Metagenome Family F012027

Basic Information
Family ID	F012027
Family Type	Metagenome
Number of Sequences	284
Average Sequence Length	41 residues
Representative Sequence	MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAAQKVW
Number of Associated Samples	82
Number of Associated Scaffolds	284

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.35 %
% of genes near scaffold ends (potentially truncated)	37.32 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	80
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Most Common Taxonomy
Group	Unclassified (62.676 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (92.958 % of family members)
Environment Ontology (ENVO)	Unclassified (93.662 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (93.662 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 284 Family Scaffolds
PF04195	Transposase_28	3.17

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
All Organisms	root	All Organisms	37.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
cellular organisms	root	All Organisms → cellular organisms	37.32 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	30.28 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	6.69 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	30.28 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	6.34 %
TACK group	clade	All Organisms → cellular organisms → Archaea → TACK group	0.35 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	30.28 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6.34 %
Thaumarchaeota	phylum	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota	0.35 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	30.28 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	6.34 %
Nitrososphaeria	class	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria	0.35 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	30.28 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6.34 %
Nitrososphaerales	order	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales	0.35 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	30.28 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	5.99 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.35 %
Nitrososphaeraceae	family	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	5.99 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.35 %
Candidatus Nitrosocosmicus	genus	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	5.99 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5.99 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	5.99 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	5.99 %
Spirurina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	5.99 %
Spiruromorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	5.99 %
Filarioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	5.99 %
Setariidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	5.99 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	2.46 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	2.46 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	2.11 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.35 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	2.11 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.35 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	1.41 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.35 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1.41 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.35 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.70 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.35 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	62.68 %
Pseudomonas helleri	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	30.28 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.70 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.35 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	0.35 %
Candidatus Nitrosocosmicus oleophilus	species	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	0.35 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005338\|Ga0068868_100776822	Not Available	862	Open in IMG/M
3300005459\|Ga0068867_102277892	Not Available	515	Open in IMG/M
3300005459\|Ga0068867_102334990	Not Available	508	Open in IMG/M
3300005614\|Ga0068856_102318444	Not Available	545	Open in IMG/M
3300005718\|Ga0068866_10567029	Not Available	761	Open in IMG/M
3300005718\|Ga0068866_10570256	Not Available	760	Open in IMG/M
3300005718\|Ga0068866_11434307	Not Available	506	Open in IMG/M
3300006358\|Ga0068871_102065332	Not Available	543	Open in IMG/M
3300011119\|Ga0105246_11789827	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	586	Open in IMG/M
3300013296\|Ga0157374_11818238	Not Available	635	Open in IMG/M
3300013296\|Ga0157374_12727529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	522	Open in IMG/M
3300013297\|Ga0157378_10817461	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	958	Open in IMG/M
3300013297\|Ga0157378_11230879	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	789	Open in IMG/M
3300014969\|Ga0157376_12271856	Not Available	581	Open in IMG/M
3300015267\|Ga0182122_1040024	Not Available	594	Open in IMG/M
3300015267\|Ga0182122_1072540	Not Available	502	Open in IMG/M
3300015268\|Ga0182154_1019645	Not Available	720	Open in IMG/M
3300015268\|Ga0182154_1022552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	696	Open in IMG/M
3300015268\|Ga0182154_1068943	Not Available	512	Open in IMG/M
3300015268\|Ga0182154_1072742	Not Available	504	Open in IMG/M
3300015268\|Ga0182154_1073154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	503	Open in IMG/M
3300015269\|Ga0182113_1026666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	738	Open in IMG/M
3300015269\|Ga0182113_1038384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	665	Open in IMG/M
3300015269\|Ga0182113_1041488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	650	Open in IMG/M
3300015269\|Ga0182113_1072664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	551	Open in IMG/M
3300015274\|Ga0182188_1020228	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	674	Open in IMG/M
3300015274\|Ga0182188_1020813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	669	Open in IMG/M
3300015274\|Ga0182188_1030017	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	609	Open in IMG/M
3300015274\|Ga0182188_1036055	Not Available	582	Open in IMG/M
3300015275\|Ga0182172_1017632	Not Available	756	Open in IMG/M
3300015275\|Ga0182172_1062746	Not Available	535	Open in IMG/M
3300015276\|Ga0182170_1008744	Not Available	917	Open in IMG/M
3300015276\|Ga0182170_1021243	Not Available	725	Open in IMG/M
3300015276\|Ga0182170_1046568	Not Available	584	Open in IMG/M
3300015276\|Ga0182170_1050128	Not Available	572	Open in IMG/M
3300015276\|Ga0182170_1054164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	559	Open in IMG/M
3300015276\|Ga0182170_1076060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	505	Open in IMG/M
3300015277\|Ga0182128_1004744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	1092	Open in IMG/M
3300015277\|Ga0182128_1022893	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	715	Open in IMG/M
3300015277\|Ga0182128_1043323	Not Available	600	Open in IMG/M
3300015277\|Ga0182128_1048938	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	580	Open in IMG/M
3300015277\|Ga0182128_1071574	Not Available	519	Open in IMG/M
3300015277\|Ga0182128_1072823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	516	Open in IMG/M
3300015277\|Ga0182128_1076410	Not Available	509	Open in IMG/M
3300015279\|Ga0182174_1004124	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	1172	Open in IMG/M
3300015279\|Ga0182174_1021712	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	745	Open in IMG/M
3300015279\|Ga0182174_1041454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	624	Open in IMG/M
3300015279\|Ga0182174_1059881	Not Available	561	Open in IMG/M
3300015279\|Ga0182174_1064077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	550	Open in IMG/M
3300015279\|Ga0182174_1070456	Not Available	535	Open in IMG/M
3300015279\|Ga0182174_1074989	Not Available	524	Open in IMG/M
3300015281\|Ga0182160_1014567	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	819	Open in IMG/M
3300015281\|Ga0182160_1037306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	635	Open in IMG/M
3300015281\|Ga0182160_1061351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	552	Open in IMG/M
3300015282\|Ga0182124_1019337	Not Available	753	Open in IMG/M
3300015282\|Ga0182124_1029361	Not Available	674	Open in IMG/M
3300015282\|Ga0182124_1041507	Not Available	614	Open in IMG/M
3300015283\|Ga0182156_1030857	Not Available	682	Open in IMG/M
3300015283\|Ga0182156_1037198	Not Available	647	Open in IMG/M
3300015283\|Ga0182156_1059214	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	567	Open in IMG/M
3300015283\|Ga0182156_1083491	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	510	Open in IMG/M
3300015285\|Ga0182186_1035509	Not Available	645	Open in IMG/M
3300015286\|Ga0182176_1013792	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	898	Open in IMG/M
3300015286\|Ga0182176_1018860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	808	Open in IMG/M
3300015286\|Ga0182176_1020882	Not Available	782	Open in IMG/M
3300015286\|Ga0182176_1027224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	719	Open in IMG/M
3300015286\|Ga0182176_1077496	Not Available	519	Open in IMG/M
3300015286\|Ga0182176_1083982	Not Available	505	Open in IMG/M
3300015287\|Ga0182171_1013439	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	852	Open in IMG/M
3300015288\|Ga0182173_1071020	Not Available	533	Open in IMG/M
3300015289\|Ga0182138_1004307	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1167	Open in IMG/M
3300015289\|Ga0182138_1021907	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	750	Open in IMG/M
3300015289\|Ga0182138_1049769	Not Available	598	Open in IMG/M
3300015289\|Ga0182138_1071583	Not Available	538	Open in IMG/M
3300015289\|Ga0182138_1090676	Not Available	500	Open in IMG/M
3300015291\|Ga0182125_1022898	Not Available	758	Open in IMG/M
3300015292\|Ga0182141_1055213	Not Available	590	Open in IMG/M
3300015292\|Ga0182141_1066783	Not Available	558	Open in IMG/M
3300015292\|Ga0182141_1076616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	536	Open in IMG/M
3300015292\|Ga0182141_1078370	Not Available	532	Open in IMG/M
3300015292\|Ga0182141_1090421	Not Available	509	Open in IMG/M
3300015294\|Ga0182126_1048161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	618	Open in IMG/M
3300015294\|Ga0182126_1056221	Not Available	591	Open in IMG/M
3300015294\|Ga0182126_1065127	Not Available	565	Open in IMG/M
3300015294\|Ga0182126_1071894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	549	Open in IMG/M
3300015294\|Ga0182126_1081183	Not Available	529	Open in IMG/M
3300015295\|Ga0182175_1024342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	756	Open in IMG/M
3300015295\|Ga0182175_1036861	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	673	Open in IMG/M
3300015295\|Ga0182175_1051538	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	612	Open in IMG/M
3300015295\|Ga0182175_1097384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	504	Open in IMG/M
3300015296\|Ga0182157_1031268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	715	Open in IMG/M
3300015296\|Ga0182157_1093405	Not Available	519	Open in IMG/M
3300015296\|Ga0182157_1097991	Not Available	511	Open in IMG/M
3300015298\|Ga0182106_1046449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	640	Open in IMG/M
3300015298\|Ga0182106_1055031	Not Available	610	Open in IMG/M
3300015298\|Ga0182106_1060843	Not Available	591	Open in IMG/M
3300015298\|Ga0182106_1067052	Not Available	574	Open in IMG/M
3300015298\|Ga0182106_1090886	Not Available	523	Open in IMG/M
3300015299\|Ga0182107_1023532	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	780	Open in IMG/M
3300015299\|Ga0182107_1064159	Not Available	585	Open in IMG/M
3300015299\|Ga0182107_1072590	Not Available	563	Open in IMG/M
3300015299\|Ga0182107_1076456	Not Available	555	Open in IMG/M
3300015300\|Ga0182108_1024175	Not Available	781	Open in IMG/M
3300015300\|Ga0182108_1038384	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	685	Open in IMG/M
3300015300\|Ga0182108_1104164	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	506	Open in IMG/M
3300015302\|Ga0182143_1014855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	883	Open in IMG/M
3300015302\|Ga0182143_1051563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	624	Open in IMG/M
3300015302\|Ga0182143_1103707	Not Available	503	Open in IMG/M
3300015303\|Ga0182123_1022237	Not Available	766	Open in IMG/M
3300015303\|Ga0182123_1035441	Not Available	675	Open in IMG/M
3300015303\|Ga0182123_1047683	Not Available	622	Open in IMG/M
3300015303\|Ga0182123_1066819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	565	Open in IMG/M
3300015303\|Ga0182123_1091831	Not Available	514	Open in IMG/M
3300015304\|Ga0182112_1010626	Not Available	969	Open in IMG/M
3300015304\|Ga0182112_1022882	Not Available	788	Open in IMG/M
3300015304\|Ga0182112_1053571	Not Available	618	Open in IMG/M
3300015304\|Ga0182112_1070123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	571	Open in IMG/M
3300015304\|Ga0182112_1096816	Not Available	517	Open in IMG/M
3300015305\|Ga0182158_1028884	Not Available	734	Open in IMG/M
3300015305\|Ga0182158_1068867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	572	Open in IMG/M
3300015307\|Ga0182144_1025543	Not Available	772	Open in IMG/M
3300015307\|Ga0182144_1036565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	697	Open in IMG/M
3300015308\|Ga0182142_1057435	Not Available	624	Open in IMG/M
3300015308\|Ga0182142_1073813	Not Available	578	Open in IMG/M
3300015308\|Ga0182142_1076431	Not Available	572	Open in IMG/M
3300015308\|Ga0182142_1086678	Not Available	550	Open in IMG/M
3300015308\|Ga0182142_1099046	Not Available	527	Open in IMG/M
3300015314\|Ga0182140_1027699	Not Available	770	Open in IMG/M
3300015314\|Ga0182140_1111543	Not Available	509	Open in IMG/M
3300015314\|Ga0182140_1117432	Not Available	500	Open in IMG/M
3300015321\|Ga0182127_1052994	Not Available	658	Open in IMG/M
3300015321\|Ga0182127_1054593	Not Available	652	Open in IMG/M
3300015321\|Ga0182127_1072241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	599	Open in IMG/M
3300015321\|Ga0182127_1088628	Not Available	562	Open in IMG/M
3300015321\|Ga0182127_1103715	Not Available	533	Open in IMG/M
3300015322\|Ga0182110_1061383	Not Available	628	Open in IMG/M
3300015323\|Ga0182129_1025588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	787	Open in IMG/M
3300015323\|Ga0182129_1035780	Not Available	715	Open in IMG/M
3300015323\|Ga0182129_1058871	Not Available	618	Open in IMG/M
3300015323\|Ga0182129_1096378	Not Available	533	Open in IMG/M
3300015341\|Ga0182187_1079220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	700	Open in IMG/M
3300015341\|Ga0182187_1101286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	643	Open in IMG/M
3300015341\|Ga0182187_1106138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	632	Open in IMG/M
3300015342\|Ga0182109_1098635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	683	Open in IMG/M
3300015342\|Ga0182109_1124561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	628	Open in IMG/M
3300015342\|Ga0182109_1156313	Not Available	577	Open in IMG/M
3300015342\|Ga0182109_1223911	Not Available	501	Open in IMG/M
3300015343\|Ga0182155_1211847	Not Available	514	Open in IMG/M
3300015344\|Ga0182189_1035206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	983	Open in IMG/M
3300015344\|Ga0182189_1056161	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	840	Open in IMG/M
3300015344\|Ga0182189_1193383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	537	Open in IMG/M
3300015344\|Ga0182189_1200978	Not Available	529	Open in IMG/M
3300015345\|Ga0182111_1085713	Not Available	749	Open in IMG/M
3300015345\|Ga0182111_1206617	Not Available	537	Open in IMG/M
3300015345\|Ga0182111_1210081	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	534	Open in IMG/M
3300015346\|Ga0182139_1062750	Not Available	840	Open in IMG/M
3300015346\|Ga0182139_1121969	Not Available	659	Open in IMG/M
3300015347\|Ga0182177_1109942	Not Available	687	Open in IMG/M
3300015347\|Ga0182177_1161712	Not Available	594	Open in IMG/M
3300015347\|Ga0182177_1185929	Not Available	563	Open in IMG/M
3300015347\|Ga0182177_1186144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	563	Open in IMG/M
3300015347\|Ga0182177_1212318	Not Available	535	Open in IMG/M
3300015351\|Ga0182161_1103571	Not Available	731	Open in IMG/M
3300015351\|Ga0182161_1162619	Not Available	614	Open in IMG/M
3300015351\|Ga0182161_1201029	Not Available	564	Open in IMG/M
3300015351\|Ga0182161_1227618	Not Available	536	Open in IMG/M
3300015351\|Ga0182161_1233032	Not Available	531	Open in IMG/M
3300015351\|Ga0182161_1253005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	514	Open in IMG/M
3300015355\|Ga0182159_1111973	Not Available	819	Open in IMG/M
3300015355\|Ga0182159_1150998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	724	Open in IMG/M
3300015355\|Ga0182159_1163925	Not Available	699	Open in IMG/M
3300015355\|Ga0182159_1234804	Not Available	600	Open in IMG/M
3300015355\|Ga0182159_1254335	Not Available	579	Open in IMG/M
3300015355\|Ga0182159_1255622	Not Available	578	Open in IMG/M
3300015355\|Ga0182159_1257094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	576	Open in IMG/M
3300015355\|Ga0182159_1262931	Not Available	571	Open in IMG/M
3300015355\|Ga0182159_1280283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	555	Open in IMG/M
3300015355\|Ga0182159_1287183	Not Available	549	Open in IMG/M
3300015355\|Ga0182159_1289284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	547	Open in IMG/M
3300015355\|Ga0182159_1294109	Not Available	543	Open in IMG/M
3300015355\|Ga0182159_1297073	Not Available	541	Open in IMG/M
3300015355\|Ga0182159_1339254	Not Available	510	Open in IMG/M
3300015355\|Ga0182159_1341958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	508	Open in IMG/M
3300015361\|Ga0182145_1003937	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1640	Open in IMG/M
3300015361\|Ga0182145_1072704	Not Available	699	Open in IMG/M
3300015361\|Ga0182145_1099085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	631	Open in IMG/M
3300015361\|Ga0182145_1132617	Not Available	572	Open in IMG/M
3300015361\|Ga0182145_1179361	Not Available	516	Open in IMG/M
3300015361\|Ga0182145_1194818	Not Available	502	Open in IMG/M
3300017404\|Ga0182203_1124656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	551	Open in IMG/M
3300017404\|Ga0182203_1130412	Not Available	543	Open in IMG/M
3300017404\|Ga0182203_1158701	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	507	Open in IMG/M
3300017407\|Ga0182220_1046572	Not Available	638	Open in IMG/M
3300017407\|Ga0182220_1080055	Not Available	549	Open in IMG/M
3300017407\|Ga0182220_1081379	Not Available	546	Open in IMG/M
3300017409\|Ga0182204_1019169	Not Available	864	Open in IMG/M
3300017409\|Ga0182204_1021958	Not Available	831	Open in IMG/M
3300017409\|Ga0182204_1087559	Not Available	555	Open in IMG/M
3300017409\|Ga0182204_1121256	Not Available	500	Open in IMG/M
3300017410\|Ga0182207_1030151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	892	Open in IMG/M
3300017410\|Ga0182207_1057749	Not Available	728	Open in IMG/M
3300017410\|Ga0182207_1125182	Not Available	566	Open in IMG/M
3300017410\|Ga0182207_1133296	Not Available	554	Open in IMG/M
3300017410\|Ga0182207_1159831	Not Available	520	Open in IMG/M
3300017411\|Ga0182208_1056984	Not Available	649	Open in IMG/M
3300017411\|Ga0182208_1069020	Not Available	613	Open in IMG/M
3300017411\|Ga0182208_1070185	Not Available	610	Open in IMG/M
3300017411\|Ga0182208_1090934	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	563	Open in IMG/M
3300017411\|Ga0182208_1098192	Not Available	549	Open in IMG/M
3300017411\|Ga0182208_1113765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	524	Open in IMG/M
3300017413\|Ga0182222_1018168	Not Available	795	Open in IMG/M
3300017413\|Ga0182222_1069676	Not Available	565	Open in IMG/M
3300017413\|Ga0182222_1077006	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	550	Open in IMG/M
3300017413\|Ga0182222_1094961	Not Available	520	Open in IMG/M
3300017415\|Ga0182202_1014218	Not Available	1009	Open in IMG/M
3300017415\|Ga0182202_1071819	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	623	Open in IMG/M
3300017415\|Ga0182202_1104309	Not Available	553	Open in IMG/M
3300017415\|Ga0182202_1104950	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	552	Open in IMG/M
3300017417\|Ga0182230_1073541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	613	Open in IMG/M
3300017417\|Ga0182230_1074098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	611	Open in IMG/M
3300017417\|Ga0182230_1079374	Not Available	593	Open in IMG/M
3300017420\|Ga0182228_1111141	Not Available	531	Open in IMG/M
3300017420\|Ga0182228_1127070	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	506	Open in IMG/M
3300017424\|Ga0182219_1086976	Not Available	584	Open in IMG/M
3300017425\|Ga0182224_1029606	Not Available	857	Open in IMG/M
3300017425\|Ga0182224_1031375	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	843	Open in IMG/M
3300017425\|Ga0182224_1041841	Not Available	775	Open in IMG/M
3300017425\|Ga0182224_1076561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	644	Open in IMG/M
3300017425\|Ga0182224_1107287	Not Available	579	Open in IMG/M
3300017425\|Ga0182224_1110079	Not Available	575	Open in IMG/M
3300017425\|Ga0182224_1149603	Not Available	519	Open in IMG/M
3300017427\|Ga0182190_1071585	Not Available	669	Open in IMG/M
3300017427\|Ga0182190_1076501	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	654	Open in IMG/M
3300017427\|Ga0182190_1111915	Not Available	575	Open in IMG/M
3300017427\|Ga0182190_1113692	Not Available	572	Open in IMG/M
3300017427\|Ga0182190_1124770	Not Available	554	Open in IMG/M
3300017427\|Ga0182190_1145406	Not Available	525	Open in IMG/M
3300017427\|Ga0182190_1159185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	508	Open in IMG/M
3300017427\|Ga0182190_1164722	Not Available	502	Open in IMG/M
3300017430\|Ga0182192_1049223	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	775	Open in IMG/M
3300017430\|Ga0182192_1113051	Not Available	584	Open in IMG/M
3300017430\|Ga0182192_1116966	Not Available	577	Open in IMG/M
3300017430\|Ga0182192_1143399	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	537	Open in IMG/M
3300017433\|Ga0182206_1134195	Not Available	531	Open in IMG/M
3300017433\|Ga0182206_1151700	Not Available	510	Open in IMG/M
3300017436\|Ga0182209_1074778	Not Available	660	Open in IMG/M
3300017436\|Ga0182209_1140052	Not Available	540	Open in IMG/M
3300017436\|Ga0182209_1161695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	514	Open in IMG/M
3300017436\|Ga0182209_1166165	Not Available	509	Open in IMG/M
3300017438\|Ga0182191_1094278	Not Available	629	Open in IMG/M
3300017438\|Ga0182191_1160560	Not Available	526	Open in IMG/M
3300017442\|Ga0182221_1048757	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	739	Open in IMG/M
3300017442\|Ga0182221_1067551	Not Available	670	Open in IMG/M
3300017442\|Ga0182221_1105365	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	585	Open in IMG/M
3300017442\|Ga0182221_1149662	Not Available	524	Open in IMG/M
3300017442\|Ga0182221_1151211	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	522	Open in IMG/M
3300017442\|Ga0182221_1158328	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	514	Open in IMG/M
3300017443\|Ga0182193_1124304	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	591	Open in IMG/M
3300017443\|Ga0182193_1130633	Not Available	581	Open in IMG/M
3300017443\|Ga0182193_1164665	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	536	Open in IMG/M
3300017680\|Ga0182233_1072926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	617	Open in IMG/M
3300017680\|Ga0182233_1091124	Not Available	559	Open in IMG/M
3300017680\|Ga0182233_1111038	Not Available	512	Open in IMG/M
3300017682\|Ga0182229_1047075	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	731	Open in IMG/M
3300017682\|Ga0182229_1062349	Not Available	636	Open in IMG/M
3300017682\|Ga0182229_1085917	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Setariidae → Setaria	550	Open in IMG/M
3300017683\|Ga0182218_1086186	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	602	Open in IMG/M
3300017683\|Ga0182218_1104452	Not Available	567	Open in IMG/M
3300017683\|Ga0182218_1126065	Not Available	535	Open in IMG/M
3300017683\|Ga0182218_1141010	Not Available	516	Open in IMG/M
3300017683\|Ga0182218_1150497	Not Available	506	Open in IMG/M
3300017684\|Ga0182225_1067765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	636	Open in IMG/M
3300017684\|Ga0182225_1074290	Not Available	618	Open in IMG/M
3300017685\|Ga0182227_1104732	Not Available	555	Open in IMG/M
3300017686\|Ga0182205_1113598	Not Available	579	Open in IMG/M
3300017686\|Ga0182205_1140886	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	537	Open in IMG/M
3300017686\|Ga0182205_1151730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	524	Open in IMG/M
3300017690\|Ga0182223_1036715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas helleri	703	Open in IMG/M
3300021060\|Ga0182232_1055064	Not Available	657	Open in IMG/M
3300021060\|Ga0182232_1060197	Not Available	625	Open in IMG/M
3300025899\|Ga0207642_11127300	Not Available	508	Open in IMG/M
3300025940\|Ga0207691_10228570	All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus	1611	Open in IMG/M
3300026089\|Ga0207648_10572689	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1039	Open in IMG/M
3300026089\|Ga0207648_11250847	Not Available	697	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.66%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.52%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.46%
Roots	Host-Associated → Plants → Roots	0.35%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.66%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.52%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.11%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.35%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.35%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.66%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.52%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.11%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.35%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	92.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.76%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.70%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.35%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068868_1007768221	3300005338	Miscanthus Rhizosphere	MGKKKTASKSQATFIDEESSLSLIENQEFVAMRAAQKVWPAPTTSEDQLR
Ga0068867_1022778922	3300005459	Miscanthus Rhizosphere	MGWKKAASKSQAAFVDEESSLSVIENQEFMAMRAAQKVWP
Ga0068867_1023349902	3300005459	Miscanthus Rhizosphere	MGKKKTASKSQATFVDEESSLSLIENLEFVAMRAAQKVWPAPTTSEDQL
Ga0068856_1023184441	3300005614	Corn Rhizosphere	MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTTSEDQ
Ga0068866_105670291	3300005718	Miscanthus Rhizosphere	MGKKKTTSKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTTSED
Ga0068866_105702562	3300005718	Miscanthus Rhizosphere	MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTTT
Ga0068866_114343072	3300005718	Miscanthus Rhizosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWL
Ga0068871_1020653321	3300006358	Miscanthus Rhizosphere	MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAAQKVW
Ga0105246_117898271	3300011119	Miscanthus Rhizosphere	MGKKKTASKSQAAFVDEESSLSLIENQEFVAMRAAQKVWPSPTTSED*
Ga0157374_118182381	3300013296	Miscanthus Rhizosphere	MCRKKSASKSQAAFVDEEASLFVIENQEFMAMRAAQKI*
Ga0157374_127275292	3300013296	Miscanthus Rhizosphere	RKKSASKSQTTFVDKEASLSMIENQEFMAMRAAQKI*
Ga0157378_108174612	3300013297	Miscanthus Rhizosphere	MGKKKTASKSQATFVDEESSLSLIENLEFVAMRAAQKVWPAPTTSED*
Ga0157378_112308791	3300013297	Miscanthus Rhizosphere	MGKKKAASKSQATFVDEELSLFVIENQEFVAMRAA*
Ga0157376_122718561	3300014969	Miscanthus Rhizosphere	MGKKKAVNKSQAAFVDEESSLSVIENQEFMAMRAA*
Ga0182122_10400241	3300015267	Miscanthus Phyllosphere	MGKKKTTSKSQAAFVDEESSLSLIENQEFMAMRAA*
Ga0182122_10725402	3300015267	Miscanthus Phyllosphere	MGRKKTVSKSQAAFVDEESSLSLIENQEFVAMRAA*
Ga0182154_10196451	3300015268	Miscanthus Phyllosphere	MGRKKSTSKSQATFVDEEASLSVTENQEFMAMRAAQKV*
Ga0182154_10225521	3300015268	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIENQEFVGMRAAQKVWPAPTTSED*
Ga0182154_10689431	3300015268	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEKASLSMIENQEFMAMRAAQKIWPAPTMTEDQL
Ga0182154_10727422	3300015268	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTT
Ga0182154_10731542	3300015268	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAA*
Ga0182113_10266661	3300015269	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTED*
Ga0182113_10383841	3300015269	Miscanthus Phyllosphere	MGRKKAVSKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPTTTKD*
Ga0182113_10414881	3300015269	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSMIENQEFVAIRAAQKSWPAPTTTED*
Ga0182113_10726642	3300015269	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSMIENQEFMAMRAA*
Ga0182188_10202283	3300015274	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEESSLSMIENQEFMAMRAAQKAWPAPTTTKD*
Ga0182188_10208132	3300015274	Miscanthus Phyllosphere	MGRKKAASKSQVAFVDEESSLFVIENQEFMAMRAAQKVWLAPTMTKD*
Ga0182188_10300171	3300015274	Miscanthus Phyllosphere	MGRKKSASKSQVAFVDEEASLSVIENQEFMAMRAAQKI*
Ga0182188_10360552	3300015274	Miscanthus Phyllosphere	MGRKKLASKSQATFVNEEASISVIENQEFMAMRAAQKVWPA
Ga0182172_10176322	3300015275	Miscanthus Phyllosphere	GRKKSVSKSQATFVDKEALFSTIENQEFMAMRAA*
Ga0182172_10627463	3300015275	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKI*
Ga0182170_10087442	3300015276	Miscanthus Phyllosphere	MGKNKTMSKSQSNFVDEESSLFVIENQEFMAMRAAQKAWPAPM
Ga0182170_10212431	3300015276	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAAQKVWPAPTTNEDQL
Ga0182170_10465681	3300015276	Miscanthus Phyllosphere	MGRKKLASKSQAAFVDEETSLSVIENQEFKAMRATQKIWP
Ga0182170_10501281	3300015276	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRVAQKVWPA
Ga0182170_10541642	3300015276	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEGSLSMIENQEFMAIRAA*
Ga0182170_10760602	3300015276	Miscanthus Phyllosphere	MGRKKSASKSQVAFVDEEASLSVIENQELMAMRVAQKI*
Ga0182128_10047442	3300015277	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKVWPAPTTTED*
Ga0182128_10228932	3300015277	Miscanthus Phyllosphere	MGRKKPASKSQAAFVDEESSLSGIENQEFMAMRAA*
Ga0182128_10433231	3300015277	Miscanthus Phyllosphere	MGRKKSTSKSQATFVDEEASLSVIENQEFIAMRAAQKIWPAPT
Ga0182128_10489381	3300015277	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSIIENQEFMAMRVAQKI*
Ga0182128_10715742	3300015277	Miscanthus Phyllosphere	MGRMKATSKSQATFVDKESSLFVIENKEFVAMRLPRKLGCL
Ga0182128_10728231	3300015277	Miscanthus Phyllosphere	MGRKKSASQSQATFVDEEASLSVIENQEFMAMRAAQKI*
Ga0182128_10764101	3300015277	Miscanthus Phyllosphere	MGRKKTVSKSQAAFVDKESSLSVIENQEFVAMRAA*
Ga0182174_10041242	3300015279	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKI*
Ga0182174_10217122	3300015279	Miscanthus Phyllosphere	MGRKKAMSKSQAAFVDEESSLFMIENQEFMAMRVAQKVWSAPTTTED*
Ga0182174_10414542	3300015279	Miscanthus Phyllosphere	MGKKKAVSKSQSTFVDEESSLSMIENQEFMAMRAA*
Ga0182174_10598811	3300015279	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLFVIENQEFMAMRAAQKVWP
Ga0182174_10640771	3300015279	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPTPTTSED*
Ga0182174_10704561	3300015279	Miscanthus Phyllosphere	MGRKKVTSKSQAAFVDEESSLSVIENQEFMAMRAA*
Ga0182174_10749891	3300015279	Miscanthus Phyllosphere	MGRKKLASKSQAAFVDEETSLSVIENQEFMAMRAAQKIWLAPT
Ga0182160_10145672	3300015281	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSMIENQEFMAMRAAQKIWPALTTTED*
Ga0182160_10373062	3300015281	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAT*
Ga0182160_10613511	3300015281	Miscanthus Phyllosphere	MGRKKSASKSQATFVNEEASLSVIENQEFMAMRAA*
Ga0182124_10193371	3300015282	Miscanthus Phyllosphere	MGRKKATSKSQAAFVDEESSLSVIENQEFMAIRAAQKVWPALTMTED*
Ga0182124_10293611	3300015282	Miscanthus Phyllosphere	MGKKKTTSKSQATFVDEESSLSLIQNQEFVAMRAAQKV
Ga0182124_10415071	3300015282	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAP
Ga0182156_10308571	3300015283	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKV*
Ga0182156_10371981	3300015283	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTE
Ga0182156_10592142	3300015283	Miscanthus Phyllosphere	MGRKKATSKSQAAFVDEESSLFVIENQEFMAMRAA*
Ga0182156_10834911	3300015283	Miscanthus Phyllosphere	MGRKKLTSKSQAAFVDEEASLFVIENQEFMAMRAA*
Ga0182186_10355091	3300015285	Miscanthus Phyllosphere	MGRKKSASKSQTTFVDEEASLSVIENQEFMAMRAAQKIWPAPTMTKD*
Ga0182176_10137921	3300015286	Miscanthus Phyllosphere	MGRKKATSKSQATFMDEESSLSVIENQEFVTMRAT*
Ga0182176_10188604	3300015286	Miscanthus Phyllosphere	AASKSQATFVDEESSLSVIENHEFVAMRAAQKAWPTPTTTED*
Ga0182176_10208821	3300015286	Miscanthus Phyllosphere	MGRKKAASKSQATFVDEESSLSVIENQEFVAMRVAQKAWPAPTMT
Ga0182176_10272241	3300015286	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPTTTED*
Ga0182176_10774961	3300015286	Miscanthus Phyllosphere	MGKKKTASKSQTTFVDEESSLTLIENQEFVAMRAAQKVWPAPT
Ga0182176_10839821	3300015286	Miscanthus Phyllosphere	MGKKKTASKSQSSFMDEESSLSVIENQEFVAMRAAQKSW
Ga0182171_10134391	3300015287	Miscanthus Phyllosphere	MGRKKAASKSQASFVDEESSLSMIENQEFMAMRAA*
Ga0182173_10710202	3300015288	Miscanthus Phyllosphere	MGKKKTASKSQSSFVDEETSLPVIENQEFVAMRAAQKSWSAPTTTEE*
Ga0182138_10043071	3300015289	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAPQKIWPAPTTTED*
Ga0182138_10219071	3300015289	Miscanthus Phyllosphere	MGRKKSTNKSQATFVDEEASFFVIENQEFMAMRAAQKIWPALTMTKD*
Ga0182138_10497692	3300015289	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIDNQEFMAMRAA*
Ga0182138_10715831	3300015289	Miscanthus Phyllosphere	MGKKKAASKSQAAFVDEESSLSLIENQEFVAMRAAQKV
Ga0182138_10906761	3300015289	Miscanthus Phyllosphere	MGRKKSVSNSQATFVDEEASLSVIENQEFMVMRAAQKIWPTPTTTKD*
Ga0182125_10228981	3300015291	Miscanthus Phyllosphere	MGRKKAASKSQATFVDKESSLFMIENQEFMAMRAAQKVWPAPTMNEDQ
Ga0182141_10552131	3300015292	Miscanthus Phyllosphere	MGKKKTTSKSQSSFVVEESSLSVIENQEFVAMRAAQKS*
Ga0182141_10667831	3300015292	Miscanthus Phyllosphere	MGKKKTASKSQATFMDEESSLSLIENQEFVAMRAAQKVWPAP
Ga0182141_10766162	3300015292	Miscanthus Phyllosphere	MGRRKAASKSQATSVDEESSLSMIENQEFVAMRAA*
Ga0182141_10783701	3300015292	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIENKKFMAMRGAQKV*
Ga0182141_10904211	3300015292	Miscanthus Phyllosphere	MGKKKTASKSQVTFVDEESSLSLIENQEFMAMRAAQKVW
Ga0182126_10481612	3300015294	Miscanthus Phyllosphere	MGRKKATSKFQAAFVDEEASLSVIENQEFMAMRAAQKI*
Ga0182126_10562211	3300015294	Miscanthus Phyllosphere	MGKKKTTSKSQSSFVDEESSLSVIENQEFVAMRAA*
Ga0182126_10651272	3300015294	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAA*
Ga0182126_10718941	3300015294	Miscanthus Phyllosphere	MGKKKAASKSQSTFVDEESSLSVIENQEFVAMRAAQKSWPALTSTEE*
Ga0182126_10811831	3300015294	Miscanthus Phyllosphere	MGRKKAASKSQATFMDEESSLSVIENQEFMAMRAA*
Ga0182175_10243421	3300015295	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWLAPTTTED*
Ga0182175_10368611	3300015295	Miscanthus Phyllosphere	MGRKKAASKSQATFVDEEASLSLIENQEFVAMRAAQKIWPTLTTTED*
Ga0182175_10515381	3300015295	Miscanthus Phyllosphere	MGRKKTASKSPATFVDEESSLSMIENQEFVAMRATQKAWPAPTTTED*
Ga0182175_10973842	3300015295	Miscanthus Phyllosphere	MCRKKSASKSQATFVDEEASLSVIEKQEFMAMRAAQKI*
Ga0182157_10312681	3300015296	Miscanthus Phyllosphere	MGRKKATSKSQAAFVDEESSLFVIENQKFMAMRAA*
Ga0182157_10934051	3300015296	Miscanthus Phyllosphere	MGRKKAASKSQASFVDEESSLSVIENQEFVAMRAAQKAWSAPTTTED*
Ga0182157_10979911	3300015296	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASFSVIENQEFMAIGAAQKVWPALTMTED*
Ga0182106_10464492	3300015298	Miscanthus Phyllosphere	MGRKKTASKSQATFVDEESSLSMIENQEFMAMRAAQKVWSAPTTTED*
Ga0182106_10550311	3300015298	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLFMIENQEFMAMRAAQKIWPALT
Ga0182106_10608432	3300015298	Miscanthus Phyllosphere	MGKKKTASKSQATFIDEESSLSLIENQEFVAMRAAQKVWPA
Ga0182106_10670521	3300015298	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTITED*
Ga0182106_10908862	3300015298	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAAQKVWPAPTTN
Ga0182107_10235322	3300015299	Miscanthus Phyllosphere	MGKKKATSKSQSTFVDEESSLSVIENQEFVAMRAT*
Ga0182107_10641591	3300015299	Miscanthus Phyllosphere	MGKKKTTSKSQATFVDEESSVSLIENQEFVAIRAAQKVWPA
Ga0182107_10725901	3300015299	Miscanthus Phyllosphere	MGRKKSASKSHATFVDEEASLSMIENQEFMAMRAAQKVWPAPTTTEDQLRE
Ga0182107_10764561	3300015299	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSMIENQEFMAMRAAQKIW
Ga0182108_10241751	3300015300	Miscanthus Phyllosphere	MGKKKTASKSQSSFMDEESLLFVIENQEFVAMRAAQKSWPTP
Ga0182108_10383841	3300015300	Miscanthus Phyllosphere	KSQATFVDEESSLSMIENQEFVAMRAAQKSWPAPTTTED*
Ga0182108_11041641	3300015300	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEESSLSVIENQEFVAMRAA*
Ga0182143_10148552	3300015302	Miscanthus Phyllosphere	MGKKKAASKSQSTFIDEESSLSVIENQEFVATRAA*
Ga0182143_10515632	3300015302	Miscanthus Phyllosphere	MGRKKSASKSQTTFVDEEASLSMIQNQEFMAMRAAQKVWPAPTTTED*
Ga0182143_11037072	3300015302	Miscanthus Phyllosphere	MGRKNAMSKSQATFVDEESSLSVIENQEFMAMRAA*
Ga0182123_10222371	3300015303	Miscanthus Phyllosphere	MGKKKTASKSQAAFVDEESSLSLIKNQEFVAMRAA
Ga0182123_10354411	3300015303	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIENQEFMAMRAAQKVWPAPTTSEDQ
Ga0182123_10476832	3300015303	Miscanthus Phyllosphere	MGRKKSVSKSQATFVDEEASLSVIENQEFMAMRAAQKIWPAPT
Ga0182123_10668192	3300015303	Miscanthus Phyllosphere	MSRKKSTSKSQATFVDEEASLSIIENQEFMAMRAAQKIWLALTTTED*
Ga0182123_10918311	3300015303	Miscanthus Phyllosphere	MGRKKSASKPQATFVDKEASLSMIENQEFMAMRAA*
Ga0182112_10106262	3300015304	Miscanthus Phyllosphere	MGRKKATSTSQAAFVDEESSLSVIKNQEFMAMKAA*
Ga0182112_10228821	3300015304	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAAQKVW
Ga0182112_10535711	3300015304	Miscanthus Phyllosphere	MGRKKAASKSQATFVDEESSLSVIENQEFMAMRAA*
Ga0182112_10701231	3300015304	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMGAA*
Ga0182112_10968161	3300015304	Miscanthus Phyllosphere	MGRKKSASKSHATFVDEEASLSVIENQEFVAMRAAQKIW
Ga0182158_10288841	3300015305	Miscanthus Phyllosphere	MGRKKSASKFQEAFVDEEASLSMIENQEFMAMRAA*
Ga0182158_10688672	3300015305	Miscanthus Phyllosphere	MGKKKTASKSQSSFVDEESSLSMIENQEFVAMRAA*
Ga0182144_10255431	3300015307	Miscanthus Phyllosphere	MGKKKAASKSQSSFVDEESSLSVIENQEFVAMRAAQKSWLTPTTTEE
Ga0182144_10365652	3300015307	Miscanthus Phyllosphere	MGRKKSASKFQAAFVDEEASLSVIDNQEFMAMRAA*
Ga0182142_10574352	3300015308	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSVIENQEFVAMRAA*
Ga0182142_10738131	3300015308	Miscanthus Phyllosphere	MGKKKAASKSQAAFVDEESSLSLIEKQEFVAMRDAQKVW
Ga0182142_10764311	3300015308	Miscanthus Phyllosphere	MGRKKSASKSQTTFVDEEASLFVIENQEFMAMRATQK
Ga0182142_10866782	3300015308	Miscanthus Phyllosphere	MGKKKTASKSQATFVDKESSLSLIENQEFVAMRAAQKVWLAPTTSED*
Ga0182142_10990461	3300015308	Miscanthus Phyllosphere	MGKKKTTSKSQSSFMDEESSLSVIENQEFVAMRAA*
Ga0182140_10276991	3300015314	Miscanthus Phyllosphere	MGRKKATRKSQAAFVDEESSLSVIENQEFVAMRAAQKAWPALITTED*
Ga0182140_11115432	3300015314	Miscanthus Phyllosphere	MGRKKSASKSQTTFVDEESSLSMIENQEFMAMRAA*
Ga0182140_11174321	3300015314	Miscanthus Phyllosphere	MGRKKSVSKSQTTFVDEEASLSVIENQEFMAMRVAQKIWPALTTTEDQ
Ga0182127_10529941	3300015321	Miscanthus Phyllosphere	MGRKKAASKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPTTTED*
Ga0182127_10545931	3300015321	Miscanthus Phyllosphere	MGKKKTVSKAQSSFVDEESSLSMIENQEFVAMRAAQKS*
Ga0182127_10722412	3300015321	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSVIENQEFVAMRAT*
Ga0182127_10886281	3300015321	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIENQEFMVIRVAQKIWPALPTAE
Ga0182127_11037151	3300015321	Miscanthus Phyllosphere	MGKKKTASKSQSSFVDEESSLSVIENQEFVAMRAA
Ga0182110_10613831	3300015322	Miscanthus Phyllosphere	MGQKKSASKSQATFVDEEVSLSVIENQEFMAMRAAQKVWPAPTTTED*
Ga0182129_10255881	3300015323	Miscanthus Phyllosphere	MGRKKVVSKSQAAFVDEESSLSVIENQEFMAMRAAQKV*
Ga0182129_10357801	3300015323	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTTSED
Ga0182129_10588712	3300015323	Miscanthus Phyllosphere	MGRKKTASKSQVAFVDEESSLSVIENQESVAMRAA*
Ga0182129_10963782	3300015323	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSVIENQEFMAMRAA
Ga0182187_10792202	3300015341	Miscanthus Phyllosphere	YMGKKKTASKSQSSFVDEESSLSLIENQEFVAMRAAQKFWPAPTTTEA*
Ga0182187_11012863	3300015341	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSMIENQEFMAMRATQKSWLAPTTTED*
Ga0182187_11061381	3300015341	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSVIENQEFMAMRAAQKF*
Ga0182109_10986352	3300015342	Miscanthus Phyllosphere	MGRKKPVSKSQVAFVDEETSLSVIENREFMAMRDA*
Ga0182109_11245612	3300015342	Miscanthus Phyllosphere	MGKKKTVSKAQSSFVDEESSLSMIENQEFVAMRAA*
Ga0182109_11563131	3300015342	Miscanthus Phyllosphere	MGKKKTTSKSQATFVDEESSVSLIENQEFVAMRAAQKVWPAPTTSEDQLRE
Ga0182109_12239111	3300015342	Miscanthus Phyllosphere	MGRKKTASKSQATFVDEESSLSVIENQEFVAMRAA*
Ga0182155_12118471	3300015343	Miscanthus Phyllosphere	MGRKKAVSKSQTAFVDEGSSLSVIENQEFMAMRAA*
Ga0182189_10352062	3300015344	Miscanthus Phyllosphere	MGKKKTTSKSQSSFVDEESSLSMIENQEFIAMRAAQKSWLTPTTTEE*
Ga0182189_10561611	3300015344	Miscanthus Phyllosphere	MGRKKLASKSQATFVDEEALLSVIENQEFMAMRAA*
Ga0182189_11933832	3300015344	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIEKQEFLTMRAA*
Ga0182189_12009781	3300015344	Miscanthus Phyllosphere	MGRKKSVRKSQAAFVDEEASLSMIENQEFIAMRAA*
Ga0182111_10857131	3300015345	Miscanthus Phyllosphere	MGRKKTTSKSQVAFVDEESSLSVIENQEFMAMMAAQKVWPAPTTTEV*
Ga0182111_12066171	3300015345	Miscanthus Phyllosphere	MGKKKAASKSQATFVDEESSLSVIKNQEFMAMRAA*
Ga0182111_12100811	3300015345	Miscanthus Phyllosphere	MGRKKLVSKSQPTFVDEEASLSVIENQEFMAMRAAQKIWPAPTMTKD*
Ga0182139_10627501	3300015346	Miscanthus Phyllosphere	MGRKKTTSKSQATFVDAESSLSVIENREFIAMRATQKVW
Ga0182139_11219691	3300015346	Miscanthus Phyllosphere	MGKKKTVGKSHATFVDEESSLAVIENREFMAMRAAQKVWPAPTTTEDQL
Ga0182177_11099421	3300015347	Miscanthus Phyllosphere	MGKKKTTSKSQAAFVDEESSLSLIENQEFVAMRAA*
Ga0182177_11617121	3300015347	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEESSLFVIENQEFMAMRTA*
Ga0182177_11859291	3300015347	Miscanthus Phyllosphere	MGRKKSTSKSQATFVDEEPSLSVIENQEFMVMRAAQ
Ga0182177_11861443	3300015347	Miscanthus Phyllosphere	MGKKKAASKSQSTFVDKESSLSVIENQEFIAMRAAQKSWPAPTTTED*
Ga0182177_12123181	3300015347	Miscanthus Phyllosphere	MGRKKSTSKSQVTFVDEEASLSVIENREFMAMRAAPKI*
Ga0182161_11035711	3300015351	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLCVIKNQEFMAMRAAQKIWPAPTTTED*
Ga0182161_11626191	3300015351	Miscanthus Phyllosphere	MGKKKAASKSQAAFVDEESSLSLIENQEFVAMRAAQKVW
Ga0182161_12010291	3300015351	Miscanthus Phyllosphere	MGKKKTASKSQSSFVDEESSLSVIENQEFVAMRAAQKSWPTPTTTKE*
Ga0182161_12276181	3300015351	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVFENQEFMAMWAAQKIWSAVTTT
Ga0182161_12330322	3300015351	Miscanthus Phyllosphere	MGKKKTASKSQSSFMDEESLLFVIENQEFVAMRAAQKSWPTPTTT
Ga0182161_12530052	3300015351	Miscanthus Phyllosphere	MGRKKAASKSQATFVDEESSLSMIENQEFMAMRAA*
Ga0182159_11119731	3300015355	Miscanthus Phyllosphere	MGRTKAASKSQATFMDEESSLSVIENQEFMAMRAT*
Ga0182159_11509981	3300015355	Miscanthus Phyllosphere	MGTKKLASKSQASFVDEEALLSVIENQEFMAMRAAQKIWPTPTTTED*
Ga0182159_11639251	3300015355	Miscanthus Phyllosphere	MGRKKAANKSQAAFVDEESSLSLIENQEFVAMRAAQKVWLA
Ga0182159_12348041	3300015355	Miscanthus Phyllosphere	MGRKKSASKSQASFVDEEASLSVIENQEFMAMRAAQKI*
Ga0182159_12543351	3300015355	Miscanthus Phyllosphere	MGKKKTVSKSQIAFVDEESSLSLIENQEFVAMRVA*
Ga0182159_12556221	3300015355	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIENLEFVAMRAAQKVWPAPTTSED
Ga0182159_12570941	3300015355	Miscanthus Phyllosphere	MGRKKSVSKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTED*
Ga0182159_12629312	3300015355	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSIIENQEFMAMRAAQKIWSAPTTTEVSFTSSLVMV*
Ga0182159_12802833	3300015355	Miscanthus Phyllosphere	MGRKKAMSKSQVAFVDEETSLSVIENREFMAMRDA*
Ga0182159_12871831	3300015355	Miscanthus Phyllosphere	MGRKKSAIKSQATFVDEEASLSVIENQEFMAMRAA*
Ga0182159_12892843	3300015355	Miscanthus Phyllosphere	MGRKKPASKSHATFVDEEASLSVIENQELMAMRAAQKIWPAPTTTED*
Ga0182159_12941092	3300015355	Miscanthus Phyllosphere	MGKKKTAGKSQASFVDEESSLPVIDNQEFMAMRAAQKAWPAPTTTEDQL
Ga0182159_12970731	3300015355	Miscanthus Phyllosphere	MGRKKAASKSQATFVDKESSLSVIENQEFVAMRAAQKAWLAPTTTED*
Ga0182159_13392541	3300015355	Miscanthus Phyllosphere	MGRKKLVSKSQPTFVDEEASLSVIENQEFMAMRAAQKIW
Ga0182159_13419582	3300015355	Miscanthus Phyllosphere	MGRKKSARKSQAAFVDEEASLSVIENQEFMAMRAA*
Ga0182145_10039371	3300015361	Miscanthus Phyllosphere	MGQKKSASKSQATFVDEEVSLSVIENQEFMAMRAAQKV*
Ga0182145_10727041	3300015361	Miscanthus Phyllosphere	MGRKKSASKSQVAFVDEETSLFVIENQEFMAMRAAQKIWLAPT
Ga0182145_10990852	3300015361	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEESSLPVIENQEFMAMRAA*
Ga0182145_11326171	3300015361	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSMIENQEFMAVRAAQKIWPALTTTED*
Ga0182145_11793612	3300015361	Miscanthus Phyllosphere	MGKKKTVGKSHATFVDEESSLAVIENREFMAMRAAQKVWPAPTT
Ga0182145_11948181	3300015361	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAAQKVWPAPT
Ga0182203_11246562	3300017404	Miscanthus Phyllosphere	KSQAAFVDEEASLSVVENQVFKAMRAAQKIWLALTTIED
Ga0182203_11304123	3300017404	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSMIENQEFMAMRAAQKVWPALT
Ga0182203_11587012	3300017404	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDKESSLSVIENQEFMAMRAAQKFWPAPTTTED
Ga0182220_10465722	3300017407	Miscanthus Phyllosphere	MGRKKTTSKSQAAFVDEESSLSVIENQEFMAMRAT
Ga0182220_10800551	3300017407	Miscanthus Phyllosphere	MGKKKAASKSQATFVGEESSLSVIENQKFVAMRVA
Ga0182220_10813792	3300017407	Miscanthus Phyllosphere	MGKKKTASKSQSSFVDEESSLSLIENQEFVAMRAAQKFWPAPTTTEA
Ga0182204_10191693	3300017409	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAAQKVWPAPT
Ga0182204_10219581	3300017409	Miscanthus Phyllosphere	MGRKKATSKSQATFMDKESSLFVIENQEFVAMRAA
Ga0182204_10875592	3300017409	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSMIENQEFMAMRAA
Ga0182204_11212561	3300017409	Miscanthus Phyllosphere	MGKKKTASKSQSNFVDEESSLSLIENQEFVAMRATQKVWPA
Ga0182207_10301511	3300017410	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQKFMAMRAAQKVWPVQL
Ga0182207_10577491	3300017410	Miscanthus Phyllosphere	MGRKKATSKSQAAFVDEESSLSVIENQEFMAMRAAQKVWPAPTTTEDQLRE
Ga0182207_11251821	3300017410	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRAA
Ga0182207_11332961	3300017410	Miscanthus Phyllosphere	MGRKKAASKSQATFVDEESSLSVIENQEFVAMRAAQKSWPAPTTTEDQL
Ga0182207_11598311	3300017410	Miscanthus Phyllosphere	MGKKKTTSKSQSSFMDEESSLSVIENQEFVAMRAA
Ga0182208_10569841	3300017411	Miscanthus Phyllosphere	MGRKKATTKSQATFVDEESSLSMIENQEFVAMRATQKAWPAPTTTED
Ga0182208_10690201	3300017411	Miscanthus Phyllosphere	MRRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWPATTTTED
Ga0182208_10701851	3300017411	Miscanthus Phyllosphere	MGRKKAASKSQATFMDEESSLSVIENQEFVAMRAA
Ga0182208_10909343	3300017411	Miscanthus Phyllosphere	MGRKKATSKSQATFMDEESSLSMIENQEFVPMRAT
Ga0182208_10981921	3300017411	Miscanthus Phyllosphere	MGRKKAVSKSQAAFVDEDSSLSMIKNQEFMAMRAAQKVWLAPTMTKD
Ga0182208_11137651	3300017411	Miscanthus Phyllosphere	MGRKKSTSKSQVTFVDEEASLSVIENQEFMAMRAAQKIWPAPTMTED
Ga0182222_10181681	3300017413	Miscanthus Phyllosphere	MGKKKATSKSQSTFVDEESSLSVIENQEFVAMRVAQK
Ga0182222_10696762	3300017413	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSVIENREFMATRAAQKDWLAPTTTED
Ga0182222_10770062	3300017413	Miscanthus Phyllosphere	KKSASKSQAAFVDEEASLSVIENQEFMAMRAAHKI
Ga0182222_10949611	3300017413	Miscanthus Phyllosphere	MGRKKATSKSQAAFVDEESSLSVIENQEFMAMRAAQKVWPAPTTTEDQL
Ga0182202_10142183	3300017415	Miscanthus Phyllosphere	MGKKKTVSKSQATFVDKESSLSLIENQEFVAMRAAQKVWPAPTT
Ga0182202_10718191	3300017415	Miscanthus Phyllosphere	MGRKKAVSKSQAAFVDEESSLSVIENQESVAMRAAQKAWPAPTTTED
Ga0182202_11043092	3300017415	Miscanthus Phyllosphere	MGRKKATSKSQATFVDKESSLSVIENQEFVAMRAAQKAWPAPMTTEDQL
Ga0182202_11049502	3300017415	Miscanthus Phyllosphere	MGRKKSVSKSQATFVDEEASLSVIENQEFMAMRAAQKI
Ga0182230_10735412	3300017417	Miscanthus Phyllosphere	MGRKNAMSKSQATFVDEESSLYVIENQEFVAMRAA
Ga0182230_10740983	3300017417	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWSGPTTTED
Ga0182230_10793741	3300017417	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRATQKIWLAPTTTED
Ga0182228_11111412	3300017420	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIENQEFVAMRAAQKIWPAPTTTEDQLR
Ga0182228_11270702	3300017420	Miscanthus Phyllosphere	MGRKKLVSNSQATFVDEEASLSVIENQEFMAMRAA
Ga0182219_10869761	3300017424	Miscanthus Phyllosphere	MGRKKSASKSQEAFVDEEASLFVIENQEFMAMRAAQKIWPAP
Ga0182224_10296061	3300017425	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSVIENQEFMAMRAAQKFWLAPRTTQD
Ga0182224_10313752	3300017425	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRAAQKIWPAPTMTKD
Ga0182224_10418412	3300017425	Miscanthus Phyllosphere	MGRKKSASKSQAIFVDEEASLFVIENQEFMAMWAAQKVWPAPTTTEDQLR
Ga0182224_10765611	3300017425	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSMIENQEFVAIRAAQKSWPAPTTTED
Ga0182224_11072871	3300017425	Miscanthus Phyllosphere	MGKKKSASKSQATFEDEEASLSVIENQEFMAMRAAQKV
Ga0182224_11100791	3300017425	Miscanthus Phyllosphere	MGRKKAANKSQAAFVDEESSLSLIENQEFVAMWAAQKVWPAP
Ga0182224_11496031	3300017425	Miscanthus Phyllosphere	MGKKKTASKSLSSFVDGESSLPVIENQEFVAMRAAQKSWPTPTT
Ga0182190_10715851	3300017427	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEESSLSVIENQEFMAMRAA
Ga0182190_10765011	3300017427	Miscanthus Phyllosphere	MGKKKSASKSQATFVDEEASLSMIENQEFMAMRAA
Ga0182190_11119152	3300017427	Miscanthus Phyllosphere	MGRKKAANKPQAAFVDEESSLSLIENQEFVAMRAA
Ga0182190_11136922	3300017427	Miscanthus Phyllosphere	MGRKKSASKSQTAFVDEEASLSMIENQEFMALRAA
Ga0182190_11247702	3300017427	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDEEASLSVIENQGFMAMRAAQKIWPA
Ga0182190_11454061	3300017427	Miscanthus Phyllosphere	MGKKKTASKSQTAFVDEESSLSLIENEEFVAMRAAQKVWSAPTTE
Ga0182190_11591852	3300017427	Miscanthus Phyllosphere	MGKKKAASKSQSSFVDEESSLSVIENQEFVAMRATQKSWLTPTTTEE
Ga0182190_11647221	3300017427	Miscanthus Phyllosphere	MGKKKAANKSQAAFVDEESSLSLIVNQEFVAMRAAQKVWPAPTTTED
Ga0182192_10492232	3300017430	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEEASLSVIENQEFMAMRARQ
Ga0182192_11130511	3300017430	Miscanthus Phyllosphere	MGRKKAVSKSQAAFVDEESSLSVIENQEFMAMRAAQKIWPAPTTTAD
Ga0182192_11169661	3300017430	Miscanthus Phyllosphere	MGKKKAANKSQAAFVDEESSLSLIKNQEFVAMRAAQKVWPAPTTTED
Ga0182192_11433992	3300017430	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSMIENQEFMAMRAAQKIWPAPTMIED
Ga0182206_11341952	3300017433	Miscanthus Phyllosphere	MGRKKATSKSQATFVDEESSLSVIENQEFVAMRAT
Ga0182206_11517001	3300017433	Miscanthus Phyllosphere	MGKKKSASKSQAAFVDEEASLSVIENQEFMSMRAAQKIWPA
Ga0182209_10747781	3300017436	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEEASLFVIENQEFMAMRAA
Ga0182209_11400521	3300017436	Miscanthus Phyllosphere	MGKKKTTSKSQATFVDKESSLSLIENQEFVAMRAAQKVWPA
Ga0182209_11616951	3300017436	Miscanthus Phyllosphere	SKSQSSFMDEESSLSVIENQEFVAMRATQKSWLTPTTTEE
Ga0182209_11661652	3300017436	Miscanthus Phyllosphere	MGRKKAMSNSHVAFVDDEASLSVIENQEFMAMRAA
Ga0182191_10942781	3300017438	Miscanthus Phyllosphere	MGKKKTMSKSQSNFVDEESSLSVIENQEFMAMRAAQKAWPA
Ga0182191_11605602	3300017438	Miscanthus Phyllosphere	MGRNKATSKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPTTTED
Ga0182221_10487571	3300017442	Miscanthus Phyllosphere	YMGKKKTASKSQSSFVDEESSLSLIENQEFVAMRAAQKFWPAPTTTEA
Ga0182221_10675511	3300017442	Miscanthus Phyllosphere	MGRKKLASKSQAAFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTEDQL
Ga0182221_11053651	3300017442	Miscanthus Phyllosphere	MGRKKTASKSQATFVDEESSLSVIENQEFVAMRAA
Ga0182221_11496621	3300017442	Miscanthus Phyllosphere	MGRKKAAIKSQVAFVDEEASLSVIENQEFMAMRAAQKIWPALTTTED
Ga0182221_11512111	3300017442	Miscanthus Phyllosphere	MGRKKAASKSQATFMDEESSLSMIENQEFVAMRAAQKAWSAPTTTED
Ga0182221_11583281	3300017442	Miscanthus Phyllosphere	MDKKKAASKSQATFVDEESSLFVIENQEFVAMRAAQKAWPAPMTTED
Ga0182193_11243041	3300017443	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEALLSVIENQEFMAMRAAQKI
Ga0182193_11306331	3300017443	Miscanthus Phyllosphere	MGRKKSASKSQAAFVDKEASLSMIENQEFLAMRAA
Ga0182193_11646652	3300017443	Miscanthus Phyllosphere	MGRKKLASKSQVTFVDEEASLSVIENQEFMAMRAA
Ga0182233_10729261	3300017680	Miscanthus Phyllosphere	MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPTTTED
Ga0182233_10911241	3300017680	Miscanthus Phyllosphere	MGKKKTASKSQATFMDEESSLSLIEKQEFMAMKAAQKVWPAPTTSEDQ
Ga0182233_11110382	3300017680	Miscanthus Phyllosphere	MGRKKATSKFQATFVDEEASLSVIENQEFMAMRAA
Ga0182229_10470752	3300017682	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLSVIENQEFMAMRATQKIWSAPTTTED
Ga0182229_10623491	3300017682	Miscanthus Phyllosphere	MGKKKATRKSQATFVDEESSLSVIENQEFVAMRAAQKAWPAPMMTEDQL
Ga0182229_10859173	3300017682	Miscanthus Phyllosphere	MGRKKAVSKSQATFVDEESSLSVIENQEFVAMRAA
Ga0182218_10861862	3300017683	Miscanthus Phyllosphere	MGKKKTASKSQSSFVDEETSLSVIENQEFVAMRAA
Ga0182218_11044521	3300017683	Miscanthus Phyllosphere	MGRKKAANKSQAAFVDEESSLSLIENQEFMAMRAAQKV
Ga0182218_11260652	3300017683	Miscanthus Phyllosphere	MGRKKAASKSQAAFVDEESSLSVIKNQEFMAIRAV
Ga0182218_11410101	3300017683	Miscanthus Phyllosphere	MGRKKTASKSPATFVDEESSLSMIENQEFVAMRATQKAWPAPTTTED
Ga0182218_11504971	3300017683	Miscanthus Phyllosphere	MGRKKAMSKSQAAFVDKESSLSVIENQEFMAMRAA
Ga0182225_10677651	3300017684	Miscanthus Phyllosphere	MGRKKAESKSQATFMDEESSLSVIENQEFMAMKAAQKSLAGSDNN
Ga0182225_10742901	3300017684	Miscanthus Phyllosphere	MGRKKSASKSQATFVDEEASLFVIENQEFMAMRAAQKVWPAPT
Ga0182227_11047321	3300017685	Miscanthus Phyllosphere	MGRKKSASKSQATFVDVEASLSVIENQEFMAMRAAQKVW
Ga0182205_11135981	3300017686	Miscanthus Phyllosphere	MGRKKSASKSQATFVYKEASLSVIENQEVMAMRAAQKIWSALTTTED
Ga0182205_11408861	3300017686	Miscanthus Phyllosphere	MGRKKATSKSQATFVDKESSLYVIENQEFMAMRAAQKVWPAPTMTED
Ga0182205_11517302	3300017686	Miscanthus Phyllosphere	KKAASKSQAAFVDEESSLSVIENQEFMAMRAVQKVWLAPTMTED
Ga0182223_10367152	3300017690	Miscanthus Phyllosphere	MGRKKSASKSQASFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTED
Ga0182232_10550641	3300021060	Phyllosphere	MGRKKAANKSQAAFVDEESSLSLIENQEFVAMRAT
Ga0182232_10601971	3300021060	Phyllosphere	MGMKKSARKSQASFVDEEASLFVIENQEFMAMRVAQKIWPAPTTTED
Ga0207642_111273001	3300025899	Miscanthus Rhizosphere	MGKKKTASKSQATFVDEESSLSLIENQEFVAMRAAQKVWPAPITSED
Ga0207691_102285701	3300025940	Miscanthus Rhizosphere	MGKKKTASKSQATFVDEESSLSLIENLEFVAMRVAQKVWPAPTTSED
Ga0207648_105726892	3300026089	Miscanthus Rhizosphere	MGRKKSVSKSQATFVDEEASLSVIENQEFMAMRAAQKIWPAPTTTED
Ga0207648_112508471	3300026089	Miscanthus Rhizosphere	MGKKKTASKSQATFVDEESSLSLIQNQEFVAMRASQKVWPAP

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F012027

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign