NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F011820

Metatranscriptome Family F011820

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F011820
Family Type Metatranscriptome
Number of Sequences 286
Average Sequence Length 164 residues
Representative Sequence WVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPIDQKKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Number of Associated Samples 174
Number of Associated Scaffolds 286

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.05 %
% of genes near scaffold ends (potentially truncated) 94.41 %
% of genes from short scaffolds (< 2000 bps) 99.65 %
Associated GOLD sequencing projects 153
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.650 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(71.329 % of family members)
Environment Ontology (ENVO) Unclassified
(87.762 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(85.664 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.69%    β-sheet: 4.37%    Coil/Unstructured: 63.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.65 %
UnclassifiedrootN/A0.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10227181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata926Open in IMG/M
3300008832|Ga0103951_10258057All Organisms → cellular organisms → Eukaryota → Sar881Open in IMG/M
3300008832|Ga0103951_10355455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata770Open in IMG/M
3300008832|Ga0103951_10513138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata649Open in IMG/M
3300008832|Ga0103951_10811035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300008834|Ga0103882_10014430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata889Open in IMG/M
3300008834|Ga0103882_10022345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata796Open in IMG/M
3300008835|Ga0103883_1019097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300008835|Ga0103883_1027594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata671Open in IMG/M
3300008931|Ga0103734_1004528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1674Open in IMG/M
3300008932|Ga0103735_1078784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300008933|Ga0103736_1030353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata701Open in IMG/M
3300008938|Ga0103741_1080495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata648Open in IMG/M
3300008998|Ga0103502_10268283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata628Open in IMG/M
3300009006|Ga0103710_10086217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata764Open in IMG/M
3300009022|Ga0103706_10089103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra697Open in IMG/M
3300009025|Ga0103707_10109242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata600Open in IMG/M
3300009028|Ga0103708_100262044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata533Open in IMG/M
3300009028|Ga0103708_100319023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300009195|Ga0103743_1038603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata699Open in IMG/M
3300009195|Ga0103743_1069141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300009216|Ga0103842_1005985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata907Open in IMG/M
3300009272|Ga0103877_1003341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata750Open in IMG/M
3300009272|Ga0103877_1004844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata700Open in IMG/M
3300009276|Ga0103879_10008065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata770Open in IMG/M
3300009276|Ga0103879_10024580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata619Open in IMG/M
3300009279|Ga0103880_10023178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata740Open in IMG/M
3300009402|Ga0103742_1025506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra749Open in IMG/M
3300010981|Ga0138316_10638341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata673Open in IMG/M
3300010981|Ga0138316_11162844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300010987|Ga0138324_10301726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata766Open in IMG/M
3300010987|Ga0138324_10506192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra599Open in IMG/M
3300018526|Ga0193100_101681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata792Open in IMG/M
3300018526|Ga0193100_102913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata669Open in IMG/M
3300018526|Ga0193100_102955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata666Open in IMG/M
3300018526|Ga0193100_103244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata644Open in IMG/M
3300018555|Ga0193296_102082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata788Open in IMG/M
3300018555|Ga0193296_103030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata673Open in IMG/M
3300018568|Ga0193457_1008964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300018585|Ga0193221_1006964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300018588|Ga0193141_1008085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata764Open in IMG/M
3300018588|Ga0193141_1014263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300018592|Ga0193113_1014455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata825Open in IMG/M
3300018592|Ga0193113_1016693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata773Open in IMG/M
3300018592|Ga0193113_1019426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata718Open in IMG/M
3300018592|Ga0193113_1022617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300018594|Ga0193292_1014625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata573Open in IMG/M
3300018608|Ga0193415_1019208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata577Open in IMG/M
3300018616|Ga0193064_1004368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1041Open in IMG/M
3300018616|Ga0193064_1011021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata779Open in IMG/M
3300018622|Ga0188862_1031547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300018628|Ga0193355_1015590All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata703Open in IMG/M
3300018635|Ga0193376_1012562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata727Open in IMG/M
3300018635|Ga0193376_1017482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300018636|Ga0193377_1009472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra794Open in IMG/M
3300018636|Ga0193377_1013717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata680Open in IMG/M
3300018636|Ga0193377_1020535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300018637|Ga0192914_1019223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300018643|Ga0193431_1012849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata843Open in IMG/M
3300018648|Ga0193445_1044970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300018649|Ga0192969_1038804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata706Open in IMG/M
3300018651|Ga0192937_1028314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata658Open in IMG/M
3300018653|Ga0193504_1030317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300018657|Ga0192889_1045185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300018657|Ga0192889_1048767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata597Open in IMG/M
3300018659|Ga0193067_1031522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata794Open in IMG/M
3300018659|Ga0193067_1050334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300018661|Ga0193122_1028510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata823Open in IMG/M
3300018661|Ga0193122_1042653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300018662|Ga0192848_1018109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata805Open in IMG/M
3300018662|Ga0192848_1020684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata761Open in IMG/M
3300018662|Ga0192848_1042399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300018668|Ga0193013_1051730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata562Open in IMG/M
3300018674|Ga0193166_1019934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata598Open in IMG/M
3300018675|Ga0193384_1022191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata679Open in IMG/M
3300018684|Ga0192983_1025627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata800Open in IMG/M
3300018684|Ga0192983_1032035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata723Open in IMG/M
3300018691|Ga0193294_1008503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1145Open in IMG/M
3300018691|Ga0193294_1017254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra828Open in IMG/M
3300018691|Ga0193294_1023384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata711Open in IMG/M
3300018691|Ga0193294_1028653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra640Open in IMG/M
3300018698|Ga0193236_1046564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300018707|Ga0192876_1068510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300018711|Ga0193069_1017616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata777Open in IMG/M
3300018711|Ga0193069_1018263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata766Open in IMG/M
3300018711|Ga0193069_1018639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata761Open in IMG/M
3300018711|Ga0193069_1028480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata649Open in IMG/M
3300018711|Ga0193069_1052355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300018713|Ga0192887_1037827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra644Open in IMG/M
3300018713|Ga0192887_1038490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra638Open in IMG/M
3300018718|Ga0193385_1024152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata719Open in IMG/M
3300018718|Ga0193385_1024649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata712Open in IMG/M
3300018733|Ga0193036_1055204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300018733|Ga0193036_1062591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300018734|Ga0193290_1011219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra979Open in IMG/M
3300018738|Ga0193495_1047222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata573Open in IMG/M
3300018739|Ga0192974_1056075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra664Open in IMG/M
3300018739|Ga0192974_1067136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata589Open in IMG/M
3300018740|Ga0193387_1042173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata660Open in IMG/M
3300018740|Ga0193387_1059903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300018741|Ga0193534_1044440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300018741|Ga0193534_1044804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata679Open in IMG/M
3300018741|Ga0193534_1044940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata678Open in IMG/M
3300018743|Ga0193425_1035027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra692Open in IMG/M
3300018747|Ga0193147_1046430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata737Open in IMG/M
3300018758|Ga0193058_1070773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300018764|Ga0192924_1026683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata696Open in IMG/M
3300018769|Ga0193478_1063901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300018776|Ga0193407_1053360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300018777|Ga0192839_1071611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra536Open in IMG/M
3300018780|Ga0193472_1019207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata743Open in IMG/M
3300018780|Ga0193472_1029520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300018782|Ga0192832_1031348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra706Open in IMG/M
3300018782|Ga0192832_1051030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300018793|Ga0192928_1022646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1113Open in IMG/M
3300018793|Ga0192928_1031098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra960Open in IMG/M
3300018793|Ga0192928_1050303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata746Open in IMG/M
3300018794|Ga0193357_1036129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata807Open in IMG/M
3300018794|Ga0193357_1036222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata806Open in IMG/M
3300018794|Ga0193357_1036337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata805Open in IMG/M
3300018794|Ga0193357_1057580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300018794|Ga0193357_1062896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra614Open in IMG/M
3300018796|Ga0193117_1046417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata734Open in IMG/M
3300018802|Ga0193388_1035282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra799Open in IMG/M
3300018802|Ga0193388_1066001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300018804|Ga0193329_1091798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300018807|Ga0193441_1020405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra1128Open in IMG/M
3300018820|Ga0193172_1043088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata769Open in IMG/M
3300018823|Ga0193053_1056244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300018837|Ga0192927_1014812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1109Open in IMG/M
3300018837|Ga0192927_1055664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata617Open in IMG/M
3300018837|Ga0192927_1061618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300018844|Ga0193312_1073576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300018845|Ga0193042_1154172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300018850|Ga0193273_1038173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata680Open in IMG/M
3300018865|Ga0193359_1075527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata643Open in IMG/M
3300018865|Ga0193359_1102610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300018867|Ga0192859_1033385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata808Open in IMG/M
3300018867|Ga0192859_1037322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata772Open in IMG/M
3300018867|Ga0192859_1063404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata607Open in IMG/M
3300018882|Ga0193471_1068348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata679Open in IMG/M
3300018883|Ga0193276_1071227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata717Open in IMG/M
3300018883|Ga0193276_1099792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata591Open in IMG/M
3300018888|Ga0193304_1068597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300018896|Ga0192965_1199302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300018898|Ga0193268_1209501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300018903|Ga0193244_1097994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300018908|Ga0193279_1088756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300018908|Ga0193279_1127365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300018942|Ga0193426_10059300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra830Open in IMG/M
3300018942|Ga0193426_10071738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata761Open in IMG/M
3300018942|Ga0193426_10073399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata753Open in IMG/M
3300018942|Ga0193426_10132918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra558Open in IMG/M
3300018947|Ga0193066_10125714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata749Open in IMG/M
3300018947|Ga0193066_10208843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300018966|Ga0193293_10019339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra939Open in IMG/M
3300018966|Ga0193293_10027854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra848Open in IMG/M
3300018966|Ga0193293_10039072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata767Open in IMG/M
3300018966|Ga0193293_10047318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata724Open in IMG/M
3300018969|Ga0193143_10113170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata798Open in IMG/M
3300018969|Ga0193143_10132096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata737Open in IMG/M
3300018969|Ga0193143_10181317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata614Open in IMG/M
3300018970|Ga0193417_10170009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata697Open in IMG/M
3300018975|Ga0193006_10124543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata772Open in IMG/M
3300018979|Ga0193540_10089917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata841Open in IMG/M
3300018981|Ga0192968_10096035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra793Open in IMG/M
3300018981|Ga0192968_10133496All Organisms → cellular organisms → Eukaryota → Sar649Open in IMG/M
3300018985|Ga0193136_10160957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata668Open in IMG/M
3300018988|Ga0193275_10085104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata885Open in IMG/M
3300018988|Ga0193275_10097995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata840Open in IMG/M
3300018989|Ga0193030_10133987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata792Open in IMG/M
3300018995|Ga0193430_10113133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata650Open in IMG/M
3300018995|Ga0193430_10128990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300018995|Ga0193430_10135981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300018995|Ga0193430_10157310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300018996|Ga0192916_10164546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra659Open in IMG/M
3300018999|Ga0193514_10210725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300019000|Ga0192953_10078062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata768Open in IMG/M
3300019000|Ga0192953_10087151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata737Open in IMG/M
3300019007|Ga0193196_10255144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata757Open in IMG/M
3300019007|Ga0193196_10347428All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300019010|Ga0193044_10174300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra693Open in IMG/M
3300019010|Ga0193044_10243577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300019011|Ga0192926_10274985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra721Open in IMG/M
3300019011|Ga0192926_10391308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata588Open in IMG/M
3300019012|Ga0193043_10239161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300019017|Ga0193569_10425773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300019020|Ga0193538_10190565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata703Open in IMG/M
3300019020|Ga0193538_10237175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300019020|Ga0193538_10238091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata597Open in IMG/M
3300019022|Ga0192951_10306113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra601Open in IMG/M
3300019024|Ga0193535_10151733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata751Open in IMG/M
3300019033|Ga0193037_10075573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata970Open in IMG/M
3300019033|Ga0193037_10184251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata702Open in IMG/M
3300019037|Ga0192886_10081250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra918Open in IMG/M
3300019037|Ga0192886_10160323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra704Open in IMG/M
3300019040|Ga0192857_10090242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata832Open in IMG/M
3300019040|Ga0192857_10151539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata707Open in IMG/M
3300019040|Ga0192857_10161609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata692Open in IMG/M
3300019040|Ga0192857_10217443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata622Open in IMG/M
3300019044|Ga0193189_10096268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata710Open in IMG/M
3300019045|Ga0193336_10113286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata934Open in IMG/M
3300019048|Ga0192981_10210722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata756Open in IMG/M
3300019053|Ga0193356_10286873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300019055|Ga0193208_10325125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata797Open in IMG/M
3300019067|Ga0193459_102514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata641Open in IMG/M
3300019067|Ga0193459_102907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300019068|Ga0193461_104623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata659Open in IMG/M
3300019088|Ga0193129_1008120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata808Open in IMG/M
3300019099|Ga0193102_1031004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra512Open in IMG/M
3300019101|Ga0193217_1020682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata812Open in IMG/M
3300019102|Ga0194243_1010489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300019111|Ga0193541_1043533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata783Open in IMG/M
3300019111|Ga0193541_1093709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300019112|Ga0193106_1038089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300019115|Ga0193443_1023086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300019126|Ga0193144_1072574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata612Open in IMG/M
3300019126|Ga0193144_1074907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata605Open in IMG/M
3300019126|Ga0193144_1085760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata572Open in IMG/M
3300019131|Ga0193249_1091792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata707Open in IMG/M
3300019134|Ga0193515_1061756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300019134|Ga0193515_1067703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata627Open in IMG/M
3300019136|Ga0193112_1049092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata992Open in IMG/M
3300019136|Ga0193112_1131651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300019141|Ga0193364_10127208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300019143|Ga0192856_1018525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata843Open in IMG/M
3300019143|Ga0192856_1036657All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata673Open in IMG/M
3300019143|Ga0192856_1038953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra658Open in IMG/M
3300019143|Ga0192856_1070042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300019151|Ga0192888_10162640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata705Open in IMG/M
3300019152|Ga0193564_10145152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata745Open in IMG/M
3300021877|Ga0063123_1047012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300021878|Ga0063121_1020689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300021883|Ga0063126_1002149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300021885|Ga0063125_1027466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata707Open in IMG/M
3300021886|Ga0063114_1015024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300021889|Ga0063089_1065728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata624Open in IMG/M
3300021893|Ga0063142_1031186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300021899|Ga0063144_1040832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata732Open in IMG/M
3300021912|Ga0063133_1035585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300021912|Ga0063133_1065909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300021913|Ga0063104_1071738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra584Open in IMG/M
3300021925|Ga0063096_1016319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300028575|Ga0304731_10340274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata615Open in IMG/M
3300028575|Ga0304731_10490163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata673Open in IMG/M
3300030699|Ga0307398_10550615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300030699|Ga0307398_10686800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300030801|Ga0073947_1761164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300030801|Ga0073947_1785502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300030871|Ga0151494_1085616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata771Open in IMG/M
3300030910|Ga0073956_10956095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300030918|Ga0073985_10713802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata617Open in IMG/M
3300030951|Ga0073937_12081551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300030951|Ga0073937_12087484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300030954|Ga0073942_10009417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata815Open in IMG/M
3300031037|Ga0073979_12310381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata580Open in IMG/M
3300031037|Ga0073979_12418389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300031037|Ga0073979_12447423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra717Open in IMG/M
3300031052|Ga0073948_1941607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300031056|Ga0138346_10534576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300031056|Ga0138346_10969382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300031522|Ga0307388_10669121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata692Open in IMG/M
3300031522|Ga0307388_11083576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300031522|Ga0307388_11141527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300031674|Ga0307393_1108794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300031717|Ga0307396_10359879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata696Open in IMG/M
3300031717|Ga0307396_10518722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata572Open in IMG/M
3300031717|Ga0307396_10571365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300031735|Ga0307394_10352508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra587Open in IMG/M
3300031735|Ga0307394_10378366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata566Open in IMG/M
3300031737|Ga0307387_10712179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300031737|Ga0307387_11055374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300031739|Ga0307383_10602965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra554Open in IMG/M
3300031742|Ga0307395_10384794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300031742|Ga0307395_10466654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300032481|Ga0314668_10597687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300032521|Ga0314680_10463562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata794Open in IMG/M
3300032521|Ga0314680_10625152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata680Open in IMG/M
3300032540|Ga0314682_10455637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata705Open in IMG/M
3300032650|Ga0314673_10490379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata634Open in IMG/M
3300032708|Ga0314669_10342809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata810Open in IMG/M
3300032708|Ga0314669_10433296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata722Open in IMG/M
3300032713|Ga0314690_10311147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata780Open in IMG/M
3300033572|Ga0307390_10641215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata664Open in IMG/M
3300033572|Ga0307390_10823438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine71.33%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.83%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water3.15%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.80%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.45%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.75%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.35%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.35%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009272Eukaryotic communities of water from the North Atlantic ocean - ACM45EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300018526Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000185 (ERX1782407-ERR1711866)EnvironmentalOpen in IMG/M
3300018555Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001618 (ERX1809464-ERR1739837)EnvironmentalOpen in IMG/M
3300018568Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002404 (ERX1789617-ERR1719200)EnvironmentalOpen in IMG/M
3300018585Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000269 (ERX1782265-ERR1712044)EnvironmentalOpen in IMG/M
3300018588Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000538 (ERX1782191-ERR1712140)EnvironmentalOpen in IMG/M
3300018592Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782094-ERR1712047)EnvironmentalOpen in IMG/M
3300018594Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809463-ERR1739849)EnvironmentalOpen in IMG/M
3300018608Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002024 (ERX1782181-ERR1712102)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018635Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782126-ERR1712207)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018651Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001512 (ERX1782264-ERR1711863)EnvironmentalOpen in IMG/M
3300018653Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003013 (ERX1789553-ERR1719190)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018661Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782311-ERR1712063)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018668Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002464 (ERX1782441-ERR1712149)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018675Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789575-ERR1719413)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018691Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001616 (ERX1782222-ERR1712214)EnvironmentalOpen in IMG/M
3300018698Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001473 (ERX1809465-ERR1739846)EnvironmentalOpen in IMG/M
3300018707Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789613-ERR1719509)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018713Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782432-ERR1712119)EnvironmentalOpen in IMG/M
3300018718Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789426-ERR1719437)EnvironmentalOpen in IMG/M
3300018733Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)EnvironmentalOpen in IMG/M
3300018734Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001612 (ERX1789403-ERR1719254)EnvironmentalOpen in IMG/M
3300018738Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002938 (ERX1789371-ERR1719226)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018740Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789647-ERR1719307)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018758Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018777Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000589 (ERX1789605-ERR1719349)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018793Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000876 (ERX1789367-ERR1719325)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018802Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789649-ERR1719297)EnvironmentalOpen in IMG/M
3300018804Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001738 (ERX1789642-ERR1719208)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018820Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018837Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782235-ERR1712073)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018845Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018896Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789685-ERR1719483)EnvironmentalOpen in IMG/M
3300018898Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789568-ERR1719317)EnvironmentalOpen in IMG/M
3300018903Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512)EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018970Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789437-ERR1719295)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019044Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789478-ERR1719328)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019067Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002412 (ERX1782229-ERR1712040)EnvironmentalOpen in IMG/M
3300019068Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002414 (ERX1782336-ERR1711930)EnvironmentalOpen in IMG/M
3300019088Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782331-ERR1712049)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019101Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000077 (ERX1782274-ERR1712235)EnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019115Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002358 (ERX1782231-ERR1711979)EnvironmentalOpen in IMG/M
3300019126Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000695 (ERX1782402-ERR1712043)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019141Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001937 (ERX1789668-ERR1719463)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300021877Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021878Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021883Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S0 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030801Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030910Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030918Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030954Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031052Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1022718113300008832MarineVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL*
Ga0103951_1025805713300008832MarineMFEPRDLVNLNVEVVKADVDYGFFGNLEVFSNLAFSILVQNVDTCRTTLDWKKGVEGGKYGPMGEDLFAEVCMEKNGVDKVEAFDVTIDGACPQKRPEDQKKNKRWKSDCKTTAPAMHPFKTPTDWLTCFDQTMAM*
Ga0103951_1035545513300008832MarineMFIQVWKAIGDTNAHAGMDWVVKFDPDAVFVPERLRDRIQWMPRTSSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTEVDWKVGIKAGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL*
Ga0103951_1051313813300008832MarineVTDVKGDWHFGKRKETGAWVNTGMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAA
Ga0103951_1081103513300008832MarineVNTGMFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPTAFGVLVGSLDSCYTELDWKVGIKDGKYGPMGEDLFAEICMSTNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYF
Ga0103882_1001443013300008834Surface Ocean WaterRKETGAWVNTGIFIQVWKAIGAANAYSNHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVQGGKHGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL*
Ga0103882_1002234513300008834Surface Ocean WaterFVTKKVTDVMGDWHFAKRKETGAWVNTGIFIQVWKAIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL*
Ga0103883_101909713300008835Surface Ocean WaterGNSSQKSQRFDSYKEEEKMSEDVRANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL*
Ga0103883_102759413300008835Surface Ocean WaterERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVQGGKHGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL*
Ga0103734_100452813300008931Ice Edge, Mcmurdo Sound, AntarcticaVAETNVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGTMLQNCQYVDYGFFGNLEVLSGKAFEVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAY
Ga0103735_107878413300008932Ice Edge, Mcmurdo Sound, AntarcticaPDAVFVPERLRDRIQWMPRTINGVMLQNCQYVDYGFFGSLEVLSKRAFEVLVDNVDTCYTQIDWKVGIKHGKYGPMGEDLFMEICMEKNGVNKVEAFDITTDGACEAKRPTDQAKNKKWHSDCKVMTPAMHPFKKPDEWVQCLEATLAQ*
Ga0103736_103035313300008933Ice Edge, Mcmurdo Sound, AntarcticaITDEKGDWHFAKRKETGAWVNTGIFIRAWKSVKESGKYTNYEWVVKVDPDAVFVPERLRDRIQWMPRTINGVMLQNCQYVDYGFFGSLEVLSKRAFEVLVDNVDTCYTQIDWKVGIKHGKYGPMGEDLFMEICMEKNGVNKVEAFDITTDGACEAKRPTDQAKNKKWHSDCKVMTPAMHPFKKPDEWVQCLEATLAQ*
Ga0103741_108049513300008938Ice Edge, Mcmurdo Sound, AntarcticaHFAKRKETGAWVNTGIFIRAWKSVKESGKYTNYEWVVKVDPDAVFVPERLRDRIQWMPRTINGVMLQNCQYVDYGFFGSLEVLSKRAFEVLVDNVDTCYTQIDWKVGIKHGKYGPMGEDLFMEICMEKNGVNKVEAFDITTDGACEAKRPTDQAKNKKWHSDCKVMTPAMHPFKKPDEWVQCLEATLAQ*
Ga0103502_1026828313300008998MarineRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL*
Ga0103710_1008621713300009006Ocean WaterVRREVLESPVRRRVFGYIITDLVSNIDAFIHMWEKVRQDGRYKNHDWVVKVDADAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL*
Ga0103706_1008910313300009022Ocean WaterDVEVHLGGGFLTKKVTDVNGDWHFAKRKTTGAWVNTGMFIQVWKAIGEAGRYKDYDWVVKADPDAVFIPSRLRDRIQWMPRTMAGSFLQNCEYVDYGFFGNLEVFSHLAFSILIENADKCRTTLPWKLGIKKGKYGPMGEDLFAEICMEKNGVDKVEAFDVTIDGACPDKRPKDQKKNKKWRSDCTTKAPAMHPFKKPKDWLACWEQTTSMY*
Ga0103707_1010924213300009025Ocean WaterGIMLQNCRYVDYGFFGNLEVLSPKAFNVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEAKRPPDQKKNKMWHSDCKVKSPAMHPFKKPKDYFKCLDQTMAV*
Ga0103708_10026204413300009028Ocean WaterVDYGFFANLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM*
Ga0103708_10031902313300009028Ocean WaterGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACAANRPVDQKKNKKWHSDCKVKTAAIHPFKKPKDWFQCFDQTMAM*
Ga0103743_103860313300009195Ice Edge, Mcmurdo Sound, AntarcticaKRKETGSWVNTGMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGTMLQNCQYVDYGFFGNLEVLSGKAFEVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDTTMAL*
Ga0103743_106914113300009195Ice Edge, Mcmurdo Sound, AntarcticaKRKETGSWVNTGMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGTMLQNCQYVDYGFFGNLEVLSGKAFEVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAY
Ga0103842_100598513300009216River WaterMLTDVKGDWHFGKRKETGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGITLQNCKYVDYGFFGNLEVLSPKAFDVLVGSLDTCYTELDWKVGVKDGKYGPMGEDLFAEICMSKNGVHKVEAFDITTDGACEAKRPLDQKKDKKWHSDCTVKTPALHPFKKPKDYFECLDTTMAL*
Ga0103877_100334123300009272Surface Ocean WaterDVMGDWHFAKRKETGAWVNTGIFIQVWKAIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL*
Ga0103877_100484413300009272Surface Ocean WaterEKTKKVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHAEDCSQVKTAAMHPYKKPKDYFKCLGEIMQRDYEV*
Ga0103879_1000806513300009276Surface Ocean WaterKKVTDVMGDWHFAKRKETGAWVNTGIFIQVWKAIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL*
Ga0103879_1002458013300009276Surface Ocean WaterVPERLRDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVFSPKAFNVLTNSLDMCYTQIDWMVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPTDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL*
Ga0103880_1002317813300009279Surface Ocean WaterDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSMDTCYTEVDWKVGIKGGKYGPMGEDLFMEICMSKNGVHKVEAFDITTDGACEAKRPADQKKDKKWHSDCTVKTPAMHPFKKPTDYFECLDTTMAL*
Ga0103742_102550613300009402Ice Edge, Mcmurdo Sound, AntarcticaEISLGGGFLTKVITDEKGDWHFAKRKETGAWVNTGIFIRAWKSVKESGKYTNYEWVVKVDPDAVFVPERLRDRIQWMPRTINGVMLQNCQYVDYGFFGSLEVLSKRAFEVLVDNVDTCYTQIDWKVGIKHGKYGPMGEDLFMEICMEKNGVNKVEAFDITTDGACEAKRPTDQAKNKKWHSDCKVMTPAMHPFKKPDEWVQCLEATLAQ*
Ga0138316_1063834113300010981MarineGAWVNTGMFIQVWKAVGEAHAYSNYDWVVKVDPDAVFLPERLRDRIQWMPRTTSGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPTAYFECLDQTMAL*
Ga0138316_1116284413300010981MarineKRKSTGAWVNTGMFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWLPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL*
Ga0138324_1030172613300010987MarineGDWHFGKRKETGAWVNTGMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPTDERKNKKWHSDCKVKTAAMHPFKKPKDYFECLDQTMAQ*
Ga0138324_1050619213300010987MarineWMPRTISGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPTAYFECLDQTMAL*
Ga0193100_10168113300018526MarineSLGGDFVTKKVTDVKGDWHFAKRKSTGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRNRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPTDYFECLDTTMAL
Ga0193100_10291313300018526MarineVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193100_10295513300018526MarineQAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPIDQKKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193100_10324413300018526MarineGVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193296_10208213300018555MarineDVAASLGGGFVTKKLTDVKGDWHFAKRKSTGAWINTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193296_10303013300018555MarineKGDWHFAKRKETGAWVNTGMFIQVWKAIADTGVHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIILQNCRYVEYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0193457_100896413300018568MarineETGAWVNTGMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0193221_100696413300018585MarineDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDSCYTEVDWKVGVMGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0193141_100808513300018588MarineKRKETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSMETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193141_101426323300018588MarineFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0193113_101445513300018592MarineTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193113_101669313300018592MarineASLGGDFVTKKVTDVKGDWHFAKRKSTGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193113_101942613300018592MarineIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193113_102261713300018592MarineADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193292_101462513300018594MarineNTGIFIQVWKAIGAANVYSGHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAL
Ga0193415_101920813300018608MarineDADAVFVPDRLRDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAIHPFKKPKDWFQCFDQTMAM
Ga0193064_100436813300018616MarineSEAKTYENYDWTVKVDPDAVFVASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVSTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDVYFKCLQQTMAME
Ga0193064_101102113300018616MarineDFAKRKETGAWVNTGMFIQVWKAIADTNAHAGMDWVVKVDPDAVFVPERLSDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVFSPKAFNVLTSSLDMCYTQIDWMVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPTDEKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0188862_103154713300018622Freshwater LakeAVFVPERLQDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAA
Ga0193355_101559013300018628MarineKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVEYGFFGNLEVLSPKAFSVLTDSLETCYTSVDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193376_101256213300018635MarineRKETGAWVNTGMFIQVWKAVGEAHAYSNYDWVVKVDPDAVFLPERLRDRIQWMPRTTSGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPAAYFECLDQTMAL
Ga0193376_101748213300018635MarineDADAVFVPERLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACAANRPVDQKKNKKWHSDCKVKTAAMHPFKKPKDWFQCFDQTMAM
Ga0193377_100947213300018636MarineWKAIGEAKIYNDHDWVVKVDADAVFVPARLRDRIQWMPRTISGVMLQNCQYVDYGFFGNLEVFSQKAFSILVGNVDTCYTLLPWKVGVKNGKFGPMGEDLFAEICMKKNGVDTVEAFDVTTDGLCPAKRPTDQKKNKKWHSDCKVKTPAMHPFKKPSDYFKCLDQTMAL
Ga0193377_101371713300018636MarineKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193377_102053513300018636MarineVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDYFECLDQTMAL
Ga0192914_101922313300018637MarineRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPIDQKKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193431_101284913300018643MarineTWVRGRSASLLARNTKSTPMWRCHWVKTGMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193445_104497013300018648MarineVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPTDYFECLDTTMAL
Ga0192969_103880413300018649MarineMGVDPDAVFVPERLSERIQWMPRTTTGVMLQNCEYVDYGFFGNLEVISAKGFGVLVGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAELCMSKNGVDKVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAM
Ga0192937_102831413300018651MarineWHFAKRKETGAWVNTGMFIQVWKAIADTNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193504_103031713300018653MarineHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0192889_104518513300018657MarineMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0192889_104876713300018657MarinePDAVFLPERLRDRIQWMPRTISGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQKKNKKWHSDCKVKTPAMHPFKTPTAYFECLDQTMAL
Ga0193067_103152213300018659MarineWHFAKRKETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193067_105033413300018659MarineVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193122_102851013300018661MarineVKGDWHFAKRKETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSMETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193122_104265313300018661MarineKAIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0192848_101810913300018662MarineKVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIADTNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0192848_102068413300018662MarineETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0192848_104239913300018662MarineGNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193013_105173013300018668MarineQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193166_101993413300018674MarineMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193384_102219113300018675MarineKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLANLETCYTEIDWKVGIQNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPTAYFECFEQTMALEQ
Ga0192983_102562713300018684MarineANAYSNYDWVVKVDPDAVFVPERLRDRIQWMPRTTNGVMLQNCQYVDYGFFGNLEVLSTKAFDILVDNAETCYTEIDWKVGIKQGKYGPMGEDLFMEICMEKNGVHKVEAFDVSTDGACEAKRPTDQAKNKKWHSDCKVKSPAMHPFKKPTEWFECFDQTMAL
Ga0192983_103203513300018684MarineDVKGDWHFAKRKETGSWVNTGMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGTMLQNCQYVDYGFFGNLEVLSGKAFEVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDTTMAL
Ga0193294_100850313300018691MarineGEGLDTVKVEDVNNDWHFAKRKTTGAWVNTGMFIQVWKAIAEAKTYENYDWTVKVDPDAVFVASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVSTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDVYFKCLQQTMAME
Ga0193294_101725413300018691MarineAIAEAKTYENYDWTVKVDPDAVFVASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVSTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDVYFKCLQQTMAME
Ga0193294_102338413300018691MarineMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIILQNCRYVEYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAM
Ga0193294_102865313300018691MarineLRDRIQWLPRTTNGIMLQNCRYVEYGFFGNLEVLSPKAFSVLTDSMEACYTQMDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPMDQKKNKKWHSDCQVKTAAMHPFKKPKEYFECLDTTMAL
Ga0193236_104656413300018698MarinePDAVFLPERLRDRIQWIPRTTSGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDACYTEVDWKVGVKSGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPTAYFECLDQTMAL
Ga0192876_106851013300018707MarinePRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKKPKDWFQCFDQTMAL
Ga0193069_101761613300018711MarineETGAWVNTGMFIQVWKAIADTNAQAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0193069_101826313300018711MarineETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193069_101863913300018711MarineETGAWVNTGMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAIHPFKKPKDWFQCFDQTMAM
Ga0193069_102848013300018711MarineDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVFSPKAFNVLTNSLDMCYTQIDWMVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPTDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0193069_105235513300018711MarineETGAWVNTGMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPIDQKKNKKWHSDCKVKTPAMHP
Ga0192887_103782713300018713MarinePRTISGVMLQNCQYVDYGFFGNLEVFSQKAFSILVGNVDTCYTLLPWKVGVKNGKFGPMGEDLFAEICMKKNGVDTVEAFDVTTDGLCPAKRPTDQKKNKKWHSDCKVKTPAMHPFKKPSDYFKCLDQTMAL
Ga0192887_103849013300018713MarineAHAYSNYDWVVKVDPDAVFLPERLRDRIQWMPRTISGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPTAYFECLDQTMAL
Ga0193385_102415213300018718MarineVGEAMFYKNYDWVVKVDPDAVFVPDRLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLANLETCYTEIDWKVGIQNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPTAYFECFEQTMALER
Ga0193385_102464913300018718MarineVGEAMFYKNYDWVVKVDPDAVFVPDRLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLANLETCYTEIDWKVGIQNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPEAYFECFDQTMAFER
Ga0193036_105520413300018733MarineGAANFYSDHDWVVKVDADAVFVPERLRERVQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDSCYTEVDWKVGVEGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0193036_106259113300018733MarineVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDSCYTEVDWKVGVEGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0193290_101121913300018734MarineVASRLRDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVNKVEAFDVTTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDVYFKCLQQTMAME
Ga0193495_104722213300018738MarineFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFECLDETMAL
Ga0192974_105607513300018739MarineGGFLTKVITDEKGDWHFAKRKETGAWVNTGIFIRAWKSVKESGKYTNYEWVVKVDPDAVFVPERLRDRIQWMPRTINGVMLQNCQYVDYGFFGSLEVLSKRAFEVLVDNVDTCYTQIDWKVGIKHGKYGPMGEDLFMEICMEKNGVNKVEAFDITTDGACEAKRPTDQAKNKKWHSDCKVMTPAMHPFKKPDEWVQCLEATLAQ
Ga0192974_106713613300018739MarineIQWMPRTTSGVMLQNCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193387_104217313300018740MarineTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193387_105990313300018740MarineRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLANLETCYTEIDWKVGIQNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPEAYFDCFDQTMAFER
Ga0193534_104444013300018741MarineAIADSNAHAGMDWVVKVDADAVFVPERLRNRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLISSLETCYTQVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTMDGACEANRPIDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECLDTTMAM
Ga0193534_104480413300018741MarineAIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193534_104494013300018741MarineTGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTEVDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193425_103502713300018743MarineAVGEAHAYSNYDWVVKVDPDAVFLPERLRDRIQWMPRTTSGTMLQNCQYVDYGFFGNLEVLSVKAFDILLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPAAYFECLDQTMAL
Ga0193147_104643013300018747MarineVTKKVTDVKGDWHFAKRKSTGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTEVDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPADQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193058_107077313300018758MarineMGDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPVDQKKNKKWHSDCKVKTAAMHPFKKPKDWFQCFDQTMAM
Ga0192924_102668313300018764MarineAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193478_106390113300018769MarineFAKRKETGAWVNTGMFIQVWKAVGEAHAYSNYDWVVKVDPDAVFLPERLRDRIQWMPRTTSGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQKKNKKWHSDCKVKTPAMHPFKTPTAYFECLDQTMAL
Ga0193407_105336013300018776MarineDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLSENLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACPATRPDDQKKNKKWHSDCKVKTPAMHPFKKVKDWFQCFDQTMAL
Ga0192839_107161113300018777MarineASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVTTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDVYFKCLQQTMAME
Ga0193472_101920713300018780MarineFIQVWKAVGEAQFYKNYDWVVKVDPDAVFVPDRLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLGNLETCYTEIDWKVGIMNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPEAYFECFDQTMAFER
Ga0193472_102952013300018780MarineWMPRTTNGIMLQNCKYVEYGFFGNLEVLSPKAFSVLTDSLETCYTSVDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0192832_103134813300018782MarineDRIQWMPRTISGVMLQNCQYVDYGFFGNLEVFSQKAFSILVGNVDTCYTLLPWKVGVKNGKFGPMGEDLFAEICMKKNGVDTVEAFDVTTDGLCPAKRPTDQKKNKKWHSDCKVKTPAMHPFKKPSDYFKCLDQTMAL
Ga0192832_105103013300018782MarinePRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0192928_102264613300018793MarineAWVNTGMFIQVWKAIAEAKTYENYDWTVKVDPDAVFVASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVTTDGACEADRPPDQLKNKKWHSDCKVKTPAMHPFKKPDGYFECLQQTMAM
Ga0192928_103109813300018793MarineAWVNTGMFIQVWKAIAEAKTYENYDWTVKVDPDAVFVASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVSTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDVYFKCLQQTMAM
Ga0192928_105030313300018793MarineAWVNTGMFIQVWKAIAEAKTYENHDWTVKVDPDAVFVASRLKDRIQWMPRTTSGCFLQNCKYVDYGFFGNLEVFSHLAFSILAANVDECRTTIPWKIGVKNGKYGPMGEDLFAEICMAKNGVDKVEAFDVTIDGACEANRPRDQLKNKKWHSDCKVKTPAMHPFKKPDDYFKCLEQTMAM
Ga0193357_103612923300018794MarineRKETGAWVNTGMFIQVWKAIADSNAHAGMDWVVKADADAVFVPERLKDRIQWMPRTTNGIMLQNCKYVEYGFFGNLEVLSPKAFSVLTDSLETCYTSVDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193357_103622213300018794MarineETGAWVNTGMFIQVWKAIADTGVHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIILQNCRYVEYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0193357_103633713300018794MarineASLGGDFVTKKVTDVKGDWHFAKRKSTGAWINTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193357_105758013300018794MarineRTTNGIMLQNCRYVEYGFFGNLEVLSPKAFSVLTDSMEACYTQMDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPMDQKKNKKWHSDCQVKTAAMHPFKKPKEYFECLDTTMAL
Ga0193357_106289613300018794MarineNTGMFIQVWKAIAEAKTYENYDWTVKVDPDAVFVASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVSTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDGYFKCLQQTMAME
Ga0193117_104641713300018796MarineAVFVPARLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVFSRRAFRILVGNVDTCYTKLPWKVGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVTTDGACEAKRPTDQKKNKMWHSDCKVKSPALHPFKKPEDYFKCLDQTMAM
Ga0193388_103528213300018802MarineSIFACEAYEVYSDAAASLGGDFVTKKVTDVKGDWHFAKRKSTGAWINTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193388_106600113300018802MarineYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFECLDETMAL
Ga0193329_109179813300018804MarineYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0193441_102040513300018807MarineWHFAKRKTTGAWINTGMFIQVWKAIAEAKTYENYDWTVKVDPDAVFVASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVSTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDVYFKCLQQTMAME
Ga0193172_104308813300018820MarineKGDWHFAKRKETGAWVNTGMFIQVWKAIADSNAHAGMDWVVKVDADAVFVPERLRNRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTSSLETCYTQVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTMDGACEANRPIDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECLDTTMAM
Ga0193053_105624413300018823MarineQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0192927_101481213300018837MarineLLARHMKSTGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0192927_105566413300018837MarineDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVFSPKAFNVLTNSLDMCYTQIDWMVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTMDGACEANRPTDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0192927_106161813300018837MarineLRDRIQWMPRTTTGVMLQNCQYVDYGFFGNLEVLSVKAFDVLLSSMDTCYTEVDWKVGVKNGKFGPMGEDLFAEVCMSKNGVNKVESFDTTIDGACKAKRPTDEKKNKKWHSDCKVKVPAFHPFKKPTEYFECLDQTMAL
Ga0193312_107357613300018844MarineMGGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193042_115417213300018845MarineETGAWVNTGMFIQVWKAIADTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVLSPKAFSVLTDSMETCYTQVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITADGACEANRPIDQKKNKKWHSDCKVKTAAMHPFKKTK
Ga0193273_103817323300018850MarineMGVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193359_107552713300018865MarineEDVNNDWHFAKRKTTGAWINTGMFIQVWKAIAEAKTYENHDWTVKVDPDAVFVASRLKDRIQWMPRTTSGCFLQNCKYVDYGFFGNLEVFSHLAFSILAANVDECRTTIPWKIGVKNGKYGPMGEDLFAEICMAKNGVDKVEAFDVTIDGACEANRPRDQLKNKKWHSDCKVKTPAMHPFKKPDDYFKCLEQTMAME
Ga0193359_110261013300018865MarineQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMALQ
Ga0192859_103338513300018867MarineKRKETGAWVNTGMFIQVWKAIADTGVHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIILQNCRYVEYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0192859_103732223300018867MarineFIQVWKAIVDTGAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVLSPKAFSVLTDSVETCYTQIDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0192859_106340413300018867MarineKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193471_106834813300018882MarineAIADSNAHAGMDWVVKVDADAVFVPERLRNRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTSSLETCYTQVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTMDGACEANRPIDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECLDTTMAM
Ga0193276_107122713300018883MarineNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRNRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193276_109979223300018883MarineDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVFSPKAFNVLTNSLDMCYTQIDWMVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTMDGACEANRPTDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAM
Ga0193304_106859713300018888MarineADSNAHGGMDWVVKADADAVFVPERLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACAANRPVDQKKNKKWHSDCKVKTAAIHPFKKPKDWFQCFDQTMAM
Ga0192965_119930213300018896MarineEVLSAKAFGVLVGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAELCMSKNGVDKVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193268_120950113300018898MarineVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193244_109799413300018903MarineQNCQYVDYGFFGNLEVLSVKAFDVLLSSMDTCYTEVDWKVGVKNGKFGPMGEDLFAEVCMSKNGVNKVESFDTTIDGACKAKRPTDEKKNKKWHSDCKVKVPAFHPFKKPTEYFECLDQTMAL
Ga0193279_108875613300018908MarineVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSMETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193279_112736513300018908MarineVLSPKAFSVLTDSMETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0193426_1005930013300018942MarineRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVNKVEAFDVTTDGACEANRPLDQLKNKKWHSDCKVKTPAMHPFKKPDVYFQCLQQTMAME
Ga0193426_1007173823300018942MarineFIQVWKAIADTNAHVGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTESLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPEDQRKNKKWHSDCKVKTAAMHPFKKTKAYFECLDETMALE
Ga0193426_1007339913300018942MarineGGGFSTKKVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193426_1013291813300018942MarineGNLEVFSQKAFSILVGNVDTCYTLLPWKVGVKNGKFGPMGEDLFAEICMKKNGVDTVEAFDVTTDGLCPAKRPTDQKKNKKWHSDCKVKTPAMHPFKKPSDYFKCLDQTMAL
Ga0193066_1012571423300018947MarineQVWKAIADTNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193066_1020884313300018947MarineYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0193293_1001933913300018966MarineEVYADVAVSLGGEFVTKKVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIADTGVHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIILQNCRYVEYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0193293_1002785423300018966MarineACDAYDVYSDVEVSLGGGFVTKKVTDVMGDWHFAKRKETGAWVNTGIFIQVWKAIGAANVYSGHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193293_1003907213300018966MarineAASLGGDFVTKKVTDVKGDWHFAKRKSTGAWINTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193293_1004731813300018966MarineDVKGDWHFAKRKSTGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193143_1011317013300018969MarineTKKVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIADTNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSMETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193143_1013209613300018969MarineFIQVWKAIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193143_1018131713300018969MarineCKYVDYGFFGNLEVLSPKAFSVLTDSMETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMA
Ga0193417_1017000913300018970MarineIQVWKAIADSNAHGGMDWVVKADADAVFVPERLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACAANRPVDQKKNKKWHSDCKVKTAAIHPFKKPKDWFQCFDQTMAM
Ga0193006_1012454313300018975MarineYDVYSDVEVSVGGDFSTKKVTDVKGDWHFAKRKETGAWVNTGMFVQVWKAIADTNAHAGMDWVVKVDADAVFVPERLRNRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTESLETCYTQLDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPIDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECLDQTMAM
Ga0193540_1008991713300018979MarineMGVSLGGGFVTKKVTDVMGDWHFAKRKETGAWVNTGIFIQVWKAIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0192968_1009603513300018981MarineEVYSDVEISLGGGFLTKVITDEKGDWHFAKRKETGAWVNTGIFIRAWKSVKESGKYTNYEWVVKVDPDAVFVPERLRDRIQWMPRTINGVMLQNCQYVDYGFFGSLEVLSKRAFEVLVDNVDTCYTQIDWKVGIKHGKYGPMGEDLFMEICMEKNGVNKVEAFDITTDGACEAKRPTDQAKNKKWHSDCKVMTPAMHPFKKPDEWVQCLEATLAQ
Ga0192968_1013349613300018981MarineVNTGIFIQVWKAIGEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHMVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAM
Ga0193136_1016095713300018985MarineGVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSMETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193275_1008510423300018988MarineMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVEYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193275_1009799513300018988MarineMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVEYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPIDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECLDTTMAM
Ga0193030_1013398713300018989MarineRKETGAWVNTGMFIQVWKAIAESNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193430_1011313313300018995MarineDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVEYGFFGNLEVLSPKAFSVLTDSMEACYTQMDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPMDQKKNKKWHSDCQVKTAAMHPFKKPKEYFECLDTTMAL
Ga0193430_1012899013300018995MarineQNCRYVEYGFFGNLEVLSPKAFSVLTDSVETCYTQIDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0193430_1013598113300018995MarineRLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193430_1015731013300018995MarinePERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLSENLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACPATRPDDQKKNKKWHSDCKVKTPAMHPFKKVKDCSSASTRLWHCRASPEMI
Ga0192916_1016454613300018996MarineDYGFFGNLEVLSLRAFDILLANLETCYTDIDWKVGIQNGKYGPMGEDLFAEICMTKNGVDKVEAFDTSTDGACEAKRPADQQKNKKWHSDCRVRTPAIHPFKTPTAYFECFDQTMALEQ
Ga0193514_1021072513300018999MarineFIQVWKAIADTNAHSGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPRAFSVLADSLETCYTQIDWKVGIKGGKYGPMGEDLFAEICMSKGGVHYVEAFDVTTDGACEANRPTDERKNKKWHSDCKVKTAAMHPFKKPKDYFECLDQTMALA
Ga0192953_1007806213300019000MarineMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGSMLQNCQYVDYGFFGNLEVLSGKAFEVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDTTMAL
Ga0192953_1008715113300019000MarineTWVLQNCQYVDYGFFGNLEVLSTKAFDILVDNAETCYTEIDWKVGIKQGKYGPMGEDLFMEICMEKNGVHKVEAFDVSTDGACEAKRPTDQAKNKKWHSDCKVKSPAMHPFKKPTEWFECFDQTMAL
Ga0193196_1025514413300019007MarineLEVISAKAFGVLVGSLDSCYTEVDWKVGVEGGKYGPMGEDLFAEICMSKNGVHLVEAFDVTTDGACPAKRPIDQTKNNKWHSDCNVKTPAMHPFKKPKDWFECFDKTMALER
Ga0193196_1034742813300019007MarineHGGSVLQNCQYVDYGFFGNLEVFSNLAFSILVQNVDTCRTTLDWKKGVEGGKYGPMGEDLFAEVCMEKNGVDKVEAFDVTIDGACPHKRPEDQKKNKKWKSDCKITAPAMHPFKTPTDWLTCFDQTMAM
Ga0193044_1017430013300019010MarineIFIQVWKAIAEANAYSGHDWVVKVDADAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKTPTAYFECLDQTMAL
Ga0193044_1024357713300019010MarineQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0192926_1027498523300019011MarineRIQWMPRTMSGSVLQNCPYVDYGFFGNLEVFSNLAFGILVQNVDTCRTTLDWKKGVEGGKYGPMGEDLFAEVCMEKNGVDKVEAFDVTIDGACPQKRPEDQKKNKKWKSDCKITAPAMHPFKTPTDWLTCFDQTMAM
Ga0192926_1039130813300019011MarineDYGFFGNLEVISAKAFGVLVGSLDTCYMEVDWKVGVQGGKHGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0193043_1023916113300019012MarineMFIQVWKAIADSNAHAGMDWVVKVDADAVFVPERLRNRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLISSLETCYTQVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITADGACEANRPMDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECLDTTMAM
Ga0193569_1042577313300019017MarineFVPERLRDRIQWMPRTTNGVMLQNCEYVDYGFFGNLEVISTKAFGILLGNLDTCYTEIDWKLGVENGIYGSMGEDLFAEICMEKHGVHKVEAFDVTTDGACKAKRPADQQKNKKWHSDCKVKTPAMHPFKKPDEWFACLAQTMALE
Ga0193538_1019056513300019020MarineQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTEVDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193538_1023717513300019020MarineGFFGNLEVFSNLAFSILVQNVDTCRTTLDWKKGVEGGKYGPMGEDLFAEVCMEKNGVDKVEAFDVTIDGACPHKRPEDQKKNKKWKSDCKITAPAMHPFKTPTDWLTCFDQTMAM
Ga0193538_1023809113300019020MarineAGDWHFAKRKETGAWVNTGIFIQVWKAIAEAKFYSSHDWVVKVDADAVFVPERLQDRVQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSTMAFNVLVDNLDTCYTEVDWKVGVKNGEYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0192951_1030611313300019022MarineAKIYNDYDWVIKVDPDAVFVPARLRDRIQWMPRTISGVMLQNCQYVDYGFFGNLEIFSHRAFSILVGNVDTCYTKLPWKVGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVTTDGACEAKRPTDQKKNKMWHSDCNVKSPAIHPFKKPKDYFKCLDQTMAM
Ga0193535_1015173313300019024MarineSLGGDFVTKKVTDVKGDWHFAKRKSTGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTEVDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193037_1007557313300019033MarineKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDSCYTEVDWKVGVEGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVSTDGACPAKRPKDQTKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0193037_1018425113300019033MarineKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDSCYTEVDWKVGVEGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVSTDGACPAKRPKDQTKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAM
Ga0192886_1008125013300019037MarineGGVLTKKVTDVKGDWHFAKRKTAGTWINTGMFIQVWKAIGEAKIYNDHDWVVKVDADAVFVPARLRDRIQWMPRTISGVMLQNCQYVDYGFFGNLEVFSQKAFSILVGNVDTCYTLLPWKVGIKNGKYGPMGEDLFAEICMKKNGVDTVEAFDVTTDGLCPAKRPTDQKKNKKWHSDCKVKTPAMHPFKKPSDYFKCLDQTMAL
Ga0192886_1016032313300019037MarineRLRNRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLGNLETCYTGIDWKVGIQNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPEAYFQCFEQTMELGV
Ga0192857_1009024213300019040MarineTGAWVNTGIFIQVWKAIGAANAYSSHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDSCYTEVDWKVGVEGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVSTDGACPAKRPKDQTKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0192857_1015153913300019040MarineADSNAHAGMDWVVKADADAVFVPERLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPVDQKKNKKWHSDCKVKTAAIHPFKKPKDWFQCFDQTMAM
Ga0192857_1016160913300019040MarineMGETGAWVNTGMFIQVWKAIAETNFYAGMDWIVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVISPKAFSVLIDSLESCYTQIDWRVGIKGGKYGPMGEDLFAEICMAKNGVHYVEAFDITTDGACQANRPMDQTKNKKWHSDCKVKTAAMHPFKKPQEYFECLDQTMAM
Ga0192857_1021744313300019040MarineMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKGGVHYVEAFDVTTDGACEANRPTDQRKNKKWHSDCKVKTAAMHPFKKPKDYFECLDQTMALA
Ga0193189_1009626813300019044MarineADAVFVPERLQDRVQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSTMAFNVLVDNLDTCYTEVDWKVGVKNGEYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPRDQTENKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMEL
Ga0193336_1011328623300019045MarineMFIQVWKAIADSNAHGGMDWVVKADADAVFVPERLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACAANRPVDQKKNKKWHSDCKVKTAAIHPFKKPKDWFQCFDQTMAM
Ga0192981_1021072213300019048MarineAVFVPERLRDRIQWMPRTTNGVMLQNCQYVDYGFFGNLEVLSTKAFDILVDNAETCYTEIDWKVGIKQGKYGPMGEDLFMEICMEKNGVHKVEAFDVSTDGACEAKRPTDQAKNKKWHSDCKVKSPAMHPFKKPTEWFECFDQTMAL
Ga0193356_1028687313300019053MarineDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEVCMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0193208_1032512523300019055MarineVEVSLGGGFVTKKVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIADTNAHAGMDWVVKVDPDAVFVPERLSDRIQWMPRTTNGIMLQNCRYVEYGFFGNLEVFSPKAFNVLTSSLDMCYTQIDWMVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPTDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0193459_10251413300019067MarineWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPIDQKKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193459_10290713300019067MarineERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193461_10462313300019068MarineTGMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWMVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTTDGACEANRPIDQKKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193129_100812013300019088MarineETGAWVNTGMFIQVWKAIVDTNAHADMDWVVKVDPDAVFVPERLRGRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSMETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0193102_103100413300019099MarineFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPAAYFECLDQTMAL
Ga0193217_102068213300019101MarineMGGEGFLTKKVTDVKGDWHFGKRKETGAWVNTGMFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0194243_101048913300019102MarineKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193541_104353313300019111MarineVEVSLGGGFVTKKVTDVMGDWHFAKRKETGAWVNTGIFIQVWKAIGAANVYSAHDWVVKVDPDAVFVPERLKDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0193541_109370913300019111MarineEVLSPKAFSVLISSLETCYTQVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVTMDGACEANRPIDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193106_103808913300019112MarineMLQNCQYVDYGFFGNLEVLSVKAFDVLLSSLDTCYTEVDWKVGVKNGKFGPMGEDLFAEVCMSKNGVNKVESFDTTIDGACKAKRPTDEKKNKKWHSDCKVKVPAFHPFKKPTEYFECLDQTMAL
Ga0193443_102308613300019115MarineHGMLQDCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVQGGKHGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0193144_107257413300019126MarineDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSMETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0193144_107490713300019126MarineDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSMETCYTSLDWKVGIKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECLDTTMAM
Ga0193144_108576013300019126MarineHAGMDWVVKVDPDAVFVPERLRDRIQWLPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0193249_109179213300019131MarineVFVPDRLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLGNLETCYTEIDWKVGIMNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPEAYFECFDQTMAFER
Ga0193515_106175613300019134MarineMWRCLWVEASRQKKVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIADTNAHAGMDWVVKVDADAVFVPDRLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTA
Ga0193515_106770313300019134MarineMGDPDAVFLPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSVKAFDVLLSSLDTCYTEVDWKVGVKNGKFGPMGEDLFAEVCMSKNGVNKVESFDTTIDGACKAKRPTDEKKNKKWHSDCKVKVPAFHPFKKPTEYFECLDQTMAL
Ga0193112_104909223300019136MarineVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0193112_113165113300019136MarineFVPERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVQGGKHGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0193364_1012720813300019141MarineWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0192856_101852513300019143MarineTWALGGGFVTKKVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAVGEAHAYSNYDWVVKVDPDAVFLPERLRDRIQWMPRTISGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPAAYFECLDQTMAL
Ga0192856_103665713300019143MarineETGAWVNTGMFIQVWKAIADTGVHTGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIILQNCRYVEYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWKVGVKGGKYGPMGEDLFAEICMSKNGVHYVEAFDITTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKEYFECLDQTMAL
Ga0192856_103895313300019143MarineRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLANLETCYTEIDWKVGIQNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPTAYFECFEQTMALE
Ga0192856_107004213300019143MarineRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSLRAFDILLANLETCYTEIDWKVGIQNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPTAYFDCFDQTMAFER
Ga0192888_1016264013300019151MarineGAWVNTGFFIQVWKAVGAANAYSNYDWVVKVDPDAVFLPERLRDRIQWMPRTTTGVMLQNCQYVDYGFFGNLEVLSVKAFDVLLSSMDTCYTEVDWKVGVKNGKFGPMGEDLFAEVCMSKNGVNKVESFDTTIDGACKAKRPTDEKKNKKWHSDCKVKVPAFHPFKKPTEYFECLDQTMA
Ga0193564_1014515213300019152MarineFIQVWKAIADTNAHADMDWVVKVDPDAVFVPERLRDRIQWLPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTEIDWMVGIKGGKYGPMGEDLFAEICMSKHGVHYVEAFDVTTDGACEANRPNDQRKNKKWHSDCKVKTAAMHPFKKPNEYFQCLDETMAL
Ga0063123_104701213300021877MarineNAHAGMDWVVKVDPDAVFVPERLSDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPTAFGVLVGSLDSCYTELDWKVGIKDGKYGPMGEDLFAEICMSTNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0063121_102068913300021878MarineSDVAVSLGGDFSTKQVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIADSNAHGGMDWVVKADADAVFVPERLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACAANRPVDQKKNKKWHSDCKVKTAAIHPFKKPKDWFQCFDQTMAM
Ga0063126_100214913300021883MarineWVNTGMFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLSDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPTAFGVLVGSLDSCYTELDWKVGIKDGKYGPMGEDLFAEICMSTNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0063125_102746613300021885MarineSDVAVSLGGDFSTKQVTDVKGDWHFAKRKETGAWVNTGMFIQVWKAIADSNAHGGMDWVVKADADAVFVPERLKDRIQWMPRTTNGIMLQNCKYVDYGFFGNLEVLSPKAFNVLTDSMETCYTQLDWKVGIKGGKYGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPVDQKKNKKWHSDCKVKTAAMHPFKKPKDWFQCFDQTMAM
Ga0063114_101502413300021886MarineVMLQNCEYVDYGFFGNLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKEWFECFDQTMAL
Ga0063089_106572813300021889MarineVNTGIFIQVWKAVAEAQVYSSHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0063142_103118613300021893MarineDYGFFGNLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQSKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0063144_104083213300021899MarineFIQVWKAVGEANFYRNHDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQFVDYGFFGNLEVLSLRAFDILLGNLETCYTEIDWKVGIQNGKYGPMGEDLFAEICMSKNGVDKVESFDTSTDGACEAKRPADQQKNKKWHSDCRVKTPAIHPFKTPTAYFECFEQTMALEQ
Ga0063133_103558513300021912MarineGMFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRERIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPTAFGVLVGSLDSCYTELDWKVGIKDGKYGPMGEDLFAEICMSTNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0063133_106590913300021912MarineDPDAVFVPERLRDRIQWLPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0063104_107173813300021913MarineVSLGAGFVTKKVTDVVGDWHFAKRKETGAWVNTGIFIQVWKAVAEAQVYSSHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKK
Ga0063096_101631913300021925MarineVYSSHDWVVKVDADAVFVPERLQDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAA
Ga0304731_1034027413300028575MarineKRKSTGAWVNTGMFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWLPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0304731_1049016313300028575MarineGAWVNTGMFIQVWKAVGEAHAYSNYDWVVKVDPDAVFLPERLRDRIQWMPRTTSGSMLQNCQYVDYGFFGNLEVLSVKAFDVLLGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMAKNGVDKVEAFDISTDGACKAKRPTDQQKNKKWHSDCKVKTPAMHPFKTPTAYFECLDQTMA
Ga0307398_1055061513300030699MarineTGSWVNTGMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGSMLQNCQYVDYGFFGNLEVLSGKAFQVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDISVDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDTTMAL
Ga0307398_1068680013300030699MarineVDADAVFVPERLRDRIQWMPRTTRGVMLQNCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0073967_1190914413300030750MarineFHFAKRKTTGAWVNTGMFIQVWKAIAAEKTYQTYDWVVKADPDAVFLAERLVTRIQHMPRTVDGVFMQNCKNVDYGFFGNLEVFSHQAFAILVANVDRCYTMLDWKTGIKGGKYGPMGEDLFAEKCMEKNGVDKLEAFDLTTDGACEADRPFDQAKNKKWHTDCSSTRTPAMHPFKKPADYEKCLDATMALK
Ga0073947_176116413300030801MarineLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKEWFECFDQTMAL
Ga0073947_178550213300030801MarineSTGAWVNTGLFIQVWKAIGDTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0151494_108561613300030871MarineVTRRQKKGVQTNPLNSAVFKNAWYALKASKKIHDHEWVVKVDPDAVFVPERLRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSLDTCYTELDWKVGIKDGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACEAKRPTDQKKDKKWHSDCNVKTPAMHPYKKPKDYFECLDTTMAL
Ga0073956_1095609513300030910MarineDEFHFQKRKTTGAWVNTGMFIQVWKAIAEAKTYENYDWTVKVDPDAVFVASRLKDRIQWMPRTTSGSFLQNCKYVDYGFFGNLEVFSHLAFSILVANVDECRTTLPWKIGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVTTDGACEANRPQDQLKNKKWHSDCKVKTPAMHPFKK
Ga0073985_1071380213300030918MarinePERLKDRIQWMPRTTSGLMLQNCEYVDYGFFGNLEVISGKAFGVLVGNLDTCYTEVDWKVGVKGGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0073937_1208155113300030951MarineCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVQGGKHGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMA
Ga0073937_1208748413300030951MarineLEVLSPKAFDVLVGSMDTCYTEVDWKVGIKGGKYGPMGEDLFMEICMSKNGVHKVEAFDITTDGACEAKRPADQKKDKKWHSDCGVKTPAMHPFKKPEEYFECLDTTMAL
Ga0073942_1000941723300030954MarineGGFLTKKVTDVMGDWRFAKRKETGAWVNTGIFIQVWKAIGAANAYSNHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVQGGKHGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQVKNKKWHSDCNVKTPAMHPFKKPKDWFECFDTTMAL
Ga0073979_1231038113300031037MarineLQNCQYVDYGFFGNLEVMSKKAFGILVANLDTCYTEIPWKVGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVTTDGACEAKRPTDEKKNKMWHSDCKVKSPAMHPFKMPKEYFKCLDQTMAM
Ga0073979_1241838913300031037MarineRDRIQWMPRTTSGVMLQNCQYVDYGFFGNLEVLSPKAFGVLVGSMDTCYTEVDWKVGIKGGKYGPMGEDLFMEICMSKNGVHKVEAFDITTDGACEAKRPTDQKKDKKWHSDCTVKTPAMHPFKKPKDYFECLDTTMAL
Ga0073979_1244742313300031037MarineFIQVWKAIGDAGAYKGYDWVVKADADTVFIPERLRDRIQWMPRTMSGSVLQNCQYVDYGFFGNLEVFSNLAFGILVQNVDTCRTTLDWKKGVEGGKYGPMGEDLFAEVCMEKNGVDKVEAFDVTIDGACPQKRPEDQKKNKKWKSDCKITAPAMHPFKTPTDWLTCFDQTMAM
Ga0073948_194160713300031052MarineNAYSNHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKAFGVLVGSLDTCYTEVDWKVGVKDGKYGPMGEDLFAEVCMSKNGVHKVEAFDVTTDGACPAKRPKDQAKNKKWHSDCNVKTPAMHPFKKPKDWFECFDKTMAL
Ga0138346_1053457613300031056MarineFIQVWKAIADTNAHAGMDWVVKVDPDAVFVPERLRDRIQWMPRTTNGIMLQNCRYVDYGFFGNLEVLSPKAFSVLTDSLETCYTQIDWKVGIKGGKYGPMGEDLFAEICMSKGGVHYVEAFDVTTDGACEANRPMDERKNKKWHSDCKVKTAAMHPFKKPKDYFECLDQTMALA
Ga0138346_1096938213300031056MarineQNCKYVDYGFFGNLEVLSPKAFSVLTDSLETCYTSLDWKVGVKGGKFGPMGEDLFAEICMSKNGVHYVEAFDVSTDGACEANRPLDQKKNKKWHSDCKVKTAAMHPFKKPKDWFECFDQTMAM
Ga0307388_1066912113300031522MarineWHFAKRKETGSWVNTGMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGSMLQNCQYVDYGFFGNLEVLSGKAFQVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDISVDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDKTMAL
Ga0307388_1108357613300031522MarineTDVVGDWHFAKRKETGAWVNTGIFIQVWKAIGEANAYSSHDWVVKVDPDAVFVPERLRERIQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSAKAFGVLVGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHMVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPF
Ga0307388_1114152713300031522MarineVKVDADAVFVPERLQERIQWMPRTTGGTMLQNCQYVDYGFLGNLEVLSGKAFEVLLGNLDSCYTDVDWKEGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVNVPAMHPFKKPAAYFECLDTTMAL
Ga0307393_110879413300031674MarineTGIFIQVWKAIGEANAYSSHDWVVKVDPDAVFVPERLRERIQWMPRTTTGVMLQNCEYVDYGFFGNLEVISAKGFGVLVGSLDTCYTEIDWKVGVKDGKYGPMGEDLFAELCMSKNGVDKVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAM
Ga0307396_1035987923300031717MarineGSWVNTGMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGSMLQNCQYVDYGFFGNLEVLSGKAFQVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDTTMA
Ga0307396_1051872213300031717MarineLGGGFVTKKVTDVVGDWHFAKRKETGAWVNTGIFIQVWKAISEANAYSSHDWVVKVDPDAVFVPERLRERIQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSAKAFGVLVGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHMVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPF
Ga0307396_1057136513300031717MarineTDVVGDWHFAKRKETGAWVNTGIFIQVWKAIGEANAYSSHDWVVKVDPDAVFVPERLSERIQWMPRTTTGVMLQNCEYVDYGFFGNLEVISAKGFGVLVGSLDTCYTEIDWKVGVKDGKYGPMGEDLFAELCMSKNGVDKVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPF
Ga0307394_1035250813300031735MarineAYDVYSDVEVSLGEGFVTKKVTDVVGDWHFAKRKETGAWVNTGIFIQVWKAVAEAQVYSSHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKT
Ga0307394_1037836613300031735MarineMPRTTTGVMLQNCEYVDYGFFGNLEVISAKGFGVLVGSLDTCYTEIDWKVGVKDGKYGPMGEDLFAELCMSKNGVDKVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0307387_1071217913300031737MarineIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGSMLQNCQYVDYGFFGNLEVLSGKAFEVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDTTMAL
Ga0307387_1105537413300031737MarineVFVPERLQERIQWMPRTTGGSMLQNCQYVDYGFFGNLEVLSQKAFQVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDISVDGACPAKRPEDERKNKKWKSDCNVKVPAMHPFKKPAAYFECLDTTMAL
Ga0307383_1060296513300031739MarineLEVFSQKAFSVLVANMDTCYTEVPWKVGIKNGKYGPMGEDLFAEICMEKNGVDKVEAFDVTTDGACEAKRPTDEKKNKMWHSDCKVKSPAMHPFKKPKDYFKCLDQTMAM
Ga0307395_1038479413300031742MarineWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0307395_1046665413300031742MarineKKVTDVVGDWHFAKRKETGAWVNTGIFIQVWKAISEANAYSSHDWVVKVDPDAVFVPERLRERIQWMPRTTSGVMLQNCEYVDYGFFGNLEVISAKGFGVLVGSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHMVEAFDITTDGACPAKRPKDQVKNKKWHSDCKVKTPAMHPF
Ga0314668_1059768713300032481SeawaterDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0314680_1046356213300032521SeawaterGFVTKKVTDVVGDWHFAKRKETGAWVNTGIFIQVWKAVAEAQVYSSHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0314680_1062515213300032521SeawaterVAEAQVYSSHDWVVKVDADAVFVPERLQDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAA
Ga0314682_1045563713300032540SeawaterWKAVAEAQVNSSHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQNCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAA
Ga0314673_1049037913300032650SeawaterVPERLQDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAA
Ga0314669_1034280913300032708SeawaterVSLGEGFVTKKVTDVVGDWHFAKRKETGAWVNTGIFIQVWKAVAEAQVYSSHDWVVKVDADAVFVPERLRDRIQWMPRTTSGVMLQTCEFVDYGFFGNLEVISTKAFGVLVDSLDTCYTEVDWKVGVKGGKYGPMGEDLFAEICMSKNGVHKVEAFDTTTDGACPAKRPTDQAKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAL
Ga0314669_1043329613300032708SeawaterFIQVWKAVAEAQVYSSHDWVVKVDADAVFVPERLQDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAA
Ga0314690_1031114713300032713SeawaterVSLGGGFVTKKVTDVVGDWHFAKRKETGAWVNTGIFIQVWKAVAEAQVYSSHDWVVKVDADAVFVPERLQDRIQWMPRTTSGVMLQNCEYVDYGFFGNLEVLSTKAFDVLVDSLDTCYTEVDWKVGVKNGKYGPMGEDLFAEICMSKNGVHKVEAFDVTTDGACPAKRPKDQTKNKKWHSDCKVKTPAMHPFKKPKDWFECFDQTMAA
Ga0307390_1064121513300033572MarineGSWVNTGMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGSMLQNCQYVDYGFFGNLEVLSGKAFQVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDISVDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDTTMA
Ga0307390_1082343813300033572MarineETGSWVNTGMFIQVWKAIGEANVYQNYDWVVKVDADAVFVPERLQERIQWMPRTTGGTMLQNCQYVDYGFFGNLEVLSGKAFEVLLGNLDSCYTDVDWKVGVKDGKYGPMGEDLFAEICMAANGVDKVEAFDVSIDGACPAKRPEDEKKNKKWKSDCNVKVPAMHPFKKPAAYFECLDKTMAL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.