga0066699_109294301	3300005561	Soil	MGVALLVWLVLLYLFSTKPGWFGCLLVLLLVGILLAGCG*
Ga0066693_100597151	3300005566	Soil	MGIALLVWLVLLYLCSGKPGWFGCLLALLVIAVLITGCA*
Ga0066705_104421531	3300005569	Soil	MAIALLVWLLLLYFCGNAPRRFGCLLALLFIAVLIAGCA*
Ga0066705_105515752	3300005569	Soil	MGIALLVWLVLLYLCSGKPGWFGCLLILLVIAVLIAGCA*
Ga0066705_106013191	3300005569	Soil	RRSGMAIALLVWLVLLYFCSNKPGWFGCLLVLLVIAVLIAGCA*
Ga0066702_107719102	3300005575	Soil	MGLAILAWLVLLCLFSSKPGVFACLLVLLVVGILVAGCG*
Ga0066708_100996272	3300005576	Soil	MAIALLVWLVLLYFWSDKPGWFGCLLILLVIAVLITGCA*
Ga0066708_101602153	3300005576	Soil	MGVALLVWLVLIYLLSSKPGWFGCLLVLLLVGTLIAGC*
Ga0066708_102088631	3300005576	Soil	MAIALLVWLVLIYFCSGKPGWFGCLLVLLVIAILITGCA*
Ga0066708_103132571	3300005576	Soil	MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLIAVCA*
Ga0066708_108332052	3300005576	Soil	MGIALLVWLVLLYFWSGKPGWFACVLVLLVVGILIAGC*
Ga0066691_103241362	3300005586	Soil	MAIAFLVWLVLLYSYSDKPGWFGYLLVLLVIAVLITGC*
Ga0070762_110621081	3300005602	Soil	MGIALLVWLLLLYFGSGKPGLFWCLLSLLVIGILIAGCG*
Ga0070763_105323531	3300005610	Soil	MGIALLVWLLLLYFGSGKSGLFWCLLVLLVVGILIAGCG*
Ga0068856_1016643682	3300005614	Corn Rhizosphere	MCTFILVWLVLAYFVSSKPSWFGCLFVLLVIAVLIAE*
Ga0068864_1012580641	3300005618	Switchgrass Rhizosphere	MCTFLLVWLVLAYFASTRPGWFGCLLVLLVIVTLVVGGA*
Ga0068863_1019801441	3300005841	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSKPGWFGALLVFLAIVILV
Ga0068860_1012641951	3300005843	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGCFLVLLVIAVLIAGCS*
Ga0068862_1007569102	3300005844	Switchgrass Rhizosphere	MCAFLLVWLVLAYFVNNKPGWFGALLVILVIAVLVAGCA*
Ga0070766_112336802	3300005921	Soil	LLVWLLLLYFGSGKPGLFWCLLSLLVIGILVAGC*
Ga0070717_111412612	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MAIALLVWLVLLYFCSKKPGWFGCLLVLLVIAVLIAGCA*
Ga0070717_119826132	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MAIALLVWLVLLYFCSNKPGCFGCLLVLLLVGVLIIGC*
Ga0066651_102758083	3300006031	Soil	MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIAVLITGCA*
Ga0066651_104429292	3300006031	Soil	MAIALLVWLLLLYFCGNTPRRFGCLLALLFIAVLIAGCA*
Ga0066651_108101921	3300006031	Soil	MAIALLVWLVLLYFCSDKPGWFGCLFILLVAGIALKGCAG*
Ga0066696_107244551	3300006032	Soil	IALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA*
Ga0066656_103969402	3300006034	Soil	MGIALLVWLVLLYLCSGKPGWFGCLLVLLVIGMLIVGCG*
Ga0066656_111286372	3300006034	Soil	MGIALLVWLVLLYLCSNRPGWFGCLLVLLLVGILIAGCG*
Ga0066652_1003494352	3300006046	Soil	MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGGA*
Ga0066652_1003692061	3300006046	Soil	MLCIAFLGWLVLLYFCSSKPGWFGCLLALLLVGIIL
Ga0066652_1016087522	3300006046	Soil	LVWLVLLYFCSDKPGWFGCLLILLVAGIALKGCAG*
Ga0070765_1003185092	3300006176	Soil	MGFAILAWLVLLYFFSSKPGVFACLLVLLVIGILIGGCG*
Ga0070765_1011510412	3300006176	Soil	MGFAILAWLILLYFFSSKPGVFACLLVLLFVGILLVGCG*
Ga0066653_106736701	3300006791	Soil	RRCGMAIALLVWLVLLYFCSDKPGWFGYLLILLVIAVLITGGA*
Ga0066658_103335141	3300006794	Soil	MAIALLVWLVLLYFCSDKPAWFGGLLVLLVIAVLITGCA*
Ga0066658_104993022	3300006794	Soil	MGIALLVWLVLLYLCSGKPGWLGCLLVLLVIAVLIAGCA*
Ga0066658_107696501	3300006794	Soil	MGLALLAWLVLLYLFNSKPGWFACLHVLLAIGVLVAGCG*
Ga0066665_110046812	3300006796	Soil	MGVALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA*
Ga0066659_106883521	3300006797	Soil	MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLIAGGA*
Ga0066659_108719592	3300006797	Soil	LVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGCA*
Ga0066660_103687921	3300006800	Soil	MGFAILAWLVLLYFFSSKPGWFACLLVLLVVGILVAGCG*
Ga0066660_103780481	3300006800	Soil	AIALLVWLVLLYFCSDKPGWFGCLLVLLVIGIFVAGC*
Ga0066660_115951062	3300006800	Soil	MAIALLVWLVLLYFCSDKPGWFGCLLILLVIAVLITGCA*
Ga0075425_1012679062	3300006854	Populus Rhizosphere	MAIALLVWLVLLYFCSDKPGWFGCRLVLLVIAVLVVGC*
Ga0099793_105756942	3300007258	Vadose Zone Soil	MGFALLAWLARLYLFSSKPGWFACLLVLLLVCILVAGCG*
Ga0099794_107492751	3300007265	Vadose Zone Soil	MGLAILAWLVLLYLFSGKPGWFACLLVLLLVGILIAGCG*
Ga0099795_101621722	3300007788	Vadose Zone Soil	MGVALLVWLVLLYLFSSKPGWFACLLVLLLVGILVAGC*
Ga0099795_103372221	3300007788	Vadose Zone Soil	MCLAILAWVVLLCLFISKHGWFGCLLVLLVIAVLITGCA*
Ga0066710_1005340621	3300009012	Grasslands Soil	MGVAILAWLVLLYLVSGKPGWFACLLVVLAIRILVAGCG
Ga0066710_1024762701	3300009012	Grasslands Soil	MAIAFLVWLVLLYSCSDKPGWFGCLLVLLVIAVLITGCA
Ga0066710_1041273161	3300009012	Grasslands Soil	MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLIAVCA
Ga0099829_112237902	3300009038	Vadose Zone Soil	MGFALLAWLVLLYLFSSKPGWFACLLVLLVVGILVAGCG*
Ga0099828_119262102	3300009089	Vadose Zone Soil	MGFALLAWLVLLYLFSGKPGWFACLLVLLVVGILVAGCG*
Ga0111539_102470855	3300009094	Populus Rhizosphere	MCTFLLVWLVLAYFVNNKLGWFGALVVLLVVAVLIAGCA*
Ga0111539_111618142	3300009094	Populus Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVVAVLIAGGA*
Ga0111539_117100331	3300009094	Populus Rhizosphere	MCTFLLVWLVLAYFVSSKAGWFGCLLVFLVIVTLVAGGA*
Ga0066709_1007870792	3300009137	Grasslands Soil	MAIALLVWLVLLYFCSNKSGWFGGLLVLLVIAVLIAGCA*
Ga0066709_1016813502	3300009137	Grasslands Soil	MGFAILAWLLLLYLFSSKPGVFACLLVLLVVGILVAGCG*
Ga0066709_1038576732	3300009137	Grasslands Soil	MGIGLLVWLVLLYLCSDKPAWFGCLLVLLVIGVLIAGC*
Ga0099792_105814502	3300009143	Vadose Zone Soil	MAIALLVWLVLLYFCSNKPGLFGCLLVLLVIAVLIAGCA*
Ga0099792_109506691	3300009143	Vadose Zone Soil	MGFAILAWLVLLYLFSSKPGWFACLLVLLVVGILVGGCG*
Ga0105243_122114832	3300009148	Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSTKPGWFGALLVLLVIAVLIAGCA*
Ga0111538_116704081	3300009156	Populus Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAVLIAG
Ga0111538_123577492	3300009156	Populus Rhizosphere	MCTFLLVWLLLAYFVSSRPGWFGALLVLLVIAILVAGCT*
Ga0111538_139548361	3300009156	Populus Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAILVAGGA*
Ga0105242_112711732	3300009176	Miscanthus Rhizosphere	MCTFLLVWLVLVYFVSSKPGWFGALLVFLAIAILVAGCA*
Ga0105242_117350911	3300009176	Miscanthus Rhizosphere	MCTFLLVWLVLAYFVNNKPGWFGALLVLLVVAVLIAGGA*
Ga0105248_113020711	3300009177	Switchgrass Rhizosphere	MCAFLLVWLVLAYFVSSKPGWFGALLVLLVIVALIVGGA*
Ga0105249_104937433	3300009553	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVNNKLGWFGALLVILVIAVLVAGCA*
Ga0127465_10800292	3300010118	Grasslands Soil	MGFAILAWLVLLYLFSSKPGWFACLLVILVIGVLIAGC*
Ga0099796_100110973	3300010159	Vadose Zone Soil	MGFALLVWLVLLYLFSSKPGWFGCLLVLLLVGILLAGCG*
Ga0126306_111681041	3300010166	Serpentine Soil	MCIAILVWLLLAYVLSSKLGWFACLLVLLVVSILLAGCG*
Ga0134082_102616701	3300010303	Grasslands Soil	MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAILITGCA*
Ga0134109_101562911	3300010320	Grasslands Soil	MAIALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA*
Ga0134067_104963362	3300010321	Grasslands Soil	MGIALLVWLVLVYFCSSKPGWFGCLLVLLVIAVLIAGCA*
Ga0134064_103085732	3300010325	Grasslands Soil	MAIALLVWLMLLYFCSDKPGWFGCLLVLLVIAILITGCA*
Ga0134065_100252291	3300010326	Grasslands Soil	MGIALLVWLVLLYSCSDKPGWFGCLLVLLVIAVLIAVCA*
Ga0134065_103201762	3300010326	Grasslands Soil	MAVALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA*
Ga0134080_106220642	3300010333	Grasslands Soil	MGIAFLVWLVLVYLCSGKPGWFGCLLVLLVIAVLIAGCA*
Ga0134063_104539921	3300010335	Grasslands Soil	MGFVFLTGLVLLYLCSSKPGGFACLFVLLVGILVAGCG*
Ga0134062_103906472	3300010337	Grasslands Soil	MGVALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGCA*
Ga0134062_105304671	3300010337	Grasslands Soil	MGIALLVWLVLLYFCSNKPGWFGCLLGLLVIAVLITGCA*
Ga0134066_100930682	3300010364	Grasslands Soil	MAVALLVWLVLLYFWSGKPGWFACVLVLLVVGILIAGC*
Ga0134128_104266972	3300010373	Terrestrial Soil	MCTFLLVWLVLAYFVSAKPGWLGCLLVLLVVAILIAGCA*
Ga0134128_112508492	3300010373	Terrestrial Soil	MAIAFLAWLVLLYFYSDKPGPFGCLLVLLVIAVLIAGCA*
Ga0134128_113170672	3300010373	Terrestrial Soil	MCTFLLVWLVLAYFVSSRQGQFGALLVLLVIAILIAGYA*
Ga0105239_117991891	3300010375	Corn Rhizosphere	VTCTFLLVWLVLAYFASSRPSWFGALLVILVIAVL
Ga0134124_126916451	3300010397	Terrestrial Soil	MCTFLLVWLVLAYVVSSKPGWFGCLLVILAIAVLIAGCA*
Ga0134124_131505401	3300010397	Terrestrial Soil	MCTFLPVWLVLAYFVSSRPGWFGCLLVLLVIAVLIAGGA*
Ga0134127_128895901	3300010399	Terrestrial Soil	MCTFLLVWLLLAYFVSSKPGWFGALLVLLAIVILVAGCA*
Ga0134122_102801942	3300010400	Terrestrial Soil	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAILGAGWA*
Ga0134121_124487322	3300010401	Terrestrial Soil	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAVLIAGCV*
Ga0134123_125198762	3300010403	Terrestrial Soil	MCTFLLVWLVLAYFLVWLVLAYFVSSKPGWFGALLVLLVVAILILGGA*
Ga0137393_110643662	3300011271	Vadose Zone Soil	MGFAIVAWLVLLYLFSSKPGWFACLLVLLLVGILVAGCG*
Ga0137389_107802522	3300012096	Vadose Zone Soil	MGLALLAWLVLLYLCSSKPGWFACLLVLLVVGILVAGCG*
Ga0153943_11499742	3300012177	Attine Ant Fungus Gardens	MWTALLCWLALLYLLRSKPGWFGCLLVLLAVCVLIAGCG*
Ga0137388_108372601	3300012189	Vadose Zone Soil	MGFAILAWLVLLYLFSGKPGWFACLLVLLVIGILIAGCG*
Ga0137383_105041052	3300012199	Vadose Zone Soil	MAIALLVWLVLIYFCSGKPGWFGCLLVLLVIVVLIAGCA*
Ga0137382_100818002	3300012200	Vadose Zone Soil	MAIALLVWLVLLYFCSDKHGWFGCLLVLLVIAVLIAVCA*
Ga0137382_104470251	3300012200	Vadose Zone Soil	MAIAFLVWLVLLYFCSDKPGWFGCLLILLVIAVLITGCA*
Ga0137363_101132283	3300012202	Vadose Zone Soil	MGIALLVWLVLLYLCSSKPGSFGCLLVLLVIAVLITGCA*
Ga0137399_111502062	3300012203	Vadose Zone Soil	MAIALLVWLVLLYFCSNKPGWFGCLLVLLVIAVLITGCA*
Ga0137362_107150201	3300012205	Vadose Zone Soil	ALLVWLVLIYFCSSKPGWFGCLVVLLVIAVLIAGCA*
Ga0137376_100175457	3300012208	Vadose Zone Soil	MAIALLVWLVLLYFCSDKHGWFGCILVLLVIAVLITGCA*
Ga0137376_104609242	3300012208	Vadose Zone Soil	MAIALLVWLVLLYFCSNKPSWFGCLLVLLFLAVLIAGCA*
Ga0137376_105587112	3300012208	Vadose Zone Soil	MAIALLVWLVLVYLCSSKPGWVGCLLALLVIAVLITGCA*
Ga0137376_107436322	3300012208	Vadose Zone Soil	MGVAIIAWLVLLYLFSSKPGWFACLLVLLLVGILVAGCG*
Ga0137378_103532781	3300012210	Vadose Zone Soil	MAIALLVWLVLLYFCSNKPGWFGCLLVLLVIAVLIAGCA*
Ga0137377_100227986	3300012211	Vadose Zone Soil	MGVALLVWLVLLYFCSDKPGWFGCLLILLVIAILITGCA*
Ga0137377_115074972	3300012211	Vadose Zone Soil	MAIAFLVWLVLLYFCSDKPGWFGCLLILLVIAVLIAGCA*
Ga0137377_115430772	3300012211	Vadose Zone Soil	MGIALLVWLLLLYFGSGKPGLFWCLLSLLLVGILVAGCG*
Ga0137377_118783522	3300012211	Vadose Zone Soil	MGFAILAWLVLLYLFSSKPGWFGCLLVLLLVGILVAGCG*
Ga0150985_1220178301	3300012212	Avena Fatua Rhizosphere	MCTILLVWLVLAYIVSSKPGWFGCLLVLLAIAVLIAGCA*
Ga0137370_101458741	3300012285	Vadose Zone Soil	LLVWLVLLYFCSDKPGWFGCLLTLLVIAVLITGCA*
Ga0137370_102568772	3300012285	Vadose Zone Soil	MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLIAGCA*
Ga0137370_104393841	3300012285	Vadose Zone Soil	MHIAFLVWLVLVYLCSSKPGWFGCLLVLLVIAVLITGCA*
Ga0137370_107319041	3300012285	Vadose Zone Soil	MAIAVLVWLVLLYVCCDKLAWFGCLLVLLVISALFTGC
Ga0137367_101717392	3300012353	Vadose Zone Soil	MGLAILAWLVLLYLFSSKPGWFACLLVLLLVGILVAGCG*
Ga0137366_103388672	3300012354	Vadose Zone Soil	MGLAILAWLVLLYPFSSKPGWFACLLVLLLVGILVAGCG*
Ga0137384_109896602	3300012357	Vadose Zone Soil	MDVAILAWLVLLYLFSSKPGWFACLLVLLLVVGILIAGCG*
Ga0150984_1019041171	3300012469	Avena Fatua Rhizosphere	MCTFVLVWMVLAWFVSSKPGWFGCLLVLLAIAILVAGGA*
Ga0150984_1041888301	3300012469	Avena Fatua Rhizosphere	PAMCTFLLVWLVLAYFVSSKPGWFGCLLVLLVIAVLIAGCA*
Ga0137373_101686751	3300012532	Vadose Zone Soil	MGLALLAWLVLLYLFSSKPGWFACLLVLLVVGILIAGCG*
Ga0137358_104878681	3300012582	Vadose Zone Soil	MGFAILVWLVLLYLSSSKPGWFGCLLVLLLVAILVAGCG*
Ga0137358_107572301	3300012582	Vadose Zone Soil	AILAWLVLLYLFRGKPGVFACLLVVLVIGTLVAGCG*
Ga0137398_100172372	3300012683	Vadose Zone Soil	MGFVILAWLVLLYLFSSKPGWFACLLVLLLVSILVAGCG*
Ga0137398_102715412	3300012683	Vadose Zone Soil	MGIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLIAGCA*
Ga0137398_112635422	3300012683	Vadose Zone Soil	MGFALLVWLVLLYLFSSKPGWFACLLVLLVVGILLAGCG*
Ga0157301_103207662	3300012911	Soil	MCTFLLVWLVLAYFVSSRPGWFGCLLVLLVIVTLVVGGA*
Ga0137395_106859112	3300012917	Vadose Zone Soil	MGLAILAWLVLLYLFSSKPGWFACLFVLLVVGILVAGCG*
Ga0137359_109548412	3300012923	Vadose Zone Soil	MGVALLAWLMLLYLFSSKPGWFACLLVLLVVGILVAGCG*
Ga0137413_105245942	3300012924	Vadose Zone Soil	MGFALLVWLVLLYLFSSKPGWFGCLLVVLLLVGILLAGCG*
Ga0137413_115383541	3300012924	Vadose Zone Soil	MAIALLVWLVLLYFCSDKPGWFGCLLTLLVIAVLITGCA*
Ga0137419_103679811	3300012925	Vadose Zone Soil	RRSRMGFALLAWLVLLYLFSSKPGWFACLLVLLLVGILVAGC*
Ga0137419_108247152	3300012925	Vadose Zone Soil	MGFALLAWLILLYFFNSKPGVFACLLVLLVVGILVAG*
Ga0137419_109989373	3300012925	Vadose Zone Soil	MGFALLVWLVLLYLFSSKPGWFGCLLVLLLVGILIAGCG*
Ga0137416_107036452	3300012927	Vadose Zone Soil	MGFAILAWLALLYLFSSKPGWFACLLVLLVVGILIAGC*
Ga0137416_111255021	3300012927	Vadose Zone Soil	GVAFLAWLMLLYFCSSKPGWFGCLLVLLVIGILVAGCA*
Ga0137416_118391741	3300012927	Vadose Zone Soil	MGLAILAWLVLLYLFSSKPGWFGCLVVLLLVGILVAGCG*
Ga0137404_112855452	3300012929	Vadose Zone Soil	MGLALLVWLVLLYLFSSKPGWFACLLVLLVIGILVAGCG*
Ga0134087_108005562	3300012977	Grasslands Soil	GMAIALLVWLVLLYFWSNKPGWFGCLLILLVIAVLITGCA*
Ga0164309_117869652	3300012984	Soil	MCTFLRVWLVLAYVVSSKPGWFEALLVLLVIAVLVVGCA*
Ga0164307_104613233	3300012987	Soil	MCTFLLVWLVLAYFVSSRPGWFGALLVFLVIVTLIVGGA*
Ga0164305_108825652	3300012989	Soil	MCTFLLVWLVLAYFVSSKPGWFGCLLVLLVIAILVAGCA*
Ga0157374_119030472	3300013296	Miscanthus Rhizosphere	MCTSVLVWLVLAYFVSSRPGWFGALLVLLAMVILVAGCA*
Ga0163162_116582722	3300013306	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSRQGRFGALLVLLVIAILIAGCA*
Ga0157372_133233751	3300013307	Corn Rhizosphere	MCTFLLVWLVLAYFVSSKPGWFGCLLVLLVVAVLVAGCA*
Ga0134079_103119421	3300014166	Grasslands Soil	MAIALLVWLVLLYFCSDKPGWFECLLVLLVIAVLITGCA*
Ga0134079_106626441	3300014166	Grasslands Soil	MGVTLLVWLVLLYLLGGKPGWFGCLVVLLVIAVPFAGCA*
Ga0134079_107036932	3300014166	Grasslands Soil	MAIALLVWLVLLYFCSDKPGWFGCLLVLLVVSILITGC*
Ga0163163_127379121	3300014325	Switchgrass Rhizosphere	MCTFLLVWLVLAYVVSSKPGWFGALLVLLAIAILIAGCA*
Ga0157380_102627063	3300014326	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSKPGSFGAFLVLLVIAVLIAGGA*
Ga0157377_101523792	3300014745	Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSSKPGWFGALLVLLVIVTLVAGGA*
Ga0157376_115406451	3300014969	Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGCLLVPLVIVTLVAGGA*
Ga0173480_104298292	3300015200	Soil	MCTFLLVWLVLAYFVSSKPGWFGALLVLLVIAVLIAGCA*
Ga0137418_100260143	3300015241	Vadose Zone Soil	MCFAILAWLMLLYLFSSKPGWFACLLVLLVVGILVAGC*
Ga0182007_101949101	3300015262	Rhizosphere	MCTFLLVWLVLVYFVSAKPGWLGCLLVLLVVAILIAGCA*
Ga0132256_1020911801	3300015372	Arabidopsis Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVVALLIAGGA*
Ga0132257_1028599631	3300015373	Arabidopsis Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVVAVLIAGCA*
Ga0132255_1050697052	3300015374	Arabidopsis Rhizosphere	MCTFLLVWLVLAYFASSRPSWFGCLLVLLIIVTLVVGGA*
Ga0134069_11583081	3300017654	Grasslands Soil	MGFVFLAGFVLLYLFSSKPGWFGCLLVILVVGILIT
Ga0163161_102174043	3300017792	Switchgrass Rhizosphere	MSAFLLVWLVLAYFVSNRPGWFGCLLVLLVIVTLVAGGA
Ga0163161_116351602	3300017792	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIAVLIAGCA
Ga0184619_100289884	3300018061	Groundwater Sediment	MGVAIIAWLVLLYLFSSKPGWFACLLVLLVVGILVAGCG
Ga0066655_104601572	3300018431	Grasslands Soil	MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIAVLITGCA
Ga0066655_107784911	3300018431	Grasslands Soil	MGFAILAWLVLLYLFSSKPGVFACLLVVLVVGILIAGCG
Ga0066655_113077631	3300018431	Grasslands Soil	MAIALLVWLVLLYFCSDKPGWFGCLLILLVIAVLITGGA
Ga0066667_102528352	3300018433	Grasslands Soil	MAIALLVWLMLLYFCSDKPGWFGCLLVLLVIAVLIAGCA
Ga0066667_106916422	3300018433	Grasslands Soil	MGFAILAWLVLLYLFSSKPGWFACLLVILVIGVLIAGC
Ga0066667_109306822	3300018433	Grasslands Soil	MGFAILAWLLLLYLFSSKPGVFACLLVLLVVGILVAGCG
Ga0066667_111476761	3300018433	Grasslands Soil	MGVALLVWLVLVYLCSGKPGWFGCLLALLVIAVLITGCA
Ga0066662_109201752	3300018468	Grasslands Soil	MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIAVLITGSA
Ga0066669_101629953	3300018482	Grasslands Soil	MGIAFLVWLVLVYLCSSKPGWFGCLLALLVIVLITGCA
Ga0066669_101890992	3300018482	Grasslands Soil	MAIALLVWLLLLYFCGNTPRRFGCLLALLFIAVLIAGCA
Ga0066669_103154062	3300018482	Grasslands Soil	MGVALLVWLVLIYLLSSKPGWFGCLLVLLLVGTLIAGC
Ga0066669_103889792	3300018482	Grasslands Soil	MAIALLVWMALLYLYSGRPGWFGCLFILLVAGIALKGCAG
Ga0066669_104971412	3300018482	Grasslands Soil	MGIALLVWLVLIYFCSGKPGWFGCLVVLLVIAVLIAGCA
Ga0066669_109945782	3300018482	Grasslands Soil	MAIALLVWLVLLYFCSNKPGPFGCLLVLLVIAVLIAGCA
Ga0066669_114736752	3300018482	Grasslands Soil	MAIALLVWLVLLYFWSDKPGWFGCLLVLLVIAVLITGGA
Ga0066669_115490671	3300018482	Grasslands Soil	MAIAFLVWLVLLYSCSDKPGWFGCLLVLLVIAVLITGC
Ga0173479_106340962	3300019362	Soil	MCTFLLVWLVLAYVVSTKPGWFGALLVLLVFAVLIAGCA
Ga0210401_104476573	3300020583	Soil	MGIALLVWLLLLYFGSGKSGLFWCLLVLLVVGILIAGCG
Ga0210401_107650841	3300020583	Soil	VAVLAWLVLPYLFSSKPGWFACLLVLLLIGILVAGCG
Ga0210401_109788512	3300020583	Soil	MGFALLAGLALLYFFSSKPSVFACLLVLLFVGILVAGC
Ga0210400_100526132	3300021170	Soil	MGAALLVWLVLLYLFSSKPGWFGCLLLLVGTLIAGCAPSV
Ga0210400_100780403	3300021170	Soil	MGFAILVWLVLLYLCSSKPGWFGCLLVVLLVGILIAGCG
Ga0210400_107583512	3300021170	Soil	MGVALLVWLVLLYLCSSKPGWFGCLLVLLLVGILIAGCG
Ga0210400_112209441	3300021170	Soil	MGIVFLAGLVLLYLFSSKPGWFGCLLVLLVVSILIAGCG
Ga0213873_101746271	3300021358	Rhizosphere	MAIALLVWLVLLYFCSNKPGWFGCLLVLLVIGVLVAGC
Ga0210394_112187391	3300021420	Soil	MGFAILAWLVLLYFFSSKPGWFACLLVLLVVGILIAGCG
Ga0212123_100502893	3300022557	Iron-Sulfur Acid Spring	RPRMGIALLVWLMLLYLCSGKPGWFGCLLVLLIVGILIAECG
Ga0207642_107385432	3300025899	Miscanthus Rhizosphere	MCTFLLVWLVLAYFASGRPGWFGCLLVLLVIAVLVVGGA
Ga0207688_104341331	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MCTFLPVWLVLAYFVSSRPGWFGCLLVLLVIAVLIAGGA
Ga0207643_101292612	3300025908	Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGCLLVLLAMAILIAGGA
Ga0207684_101068532	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVVLAGLVLLYLFSAKPGWFACLLVLLLVGILVAGC
Ga0207684_101751922	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	RSWMGFVFIAGLVLLYLFSSKPGWFGCLLVLLVVGILVAGC
Ga0207684_103079323	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVFLAGLVLLYLFSSKPAWFVSLIVLLVVGILVAGC
Ga0207684_103899052	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MGIALLVWLVLLYLFSSKPGWFGCLLVLLVVSLLIAGC
Ga0207684_104354312	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVFLAGLVLLYLFSSKPGWFGCLLVLLLVGILVAGCG
Ga0207684_106781151	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVFLAGLALLYLFSSKPGWFGCLVVLLIGILVAGC
Ga0207684_111622812	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MAFALLAWLVLLYLLSSKPGWFACLLVLLLVGVLIAGC
Ga0207684_116302411	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MAIALLVWLVLLYFCSNKPGCFGCLLVLLLVGVLIIGC
Ga0207662_101605592	3300025918	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVIVTLVVGGA
Ga0207646_100080013	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVVLAGLVLLYLFSGKPGSFGCLLVLLITGILVAGCV
Ga0207646_100151459	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MAFALLAWLVLLYLLSSKPGWFASLLILLVGILVAGC
Ga0207646_100184403	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVFLAGLVLLYLFSSKPGWFACLIVLLVGILVAGY
Ga0207646_100199463	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVFLAGLALLYLVNSKPGWFGCLLVLLVVGILVAGC
Ga0207646_100802202	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVFLAGLVLLYLFSSKPGWFGCLLVLLVVGILVAGC
Ga0207646_112585301	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MGFVFLAGLVLLYLFSGKPGWFGCLIVLLIGILVAGR
Ga0207646_116706512	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MGVALLAWLVLLYLFSGKPGWFACLLVLLLVGILLAGCG
Ga0207659_115853551	3300025926	Miscanthus Rhizosphere	LLVWLVLAYIVSSRPGWFGALLVLLVIVALVAGGA
Ga0207659_118692581	3300025926	Miscanthus Rhizosphere	MCTFLLVWLVLAYIVSSRPGWFGALLVLLVIVALVAGGA
Ga0207687_103614141	3300025927	Miscanthus Rhizosphere	MSAFLLVWLVLAYFVSNRPGWFGCLLVLLVIVTLVVGGA
Ga0207664_106923122	3300025929	Agricultural Soil	MAIFLLAWLMLLYFCSNKPGPFGCLLVLLVIAVLVVGC
Ga0207701_105428361	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVLLVTAVLIAGCA
Ga0207690_115563962	3300025932	Corn Rhizosphere	MCTFLLVWLVRAYFVSSRPSWFGCLLVLLAIAILVAGCA
Ga0207686_118025442	3300025934	Miscanthus Rhizosphere	MCTFLLVWLVLVYFVSSKPGWFGALLVFLAIAILVAGCA
Ga0207670_108886012	3300025936	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSNRPGWFGCLLVLLVIAVLIAGGA
Ga0207689_115026851	3300025942	Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSSKPGWFGALLVFLAIVILVAGCA
Ga0207677_106051693	3300026023	Miscanthus Rhizosphere	MCTFLLVWLVLAYFVSSRRGWFGCLLVLLVIVTLVAGGA
Ga0207702_109722242	3300026078	Corn Rhizosphere	MCTFLLVWLVLAYIVSSRPGWFGALLVILVVAILIAGCA
Ga0207641_115095381	3300026088	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSRPGWFGALLVILVIAVLVAGCA
Ga0207674_105789062	3300026116	Corn Rhizosphere	MCTFLLVWLVLAYFVSSKPSWFGALLVLLAIAILIAGCA
Ga0209055_12147102	3300026309	Soil	MTIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLITGCA
Ga0209153_11162902	3300026312	Soil	MSVALLVWLVLLLSSKPGWFGCLLVLLLVGTLIAGC
Ga0209155_10628483	3300026316	Soil	MLCIAFLGWLVLLYFCSSKPGWFGCLLALLLVGIILAGCG
Ga0209154_12074091	3300026317	Soil	MAIALLVWLVLLYFCSDKPGWFGCLLVLLVIAVLI
Ga0209472_12196752	3300026323	Soil	MGIAFLVWLVLVYLCSSKPGWFGCLLVLLVIAVLIAGCA
Ga0209473_12740732	3300026330	Soil	MAIALLVWLLLLYFCSNKPGPFGCLLVLLVIAILITGCA
Ga0209473_12772722	3300026330	Soil	MAIALLVWLVLIYFCSGKPGWFGCLVVLLVIAVLIAGCA
Ga0209807_11815853	3300026530	Soil	MGVALLVWLVLLYLCSGKPGWFGCLLILLVIAVLIAGCA
Ga0209161_101178542	3300026548	Soil	MAIALLVWLVLLYFWSDKPGWFGCLLILLVIAVLITGCA
Ga0209474_101558392	3300026550	Soil	MAIALLVWLVLLYFWSGKPGWFACVLVLLVVGILIAGC
Ga0179587_102795002	3300026557	Vadose Zone Soil	MGFALLVWLVLLYLFSSKPGWFACLLVLLVVGILVAGCG
Ga0209179_11477531	3300027512	Vadose Zone Soil	MGVALLVWLVLLYLFSSKPGWFGCLLVLLVIAVLIAGCA
Ga0208984_10487572	3300027546	Forest Soil	MGIALLVWLVLLYLCSSKPGSFGCLLVLLLIGIIVAGCG
Ga0209219_10954422	3300027565	Forest Soil	MGFVTLACLLLLYISSGKPGLFWCLLSLLVISILVAGCG
Ga0208990_100072211	3300027663	Forest Soil	MGVALLVWLVLLYLFSSKPGWFACLLVLLVVGILVGGCG
Ga0208981_10363612	3300027669	Forest Soil	MGFALLVWLVLLHLFSSKPGWFGCLLVLLVIGILVAGCA
Ga0208991_10261932	3300027681	Forest Soil	MGFAILGWLVLLYLFSSKPGWFACLLVLLLVGILIAGCV
Ga0208989_100011608	3300027738	Forest Soil	MGFALLVWLVLLYLFSSKPGWFGCLLVLLVIGILVAGCA
Ga0209488_103417232	3300027903	Vadose Zone Soil	MGVALLVWLVLLYLCSGKPGWFGCLLALLVIAVLITGCA
Ga0207428_103669892	3300027907	Populus Rhizosphere	MCTFLLVWLVLAYFVSSKAGWFGCLLVFLVIVTLVAGGA
Ga0209526_108507392	3300028047	Forest Soil	MCFAILAWLVLLYLFASKPGWFACLLVLLVVGILVAGC
Ga0209526_109576582	3300028047	Forest Soil	MGVALLAWLLLLCLFSSKPGWFACLLVLLVVGILVAGCG
Ga0268265_116445402	3300028380	Switchgrass Rhizosphere	MCTFLLVWLVLAYFVSSKPGWFGCLLVILVVAVLIVGGA
Ga0137415_101537231	3300028536	Vadose Zone Soil	MGFAILAWLALLYLFSSKPGWFACLLVLLLVCILVAGCG
Ga0137415_109255961	3300028536	Vadose Zone Soil	MGFAILAWLVLLYLFSSKPGWFGCLVVLLLVGILVAGCG
Ga0308309_116866662	3300028906	Soil	MGFAILAWLILLYFFSSKPGVFACLLVLLFVGILLVGCG
Ga0222749_103997981	3300029636	Soil	MGIALLVWLLLLYFGSGKPGLFWCLLSLLVIGILIAGCG
Ga0307469_118333662	3300031720	Hardwood Forest Soil	MGFVFLAGLVLLYLLSSKPGWFGCLLVILVVGILVAGC
Ga0307473_108816912	3300031820	Hardwood Forest Soil	ETSMSIAILASLVLLYLFSSKPGWFGCLLVILVVGILVAGCG
Ga0310904_111380352	3300031854	Soil	MCTFLLVWLVLAYFVSSRQGRFGALLVLLVIAILIAGCA
Ga0307479_102580961	3300031962	Hardwood Forest Soil	MGIALLAWLVLLYLFSGNPGWFACLLVLLLIGILVAGCR
Ga0307479_120054072	3300031962	Hardwood Forest Soil	MGFAILAWLVLLYLFSSKPGWFACLLVLLVVGILIAGCG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F010698

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences