NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012282

Metagenome / Metatranscriptome Family F012282

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012282
Family Type Metagenome / Metatranscriptome
Number of Sequences 282
Average Sequence Length 109 residues
Representative Sequence SATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVEVWINQHRDRYVTATASTA
Number of Associated Samples 211
Number of Associated Scaffolds 282

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.29 %
% of genes from short scaffolds (< 2000 bps) 91.13 %
Associated GOLD sequencing projects 172
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.078 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(39.362 % of family members)
Environment Ontology (ENVO) Unclassified
(93.972 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.716 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.11%    β-sheet: 18.25%    Coil/Unstructured: 76.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 282 Family Scaffolds
PF10124Mu-like_gpT 10.28
PF01476LysM 0.35



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.97 %
UnclassifiedrootN/A6.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10086755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1221Open in IMG/M
3300000947|BBAY92_10110138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium731Open in IMG/M
3300000949|BBAY94_10100809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium791Open in IMG/M
3300001450|JGI24006J15134_10006592Not Available5958Open in IMG/M
3300001450|JGI24006J15134_10050936All Organisms → Viruses → Predicted Viral1692Open in IMG/M
3300001460|JGI24003J15210_10033498All Organisms → Viruses → Predicted Viral1851Open in IMG/M
3300001472|JGI24004J15324_10016789All Organisms → Viruses → Predicted Viral2534Open in IMG/M
3300001472|JGI24004J15324_10059169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1108Open in IMG/M
3300001589|JGI24005J15628_10194373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium575Open in IMG/M
3300001720|JGI24513J20088_1015524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium882Open in IMG/M
3300001720|JGI24513J20088_1031825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium530Open in IMG/M
3300001722|JGI24525J20082_1019177Not Available725Open in IMG/M
3300001736|JGI24659J20068_1003584All Organisms → Viruses → Predicted Viral1746Open in IMG/M
3300001963|GOS2229_1036722All Organisms → Viruses → Predicted Viral1622Open in IMG/M
3300002165|JGI24527J20359_1006565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium655Open in IMG/M
3300002242|KVWGV2_10252925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium675Open in IMG/M
3300002484|JGI25129J35166_1037216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium995Open in IMG/M
3300002511|JGI25131J35506_1024851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium824Open in IMG/M
3300002511|JGI25131J35506_1067022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium501Open in IMG/M
3300002514|JGI25133J35611_10046797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1487Open in IMG/M
3300002514|JGI25133J35611_10097950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium869Open in IMG/M
3300002518|JGI25134J35505_10017351Not Available2250Open in IMG/M
3300002519|JGI25130J35507_1059129All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium744Open in IMG/M
3300002519|JGI25130J35507_1107377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium502Open in IMG/M
3300002760|JGI25136J39404_1062090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium695Open in IMG/M
3300002876|Ga0005243J43192_117440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium635Open in IMG/M
3300004276|Ga0066610_10215529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium622Open in IMG/M
3300005402|Ga0066855_10083195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium996Open in IMG/M
3300006025|Ga0075474_10214470All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium587Open in IMG/M
3300006027|Ga0075462_10022104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2051Open in IMG/M
3300006164|Ga0075441_10265643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium630Open in IMG/M
3300006165|Ga0075443_10149948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium822Open in IMG/M
3300006190|Ga0075446_10205077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium550Open in IMG/M
3300006332|Ga0068500_1386905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium732Open in IMG/M
3300006339|Ga0068481_1297563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1128Open in IMG/M
3300006340|Ga0068503_10122983All Organisms → Viruses → Predicted Viral2369Open in IMG/M
3300006731|Ga0079249_1381256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium504Open in IMG/M
3300006735|Ga0098038_1163894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium734Open in IMG/M
3300006735|Ga0098038_1168873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium721Open in IMG/M
3300006736|Ga0098033_1098367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium833Open in IMG/M
3300006737|Ga0098037_1267155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium545Open in IMG/M
3300006738|Ga0098035_1043667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1659Open in IMG/M
3300006738|Ga0098035_1240663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium597Open in IMG/M
3300006749|Ga0098042_1117314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium666Open in IMG/M
3300006749|Ga0098042_1154523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium561Open in IMG/M
3300006749|Ga0098042_1161371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium546Open in IMG/M
3300006751|Ga0098040_1163960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium656Open in IMG/M
3300006751|Ga0098040_1207039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium572Open in IMG/M
3300006752|Ga0098048_1205324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium581Open in IMG/M
3300006754|Ga0098044_1094998All Organisms → Viruses → Predicted Viral1226Open in IMG/M
3300006754|Ga0098044_1100643All Organisms → Viruses → Predicted Viral1184Open in IMG/M
3300006789|Ga0098054_1255710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium631Open in IMG/M
3300006793|Ga0098055_1229334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium701Open in IMG/M
3300006810|Ga0070754_10458402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium552Open in IMG/M
3300006916|Ga0070750_10346028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium628Open in IMG/M
3300006924|Ga0098051_1006968All Organisms → Viruses → Predicted Viral3575Open in IMG/M
3300006924|Ga0098051_1126583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium680Open in IMG/M
3300006926|Ga0098057_1029096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1375Open in IMG/M
3300006926|Ga0098057_1038261All Organisms → Viruses → Predicted Viral1186Open in IMG/M
3300006927|Ga0098034_1168938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium614Open in IMG/M
3300006927|Ga0098034_1173074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium606Open in IMG/M
3300006929|Ga0098036_1203740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium601Open in IMG/M
3300006947|Ga0075444_10060060All Organisms → Viruses → Predicted Viral1765Open in IMG/M
3300006947|Ga0075444_10205108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium795Open in IMG/M
3300007276|Ga0070747_1022438All Organisms → Viruses → Predicted Viral2560Open in IMG/M
3300007276|Ga0070747_1208328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium687Open in IMG/M
3300007276|Ga0070747_1209479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium685Open in IMG/M
3300007540|Ga0099847_1117107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium804Open in IMG/M
3300007960|Ga0099850_1283161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium632Open in IMG/M
3300007963|Ga0110931_1012384All Organisms → Viruses → Predicted Viral2591Open in IMG/M
3300007963|Ga0110931_1254624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium522Open in IMG/M
3300008216|Ga0114898_1131307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium730Open in IMG/M
3300008217|Ga0114899_1006729Not Available5185Open in IMG/M
3300008217|Ga0114899_1013499Not Available3323Open in IMG/M
3300008217|Ga0114899_1204541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium625Open in IMG/M
3300008218|Ga0114904_1005006Not Available5200Open in IMG/M
3300008219|Ga0114905_1007121All Organisms → Viruses → Predicted Viral4934Open in IMG/M
3300008220|Ga0114910_1060875All Organisms → Viruses → Predicted Viral1186Open in IMG/M
3300008220|Ga0114910_1072710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1061Open in IMG/M
3300009172|Ga0114995_10269973Not Available938Open in IMG/M
3300009173|Ga0114996_10028379All Organisms → cellular organisms → Bacteria5403Open in IMG/M
3300009412|Ga0114903_1146720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium515Open in IMG/M
3300009413|Ga0114902_1035392All Organisms → Viruses → Predicted Viral1517Open in IMG/M
3300009413|Ga0114902_1144237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium608Open in IMG/M
3300009413|Ga0114902_1150387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium590Open in IMG/M
3300009414|Ga0114909_1053353All Organisms → Viruses → Predicted Viral1190Open in IMG/M
3300009418|Ga0114908_1084265All Organisms → Viruses → Predicted Viral1082Open in IMG/M
3300009418|Ga0114908_1094255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1008Open in IMG/M
3300009418|Ga0114908_1116271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium882Open in IMG/M
3300009418|Ga0114908_1259076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium525Open in IMG/M
3300009423|Ga0115548_1121246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium839Open in IMG/M
3300009423|Ga0115548_1247176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium548Open in IMG/M
3300009432|Ga0115005_10377185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1123Open in IMG/M
3300009435|Ga0115546_1162912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium782Open in IMG/M
3300009526|Ga0115004_10212791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1156Open in IMG/M
3300009595|Ga0105214_101636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1083Open in IMG/M
3300009601|Ga0114914_1042953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium746Open in IMG/M
3300009602|Ga0114900_1092632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium840Open in IMG/M
3300009602|Ga0114900_1120685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium701Open in IMG/M
3300009602|Ga0114900_1175892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium538Open in IMG/M
3300009603|Ga0114911_1069988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1058Open in IMG/M
3300009604|Ga0114901_1049131All Organisms → Viruses → Predicted Viral1465Open in IMG/M
3300009605|Ga0114906_1272390All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium545Open in IMG/M
3300009605|Ga0114906_1283108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium530Open in IMG/M
3300009613|Ga0105228_129436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium504Open in IMG/M
3300009620|Ga0114912_1040582All Organisms → Viruses → Predicted Viral1217Open in IMG/M
3300009620|Ga0114912_1044518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1149Open in IMG/M
3300009620|Ga0114912_1111654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium651Open in IMG/M
3300009620|Ga0114912_1112502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium648Open in IMG/M
3300009679|Ga0115105_10124155All Organisms → Viruses → Predicted Viral2127Open in IMG/M
3300010151|Ga0098061_1038818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1887Open in IMG/M
3300010151|Ga0098061_1267456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium593Open in IMG/M
3300010153|Ga0098059_1363221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium549Open in IMG/M
3300010153|Ga0098059_1363223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium549Open in IMG/M
3300010155|Ga0098047_10064805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1435Open in IMG/M
3300010155|Ga0098047_10108219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1083Open in IMG/M
3300010932|Ga0137843_1083795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium629Open in IMG/M
3300011013|Ga0114934_10276661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium761Open in IMG/M
3300011322|Ga0138359_1022718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium642Open in IMG/M
3300011325|Ga0138365_1021906All Organisms → Viruses → Predicted Viral1049Open in IMG/M
3300011329|Ga0138367_1187181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium784Open in IMG/M
3300012413|Ga0138258_1396711Not Available786Open in IMG/M
3300012953|Ga0163179_11172220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium678Open in IMG/M
3300017703|Ga0181367_1008306All Organisms → Viruses → Predicted Viral1918Open in IMG/M
3300017703|Ga0181367_1072358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium597Open in IMG/M
3300017708|Ga0181369_1083725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium676Open in IMG/M
3300017717|Ga0181404_1156797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium548Open in IMG/M
3300017720|Ga0181383_1048484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1140Open in IMG/M
3300017724|Ga0181388_1161824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium531Open in IMG/M
3300017725|Ga0181398_1164426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium524Open in IMG/M
3300017735|Ga0181431_1110916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium613Open in IMG/M
3300017739|Ga0181433_1052514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1036Open in IMG/M
3300017740|Ga0181418_1037663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1224Open in IMG/M
3300017740|Ga0181418_1104558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium686Open in IMG/M
3300017741|Ga0181421_1115573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium696Open in IMG/M
3300017746|Ga0181389_1090590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium850Open in IMG/M
3300017753|Ga0181407_1096749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium745Open in IMG/M
3300017759|Ga0181414_1171965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium564Open in IMG/M
3300017759|Ga0181414_1176063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium556Open in IMG/M
3300017760|Ga0181408_1100552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium753Open in IMG/M
3300017760|Ga0181408_1146448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium609Open in IMG/M
3300017767|Ga0181406_1252840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium517Open in IMG/M
3300017768|Ga0187220_1226235All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium562Open in IMG/M
3300017772|Ga0181430_1004150Not Available5421Open in IMG/M
3300017772|Ga0181430_1142998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium697Open in IMG/M
3300017775|Ga0181432_1044040All Organisms → Viruses → Predicted Viral1233Open in IMG/M
3300017775|Ga0181432_1051129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1158Open in IMG/M
3300017779|Ga0181395_1194831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium631Open in IMG/M
3300017781|Ga0181423_1146926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium909Open in IMG/M
3300018426|Ga0181566_10903057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium598Open in IMG/M
3300019025|Ga0193545_10129746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium537Open in IMG/M
3300019271|Ga0182065_1373186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium543Open in IMG/M
3300020165|Ga0206125_10309592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium589Open in IMG/M
3300020374|Ga0211477_10217328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium663Open in IMG/M
3300020434|Ga0211670_10523540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium506Open in IMG/M
3300020436|Ga0211708_10203573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium796Open in IMG/M
3300020440|Ga0211518_10364771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium671Open in IMG/M
3300020472|Ga0211579_10775333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium530Open in IMG/M
3300021353|Ga0206693_1236386All Organisms → Viruses → Predicted Viral1361Open in IMG/M
3300021375|Ga0213869_10334955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium636Open in IMG/M
3300021443|Ga0206681_10279642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium648Open in IMG/M
3300021791|Ga0226832_10454203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium546Open in IMG/M
3300022068|Ga0212021_1060158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium776Open in IMG/M
3300022068|Ga0212021_1074045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium698Open in IMG/M
3300022072|Ga0196889_1031039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1082Open in IMG/M
3300022164|Ga0212022_1049608Not Available649Open in IMG/M
3300022178|Ga0196887_1092136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium690Open in IMG/M
(restricted) 3300023210|Ga0233412_10375238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium635Open in IMG/M
3300023445|Ga0257020_137936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium916Open in IMG/M
(restricted) 3300024052|Ga0255050_10128734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium602Open in IMG/M
(restricted) 3300024057|Ga0255051_10263924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium627Open in IMG/M
3300024344|Ga0209992_10207024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium831Open in IMG/M
(restricted) 3300024518|Ga0255048_10593834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium535Open in IMG/M
3300025047|Ga0207897_119796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium737Open in IMG/M
3300025049|Ga0207898_1004697All Organisms → Viruses → Predicted Viral1590Open in IMG/M
3300025050|Ga0207892_1007783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1101Open in IMG/M
3300025069|Ga0207887_1029020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium887Open in IMG/M
3300025078|Ga0208668_1020644All Organisms → Viruses → Predicted Viral1338Open in IMG/M
3300025078|Ga0208668_1096029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium517Open in IMG/M
3300025079|Ga0207890_1016246All Organisms → Viruses → Predicted Viral1485Open in IMG/M
3300025079|Ga0207890_1068659All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium568Open in IMG/M
3300025082|Ga0208156_1078568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium619Open in IMG/M
3300025083|Ga0208791_1041046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium835Open in IMG/M
3300025086|Ga0208157_1081243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium809Open in IMG/M
3300025103|Ga0208013_1082700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium828Open in IMG/M
3300025103|Ga0208013_1103904Not Available714Open in IMG/M
3300025109|Ga0208553_1096703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium687Open in IMG/M
3300025109|Ga0208553_1148117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium515Open in IMG/M
3300025110|Ga0208158_1030396All Organisms → Viruses → Predicted Viral1380Open in IMG/M
3300025110|Ga0208158_1040516All Organisms → Viruses → Predicted Viral1167Open in IMG/M
3300025110|Ga0208158_1048676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1046Open in IMG/M
3300025118|Ga0208790_1073729All Organisms → Viruses → Predicted Viral1031Open in IMG/M
3300025120|Ga0209535_1070222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1379Open in IMG/M
3300025122|Ga0209434_1020516Not Available2257Open in IMG/M
3300025122|Ga0209434_1052319All Organisms → Viruses → Predicted Viral1258Open in IMG/M
3300025122|Ga0209434_1091751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium878Open in IMG/M
3300025125|Ga0209644_1032534All Organisms → Viruses → Predicted Viral1166Open in IMG/M
3300025125|Ga0209644_1097553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium694Open in IMG/M
3300025128|Ga0208919_1046185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1510Open in IMG/M
3300025128|Ga0208919_1096473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium955Open in IMG/M
3300025128|Ga0208919_1153116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium713Open in IMG/M
3300025132|Ga0209232_1033402All Organisms → Viruses → Predicted Viral1958Open in IMG/M
3300025133|Ga0208299_1219414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium552Open in IMG/M
3300025137|Ga0209336_10078840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium964Open in IMG/M
3300025137|Ga0209336_10143792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium636Open in IMG/M
3300025138|Ga0209634_1025280Not Available3229Open in IMG/M
3300025141|Ga0209756_1080073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1468Open in IMG/M
3300025141|Ga0209756_1318533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium541Open in IMG/M
3300025168|Ga0209337_1070960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1723Open in IMG/M
3300025168|Ga0209337_1296370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium588Open in IMG/M
3300025168|Ga0209337_1304861All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium573Open in IMG/M
3300025218|Ga0207882_1008730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1607Open in IMG/M
3300025248|Ga0207904_1029553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1005Open in IMG/M
3300025251|Ga0208182_1024114All Organisms → Viruses → Predicted Viral1466Open in IMG/M
3300025259|Ga0207876_1006794All Organisms → Viruses → Predicted Viral2018Open in IMG/M
3300025264|Ga0208029_1080432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium619Open in IMG/M
3300025267|Ga0208179_1096675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium588Open in IMG/M
3300025270|Ga0208813_1041283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1046Open in IMG/M
3300025274|Ga0208183_1025136All Organisms → Viruses → Predicted Viral1317Open in IMG/M
3300025274|Ga0208183_1052132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium819Open in IMG/M
3300025274|Ga0208183_1099489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium532Open in IMG/M
3300025276|Ga0208814_1020303Not Available2224Open in IMG/M
3300025277|Ga0208180_1077236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium784Open in IMG/M
3300025277|Ga0208180_1110730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium597Open in IMG/M
3300025278|Ga0207417_1049497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium668Open in IMG/M
3300025280|Ga0208449_1117320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium609Open in IMG/M
3300025280|Ga0208449_1123791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium585Open in IMG/M
3300025281|Ga0207881_1064220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium573Open in IMG/M
3300025282|Ga0208030_1066824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium974Open in IMG/M
3300025282|Ga0208030_1115767All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium661Open in IMG/M
3300025282|Ga0208030_1169157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium502Open in IMG/M
3300025286|Ga0208315_1132383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium568Open in IMG/M
3300025287|Ga0207903_1029881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1016Open in IMG/M
3300025293|Ga0208934_1002905All Organisms → Viruses → Predicted Viral4914Open in IMG/M
3300025300|Ga0208181_1062238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium753Open in IMG/M
3300025301|Ga0208450_1123771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium547Open in IMG/M
3300025305|Ga0208684_1020986All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2057Open in IMG/M
3300025543|Ga0208303_1074646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium764Open in IMG/M
3300025645|Ga0208643_1054034All Organisms → Viruses → Predicted Viral1222Open in IMG/M
3300025652|Ga0208134_1103227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium784Open in IMG/M
3300025830|Ga0209832_1029969Not Available2129Open in IMG/M
3300025873|Ga0209757_10081991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium974Open in IMG/M
3300025873|Ga0209757_10119738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium814Open in IMG/M
3300025881|Ga0209309_10224374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium891Open in IMG/M
3300026117|Ga0208317_1006537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium642Open in IMG/M
3300027522|Ga0209384_1042945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1258Open in IMG/M
3300027672|Ga0209383_1051463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1540Open in IMG/M
3300027686|Ga0209071_1130369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium724Open in IMG/M
3300027771|Ga0209279_10018274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium2192Open in IMG/M
3300027847|Ga0209402_10165622All Organisms → Viruses → Predicted Viral1467Open in IMG/M
3300027849|Ga0209712_10663273Not Available577Open in IMG/M
(restricted) 3300027856|Ga0255054_10358569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium709Open in IMG/M
(restricted) 3300027868|Ga0255053_10041792All Organisms → Viruses → Predicted Viral2191Open in IMG/M
(restricted) 3300027881|Ga0255055_10295996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium875Open in IMG/M
3300028022|Ga0256382_1107354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium670Open in IMG/M
3300028022|Ga0256382_1123629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium621Open in IMG/M
3300028039|Ga0256380_1016723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1191Open in IMG/M
3300028039|Ga0256380_1037097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium768Open in IMG/M
3300028039|Ga0256380_1055189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium596Open in IMG/M
3300028233|Ga0256417_1122135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium701Open in IMG/M
3300028448|Ga0256383_106382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium926Open in IMG/M
3300028448|Ga0256383_121847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium515Open in IMG/M
3300029301|Ga0135222_1001594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1346Open in IMG/M
3300029308|Ga0135226_1011549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium709Open in IMG/M
3300029319|Ga0183748_1031057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1724Open in IMG/M
3300029448|Ga0183755_1076207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium732Open in IMG/M
3300029635|Ga0135217_106361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium686Open in IMG/M
3300029787|Ga0183757_1014471All Organisms → Viruses → Predicted Viral2081Open in IMG/M
3300030722|Ga0308137_1057583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium691Open in IMG/M
3300030727|Ga0308140_1048831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium673Open in IMG/M
3300030728|Ga0308136_1033066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1193Open in IMG/M
3300031378|Ga0308145_1052467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium623Open in IMG/M
3300031602|Ga0307993_1146795Not Available592Open in IMG/M
3300031627|Ga0302118_10099246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1452Open in IMG/M
3300031647|Ga0308012_10444397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium504Open in IMG/M
3300031693|Ga0302139_10261614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium721Open in IMG/M
3300032073|Ga0315315_11177797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium679Open in IMG/M
3300032274|Ga0316203_1072875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium978Open in IMG/M
3300032820|Ga0310342_102473936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium621Open in IMG/M
3300034629|Ga0326756_018333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium814Open in IMG/M
3300034629|Ga0326756_046466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium537Open in IMG/M
3300034654|Ga0326741_025930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium1030Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine39.36%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean19.86%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater8.16%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.09%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.03%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.84%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.77%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic1.06%
Filtered SeawaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater1.06%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.06%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.71%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.71%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.71%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.71%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.71%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.71%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.71%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.71%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.35%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine0.35%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.35%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.35%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.35%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids0.35%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine0.35%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.35%
Subsea PoolEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool0.35%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.35%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001720Marine viral communities from the Pacific Ocean - LP-36EnvironmentalOpen in IMG/M
3300001722Marine viral communities from the Pacific Ocean - LP-50EnvironmentalOpen in IMG/M
3300001736Marine viral communities from the Deep Pacific Ocean - MSP-131EnvironmentalOpen in IMG/M
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300002165Marine viral communities from the Subarctic Pacific Ocean - LP-52EnvironmentalOpen in IMG/M
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300002484Marine viral communities from the Pacific Ocean - ETNP_2_130EnvironmentalOpen in IMG/M
3300002511Marine viral communities from the Pacific Ocean - ETNP_2_1000EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300002518Marine viral communities from the Pacific Ocean - ETNP_6_100EnvironmentalOpen in IMG/M
3300002519Marine viral communities from the Pacific Ocean - ETNP_2_300EnvironmentalOpen in IMG/M
3300002760Marine viral communities from the Pacific Ocean - ETNP_6_1000EnvironmentalOpen in IMG/M
3300002876Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI073_120m_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004276Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165mEnvironmentalOpen in IMG/M
3300005402Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006332Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200mEnvironmentalOpen in IMG/M
3300006339Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500mEnvironmentalOpen in IMG/M
3300006340Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770mEnvironmentalOpen in IMG/M
3300006731Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 AAIW_A metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006926Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaGEnvironmentalOpen in IMG/M
3300006927Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008216Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_GeostarEnvironmentalOpen in IMG/M
3300008217Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215EnvironmentalOpen in IMG/M
3300008218Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6EnvironmentalOpen in IMG/M
3300008219Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05EnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009412Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2EnvironmentalOpen in IMG/M
3300009413Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12EnvironmentalOpen in IMG/M
3300009414Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906EnvironmentalOpen in IMG/M
3300009418Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009595Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500EnvironmentalOpen in IMG/M
3300009601Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38EnvironmentalOpen in IMG/M
3300009602Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231EnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300009613Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3737_250EnvironmentalOpen in IMG/M
3300009620Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010932Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1EnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300011322Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 250_B metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011325Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 DCM_B metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011329Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S9 250_B metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017703Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019271Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101411XT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020374Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)EnvironmentalOpen in IMG/M
3300020434Marine microbial communities from Tara Oceans - TARA_B100001013 (ERX555944-ERR599071)EnvironmentalOpen in IMG/M
3300020436Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021443Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015EnvironmentalOpen in IMG/M
3300021791Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmerEnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023445Marine microbial mat from Loihi Seamount, Hawaii, USA - Marker 34 Individual AssemblyEnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300024057 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300025047Marine viral communities from the Pacific Ocean - LP-42 (SPAdes)EnvironmentalOpen in IMG/M
3300025049Marine viral communities from the Pacific Ocean - LP-55 (SPAdes)EnvironmentalOpen in IMG/M
3300025050Marine viral communities from the Pacific Ocean - LP-54 (SPAdes)EnvironmentalOpen in IMG/M
3300025069Marine viral communities from the Pacific Ocean - LP-38 (SPAdes)EnvironmentalOpen in IMG/M
3300025078Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025082Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025109Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025122Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes)EnvironmentalOpen in IMG/M
3300025125Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025218Marine viral communities from the Deep Pacific Ocean - MSP-103 (SPAdes)EnvironmentalOpen in IMG/M
3300025248Marine viral communities from the Deep Pacific Ocean - MSP-118 (SPAdes)EnvironmentalOpen in IMG/M
3300025251Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes)EnvironmentalOpen in IMG/M
3300025259Marine viral communities from the Deep Pacific Ocean - MSP-146 (SPAdes)EnvironmentalOpen in IMG/M
3300025264Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 (SPAdes)EnvironmentalOpen in IMG/M
3300025267Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes)EnvironmentalOpen in IMG/M
3300025270Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes)EnvironmentalOpen in IMG/M
3300025274Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025277Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes)EnvironmentalOpen in IMG/M
3300025278Marine viral communities from the Deep Pacific Ocean - MSP-82 (SPAdes)EnvironmentalOpen in IMG/M
3300025280Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes)EnvironmentalOpen in IMG/M
3300025281Marine viral communities from the Deep Pacific Ocean - MSP-97 (SPAdes)EnvironmentalOpen in IMG/M
3300025282Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)EnvironmentalOpen in IMG/M
3300025286Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes)EnvironmentalOpen in IMG/M
3300025287Marine viral communities from the Deep Pacific Ocean - MSP-131 (SPAdes)EnvironmentalOpen in IMG/M
3300025293Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 (SPAdes)EnvironmentalOpen in IMG/M
3300025300Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes)EnvironmentalOpen in IMG/M
3300025301Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 (SPAdes)EnvironmentalOpen in IMG/M
3300025305Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300026117Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3635_2500 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027847Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027868 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300028022Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750mEnvironmentalOpen in IMG/M
3300028039Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300mEnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028448Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300mEnvironmentalOpen in IMG/M
3300029301Marine harbor viral communities from the Indian Ocean - SRH1EnvironmentalOpen in IMG/M
3300029308Marine harbor viral communities from the Indian Ocean - SRB2EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029635Marine harbor viral communities from the Indian Ocean - SMH2EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030727Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_532_33.10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030728Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_940_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031378Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_319_33.10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031647Marine microbial communities from water near the shore, Antarctic Ocean - #179EnvironmentalOpen in IMG/M
3300031693Marine microbial communities from Western Arctic Ocean, Canada - CBN3_33.1EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300034629Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 543_2600EnvironmentalOpen in IMG/M
3300034654Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1008675513300000116MarineRYWPGGVSATDIKFFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAFPIVEVWLNHHRDRFVTATASTA*
BBAY92_1011013823300000947Macroalgal SurfaceLPGANFATISPYVAGTLKPSGVFAGCSYVYNGEQKFARYWGTGTSANGYSDVKFFLITDPNQTYYIQCSLSLSANELMVIKNYNTTVSSTASSGDTTTGQSSYYMLAASGAETEQQVRVIGKKQDDGEADSDAYPIVEVWLNMHRDRYVTATASSA*
BBAY94_1010080913300000949Macroalgal SurfaceITNPDQTYYIQCSLSLSAAEAAIVRNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVIGRAKFPDEGNDDAYPIVEVWLNTHRDRYVTATASTA*
JGI24006J15134_1000659213300001450MarineVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTVTGQSSYYLDGASGTEAAAAVRVIGRAKYPDEAESDIYPIVEVYINNHRDRFVTATASTA*
JGI24006J15134_1005093613300001450MarineQKFSRYWNGGLSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTADSGSTVTGQSSYYLDGASGTEAAAAVRVIGRAKYPDEKDSDAYPIVEVWLNHHRDRXVTATASTA
JGI24003J15210_1003349843300001460MarineWNGGLSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVIGKAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA*
JGI24004J15324_1001678953300001472MarineSLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVIGKAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA*
JGI24004J15324_1005916913300001472MarineFSRYWPGGVSATDIKFFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDTDAFPIVEVWLNHHRDRFVTASASTA*
JGI24005J15628_1019437323300001589MarineATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVIGRAQFPDELDSDAFPIVEVYIANHRDRFVTATASSA*
JGI24513J20088_101552423300001720MarineFSRYWNGGLSATDIKFFVITDPDQTYYIQASLSLSAAELAIVRNYNVTVSSTAASGSTVTGQSSYYLDGASGVESSAAVRVIGRAKYPDEKDSDAYPIVEVWLNHHRDRFVGATASTA*
JGI24513J20088_103182513300001720MarineDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEASAAVRVIGKAQYPDEKDSDAFPIVEVWLNHHRDRFVTATASTA*
JGI24525J20082_101917723300001722MarineKLITSNVLFTLSAAEAAICXNYPVTVSSTASSGSTVTGQSSYYLLAAGGLETELTCRVLGRSKLPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
JGI24659J20068_100358443300001736Deep OceanYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVIGKAKYPDEKDSDAYPIVEVWLNHHRDRFVGATASTA*
GOS2229_103672223300001963MarineWPGGVSATDIKFFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAFPIVEVWLNHHRDRFVTATASTA*
JGI24527J20359_100656513300002165MarineTSATDVKFFVITNPDQTYYIQCSLTLSAAEAAICKNYPVTVSSTASSGSTVTGQSSYYLLAAGGLETELTCRVLGRSKLPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
KVWGV2_1025292523300002242Marine SedimentKFARYWNGGVSATDIKFFVITDPNQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGAESEKQVRVVGKAKYPDEKDSDAYPIVEVWLNMHRDRYVTATASSA*
JGI25129J35166_103721613300002484MarineGGTSATDIKFFVITNPDQTYHIQCSLTLSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGTEAVAAVRGIGRAQLPSEGDGDAYPIVEVYLNTHRDRYVTATASTA*
JGI25131J35506_102485113300002511MarineEQKFARYWNGGTSATDIKFFVITNPDQAYYIQASLSLSAAELLITKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
JGI25131J35506_106702213300002511MarineSRYWPGGTSATDVKFFVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGNSSYYLLAAGGLETELTCRVIGRAKFPDEGNDDAYPIVEVWLNTHRDRYVTATASTA*
JGI25133J35611_1004679713300002514MarineGTCVTDLKFHVITDPDQIYYIQASLSLSVGEINVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAESEQAARVVKRAELPEEKDSDAFPIVEVWLNTHRDRYVTATASTA*
JGI25133J35611_1009795023300002514MarineVENGEQKFSRWWNGSTSATDIKFFVITDPDQTYHIQCSLTISAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGXESVLPVRGVGRAKFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
JGI25134J35505_1001735143300002518MarineGGTCVTDLKFHVITDPDQIYYIQASLSLSVGELNVTKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPDEKDSDAFPIVEVWLNTHRDRYVTATASSA*
JGI25130J35507_105912913300002519MarineENGEPKFSRYWNGSTSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVEVWINQHRDRYVTATASTA*
JGI25130J35507_110737713300002519MarineTDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTVTGQSSYYLDGASGVESSAAVRMIGKAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA*
JGI25136J39404_106209023300002760MarineGTSATDIKFFVITNPDQAYYIQASLSLSAAELLITKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
Ga0005243J43192_11744013300002876MarineKFSRYWNGGTSATDIKFFVITDPSQTYYIQCSLTLSAAEAAIAKNYTVTVSSTASSGSTVTGQSSYYLMASSGAETELAARVVGRAQYPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0066610_1021552923300004276MarineSRYWNGGTSATDIKFFVITDPSQTYYIQCSLTLSAAEAAIAKNYTVTVSSTASSGSTVTGQSSYYLMASSGAETELAARVVGRAQYPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0066855_1008319513300005402MarineIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGQSSYYLLAAGGLETELTCRVIGRSKLPDEKSNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0075474_1021447013300006025AqueousITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA*
Ga0075462_1002210413300006027AqueousQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA*
Ga0075441_1026564323300006164MarineDQVYYIQCSLTLSAAEAAIVRNYTATVSSTASSGNTVTGQSSYYLLAASGAETELACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASSA*
Ga0075443_1014994823300006165MarineFVITDPDQTYYIQSSLSLSAAELAIVLNYNVTVSSTASSGNTRTGQSSYYLDGASGTEASAAVRVIGRAKYPDEAESDIYPIVEVYINNHRDRFVTATASTA*
Ga0075446_1020507723300006190MarineTSATDIKFFVITDPDQTYYIQASLSLSAAELAIVANYNVTVSSTASSGNTVTGQSSYYLMGSSGAETQLAVRVIGRAKYPDEKDSDAYPIVECWINNHRDRFVTATASTA*
Ga0068500_138690523300006332MarineIQASLSLSAAELAIVKNYNVTDSSTASSGNTTTGQSSYYLDGACGAESEKQVRVVGKAKYPDEKDSDAYPIVEVRLNMHRDRYVTATASSA*
Ga0068481_129756323300006339MarineQCSLTLSAAEAAICKNYPVTVSSTASSGSTVTGQSSYYLLAAGGLETELTCRVIGRSKLPDEGNDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0068503_1012298313300006340MarineWAGATSATDIKFFVITDPDQSYYIQASLSLSANELVVAKNYNVTVSSTASSGSTVTGQSSYYLDGASGAESEKTVRVVGKAKYPDEKDSDAYPIVEVWLNMHRDRYVTATASSA*
Ga0079249_138125613300006731MarineATSATDIKFFVVTDPNQSYYIQASLSLSANELVVAKNYNVTVSSTASSGSTVTGQSSYYLDGASGAESEKTVRVVGKAKYPDEKDSDAYPIVEVWLNMHRDRYVTATASSA*
Ga0098038_116389423300006735MarineWNGGTSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
Ga0098038_116887323300006735MarineKFFIITDPNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGNTTTGNSSYYLLAASGGETEQVARVIGKKKDGEETDDTDAFPIVEVFLNTHRDRYVTATASTA*
Ga0098033_109836723300006736MarineYYIQASLSLSAAELLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
Ga0098037_126715523300006737MarineYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNVTVSSTASSGNTTTGQSSYYLLAASGGETEQAARVIGKKKDGEENDDSDAFPIVEVFLNTHRDRYVTATASTA*
Ga0098035_104366733300006738MarineTSATDIKFFVITDPDQTYHIQCSTTVSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDAASGAESVLPVRGIGRAKFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0098035_124066313300006738MarineCSLTLSAAEAAIVKNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVLGRAQFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0098042_111731423300006749MarineTGTSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNVTVSSTASSGNTTTGQSSYYLLAASGGETEQAARVIGKKRDGEENDDSDAFPIVEVFLNTHRDRYVTATASTA*
Ga0098042_115452313300006749MarineEQKFARYWNGGISATDIKFFVITDPDQTYYIQCSLTLSAAEAAIVKNYNVTVSSTASSGNTVTGQSSYYLLASTGAETELAARVVGRAQFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0098042_116137113300006749MarineSATDIKFFVITDPDQTYHIQCSTTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDAASGTEAVAAVRGIGRAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0098040_116396013300006751MarineIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA*
Ga0098040_120703913300006751MarineGGTSATDIKFFVITNPDQTYHIQCSLTLSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGTEAVAAVRGIGRAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0098048_120532413300006752MarineSRYWGTGTSAAGYSNVKFFIITDPDQTYYIQCSLSLSANELMITKNYNVTVSSTASSGNTTTGQSSYYLMASSGAETELAARVIGKKRDGEETDDTDAYPIVEVFLNTHRDRYVTATASTA*
Ga0098044_109499813300006754MarineKFFVITNPDQTYYIQCSLTLSAAEAAIVRNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0098044_110064323300006754MarineQCSLTLSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGTEAVAAVRGIGRAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0098054_125571013300006789MarineIQCSTTVSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDAASGAESVLPVRGIGRAKFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0098055_122933413300006793MarineTDIKFFVITDPDQTYHIQCSTTVSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDAASGAESVLPVRGIGRAKFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0070754_1045840213300006810AqueousDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTATGQSSYYLDGASGTEATAAVRVIGKAQYPDEKDSDAYPIVEVWINQHRDRYVTATASTA*
Ga0070750_1034602813300006916AqueousEQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA*
Ga0098051_100696813300006924MarineFRRHWTGGTCVTDLKFHVITDPDQVYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA*
Ga0098051_112658323300006924MarineWPGGTSATDVKFFVITNPDQTYYIQCSLTLSAAEAAIVRNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0098057_102909613300006926MarineYVENGEQKFSRWWNGSTSATDIKFFVITDPDQTYHIQCSLTISAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGLESVLPVRGVGRAKFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0098057_103826113300006926MarineEQKFSRYWPGGTSATDVKFFVITNPDQTYYIQCSLTLSAAEAAIVRNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVLGRAQFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0098034_116893813300006927MarineWPGGTSATDVKFFVITDPDQVYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0098034_117307413300006927MarineENGEQKFSRYWPGGTSATDVKFFVITNPDQTYYIQCSLTLSAAEAAIVRNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVLGRAQFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0098036_120374013300006929MarineNPDQAYYIQASLSLSAAELLITKNYNVTVSSTASSGNTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
Ga0075444_1006006013300006947MarineYWPGGVSASDIKFFVITNANQTYHIQCSLTLSAAETLIVKNYNVTVSSTASSGSTTTGQSSYYLMASSGAETELAARVIGRAQLPDENGTDAYPIVEVYLNTHRDNYVTATASSA*
Ga0075444_1020510823300006947MarineVENGEPKFSRYWPGGTSATDVKFFVITDPDQVYYIQCSLTLSAAEAAIVRNYTATVSSTASSGNTVTGQSSYYLMASSGAETELACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASSA*
Ga0070747_102243813300007276AqueousPSGVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQVYYIQASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIKKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA*
Ga0070747_120832813300007276AqueousFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEASAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA*
Ga0070747_120947923300007276AqueousPSGVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA*
Ga0099847_111710723300007540AqueousFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQVYYIQASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIKKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA*
Ga0099850_128316123300007960AqueousIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA*
Ga0110931_101238413300007963MarineVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGAESEKQVRVVGKAKYPDEKDSDAYPIVEVWLNMHRDRYVTATASSA*
Ga0110931_125462423300007963MarineYWGTGTSAAGYSDVKFFIITDPDQTYYIQCSLSLSANELMITKNYNVTVSSTASSGNTTTGQSSYYLLAASGGETEQAARVIGKKRDGEETDDTDAYPIVEVFLNTHRDRYVTATASTA*
Ga0114898_113130713300008216Deep OceanQKFARYWNGGVSATDIKFFVITDPVQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGAESEKQVRVVGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0114899_1006729113300008217Deep OceanENGEQKFSRYWPGGTSATDVKFFVITNPDQTYYIQCSLSLSAAEAAIVKNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVIGRAKFPDEGNDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114899_101349913300008217Deep OceanNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAASGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114899_120454113300008217Deep OceanGGTSATDIKFFVITNPDQTYHIQASLSISAEELLPVKNYDVTVSSTASSGNTTTGQSSYYLLGASGAETEKVARVIGKAKFPDEKDSDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114904_100500613300008218Deep OceanTSATDVKFFVITNPDQTYYIQCSLSLSAAEAAIVKNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVIGRAKFPDEGNDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114905_100712113300008219Deep OceanVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA*
Ga0114910_106087513300008220Deep OceanTNPDQTYHIQASLSLSAAELLPVKNYNVTVSSTASSGNTVTGQSSYYLDGASGLETELPVRVIGKAKYPDEKDSDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114910_107271013300008220Deep OceanFFVITNPDQTYFIQASLSLSVAELLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATGQVRVIGKAKYPDEKDSDAYPIVEVWLNQHRDRYVTATASTA*
Ga0114995_1026997313300009172MarineQTYHIQCSLTLSAAEALIVRNYNVTVSSTASSGNTTTGQSSYYLMASSGAETELAARVIGRAQLPDENGTDAYPIVEVYLNTHRDNYVTATASTA*
Ga0114996_1002837983300009173MarineTDIKFFVITDPDQTYYIQASLSLSANELLIVKNYNCTVSSTASSGSTVTGQSSYYLDGASGVETAKGVARVVGRAKFPDEKDGDAFPIVEVWLNLHRDRFVTATAAAAL*
Ga0114903_114672023300009412Deep OceanSLSLSAAELLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
Ga0114902_103539213300009413Deep OceanKFSRYWHGGTSATDIKFFVISDPDQTYYIQASLTLAAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0114902_114423723300009413Deep OceanWGTGTSANGYSDVKFFIITDPHQTYYIQCSLSLSANELMVVKNYPVTVSSTASSGDTTTGQSSYYMLAASGAETEQQVRVIGKKQDDGEADSDAYPIVEVWLNMHRDRYVTATASSA*
Ga0114902_115038723300009413Deep OceanCSTKLSAAELMIVKNYNVTVSSTASSGNTTTGQSSYYLDAASGAESEKQARVIGLKQDDGETEDSDSYPIVEVWLNTHRDRYITASTSTG*
Ga0114909_105335323300009414Deep OceanSATDIKFFVITNPDQTYHIQASLSLSAAELLVTKNYNVTVSSTASSGNTVTGQSSFYLDGASGAETALPVRVIGKAKFPDEKDSDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114908_108426523300009418Deep OceanWNGGTSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGAESEKQVRVVGKAKYPDEKDSDAYPIVEVWLNMHRDRYVTATASSA*
Ga0114908_109425513300009418Deep OceanYYIQASLSLSAVELLIVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA*
Ga0114908_111627123300009418Deep OceanTNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAASGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114908_125907623300009418Deep OceanIYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0115548_112124613300009423Pelagic MarineDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAFPIVEVWLNHHRDRFVTATASTA*
Ga0115548_124717613300009423Pelagic MarineDIKFFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTQTGQSSYYLDGASGTEATAAVRVIGKAQYPDEKDSDAYPIVEVWINQHRDRYVTATASTA*
Ga0115005_1037718513300009432MarineKFFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTAASGSTVTGQSSYYLDGASGTEAAAAVRVIGRAKYPDEKDSDAYPIVEVWLNHHRDRFVGATASTA*
Ga0115546_116291223300009435Pelagic MarineARYWNGGISATDIKFFVITDPDQTYYIQCSLTLSAAEAAIVKNYNVTVSSTASSGNTVTGQSSYYLLAATGAETELAARVVGRAQYPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0115004_1021279123300009526MarineVITDPDQTYYIHASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDTDAFPIVEVWLNHHRDRFVTATASTA*
Ga0105214_10163623300009595Marine OceanicGGTSATDVKFFVITNPDQTYYIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGQSSYYLLAAGGAETELTCRVLGRSKLPDEGNNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114914_104295313300009601Deep OceanHWTGGTSVTDLKFHVITDPDQVYYVQASLSLSIGELNVVKNYNVTVSSTASSGNTTTGQSSYYLLSSTGGETESAARVVKRAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA*
Ga0114900_109263223300009602Deep OceanFAGCQYVEDGEQKFRRHWTGGTSVTDLKFHVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA*
Ga0114900_112068523300009602Deep OceanVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAASGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114900_117589213300009602Deep OceanTGTSANGYSDVKFFIITDPHQTYYIQCSFSVSSNELMVVKNYPVTVSSTASSGDTTTGQSSYYMLAASGAETEQQVRVIGKKQDDGEADSDAYPIVEVWLNMHRDRYVTATASSA*
Ga0114911_106998823300009603Deep OceanSRYWPGGTSATDVKFFVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAASGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114901_104913123300009604Deep OceanSFVLNGEQKFSRHWTTGTSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGNTTTGNSSYYLLAASGGETEQVARVIGKKKDGEETDDTDAFPIVEVFLNTHRDRYVTATASTA*
Ga0114906_127239023300009605Deep OceanGGVSATDIKFFVITDPDQTYYIQASLSLSAAELAIVRNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVIGKAQFPDEKDSDAFPIVEVWLNHHRDRFVTATASTA*
Ga0114906_128310823300009605Deep OceanYYIQCSLSLSANELMVTKNYNVTVSSTASSGNTTTGQSSYYLLAATGAETELAARVIGKLQDDGEKDSDAYPIVEVWLNTHRDRYVTATASTA*
Ga0105228_12943623300009613Marine OceanicATDIKFFVITDPDQIYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114912_104058213300009620Deep OceanSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
Ga0114912_104451813300009620Deep OceanCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAASGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114912_111165413300009620Deep OceanYIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGNSSYYLLAASGAETELTCRVIGRAKFPDEGNDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0114912_111250213300009620Deep OceanIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0115105_1012415543300009679MarineVISDPDQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0098061_103881813300010151MarineDQTYHIQCSTTVSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDAASGAESVLPVRGIGRAKFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0098061_126745613300010151MarineRYLNGGTSATDIKFFVRTDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
Ga0098059_136322123300010153MarineLNGEQKFSRYWGTGTSAAGYSDVKFFIITDPDQTYYIQCSLSLSANELMVTKNYNVTVSSTASSGNTTTGQSSYYLLAASGGETEQAARVIGKKRDGEETDDTDAYPIVEVFLNTHRDRYVTATASTA*
Ga0098059_136322323300010153MarineLNGEQKFSRYWGTGTSAAGYSDVKFFIITDPDQTYYIQCSLSLSANELMVTKNYNVTVSSTASSGSTVTGQSSYYLMASSGAETEQAARVIGKKRDGEETDDSDAYPIVEVFLNTHRDRYVTATASTA*
Ga0098047_1006480513300010155MarinePGGTSATDVKFFVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAAGGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA*
Ga0098047_1010821913300010155MarineNQTYYIQCSTKLSAAELMVVKNYNVTVSSTASSGNTTTGQSSFYLDAASGAETELVARVIGLKQDDGETEDSDSYPIVEVWLNMHRDRYVTATASSA*
Ga0137843_108379513300010932Subsea PoolATDIKFFVISDPDQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0114934_1027666123300011013Deep SubsurfaceTNPDQTYHIQASLSLSAAELLVTKNYNVTVSSTASSGNTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA*
Ga0138359_102271823300011322MarineYYIQCSLTLSAAEAAICLNYPVTVSSTASSGNTITGQSSYYLLAASGAETELTCRVIGRSKLPDEGSNDAYPIVEVWLNTHRDRYVTATASTA*
Ga0138365_102190613300011325MarineASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0138367_118718113300011329MarineTSATDIKFFVISDPDQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA*
Ga0138258_139671113300012413Polar MarineDIKFFVITNANQTYHIQCSLTLSAAETLIVKNYNVTVSSTASSGSTTTGQSSYYLMASSGAETELAARVIGRAQLPDENGTDAYPIVEVYLNTHRDNYVTATASSA*
Ga0163179_1117222023300012953SeawaterSFVLNGDQKFSRHWTTGTSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGNTTTGNSSYYLLAASGGETEQVARVIGKKKDGEETDDTDAFPIVEVFLNTHRDRYVTATASTA*
Ga0181367_100830613300017703MarineDQTYHIQCSLTLSAAEALIVKNYNVTVSSTASSGSTTTGQSSYYLMASSGAETELPARVIGRAQLPDESDGDAYPIVEVYLNTHRDNYVTATASSA
Ga0181367_107235813300017703MarineGTSATDVKFFVITNPDQTYYIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGQSSYYLLAAGGAETELTCRVIGRSKDPDEGSNDAYPIVEVWLNTHRDRYVTATASTA
Ga0181369_108372513300017708MarineYARYLNGGISATDIKFFVITDPDQTYYIQCSLTLSAAEAAIVKNYNVTVSSTASSGNTVTGQSSYYLLASTGAETELAARVVGRAQFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0181404_115679713300017717SeawaterKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0181383_104848413300017720SeawaterSATDVKFFVITDPDQTYYIQASLSLSAVELLIVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0181388_116182423300017724SeawaterDQTYHIQCSTTLSSAEMLIVKNYNVTVSSTASSGSTTTGQSSYYMDAASGTEAVAAVRGIGRAKFPDEKDTDAYPIVEVYLNTHRDRYVTATASTA
Ga0181398_116442623300017725SeawaterATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTATGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWINQHRDRYVTATASTA
Ga0181431_111091623300017735SeawaterGEQKFARFWNGGTSATDIKFFVITNPDQTYHIQCSLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDAASGTEAVAAVRGIGRAQFPDEGDGDAFPIVEVYLNTHRDRFVTATASTA
Ga0181433_105251413300017739SeawaterTDPDQTYYIQASLSLSAVELLIVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0181418_103766323300017740SeawaterSASDIKFFVITNADQTYHIQCSLTLSAAEALIVKNYNVTVSSTASSGSTTTGQSSYYLMASSGAETELPARVIGRAQLPDESDGDAYPIVEVYLNTHRDNYVTATASTA
Ga0181418_110455823300017740SeawaterYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAFPIVEVWLNHHRDRFVTATASTA
Ga0181421_111557313300017741SeawaterGEQKFSRFWPGTVSATDIKFFVITDPDQTYYIQASLTVSAAELLIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGVESAAAVRAIGRAKFPDEGSDDAKPILEVWLNHHRDRFVTATASSA
Ga0181389_109059023300017746SeawaterGGTSATDIKFFVITDPDQTYHIQCSLTLSAAEALIVKNYNVTVSSTASSGSTTTGQSSYYLMASSGAETELAARVIGRAQLPDESDGDAYPIVEVYLNTHRDNYVTATASTA
Ga0181407_109674923300017753SeawaterQASLSLSAVELLIVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0181414_117196523300017759SeawaterYSDVKFFIITDPDQTYYIQCSLSLSANELMVTKNYNVTVSSTASSGNTTTGQSSYYLLAASGGETEQAARVIGKKRDGEETDDTDAYPIVEVFLNTHRDRYVTATASTA
Ga0181414_117606323300017759SeawaterTDIKFFVITDPDQTYYIQCSLTLSAAEAAIVKNYNVTVSSTASSGNTVTGQSSYYLLAATGAETELAARVVGRAQYPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0181408_110055223300017760SeawaterEQKFARYWNGGISATDIKFFVITDPDQTYYIQCSLTLSAAEAAIVKNYNVTVSSTASSGNTVTGQSSYYLLAATGAETELAARVVGRAQYPDEGNNDAYPIVEVWLNTHRDRYVTATAST
Ga0181408_114644813300017760SeawaterRQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASS
Ga0181406_125284013300017767SeawaterGTGTSAAGYSDVKFFIITDPDQTYYIQCSLSLSANELMITKNYNVTVSSTASSGNTTTGQSSYYLLAESGAETELAARVIGKKRDGEETDDTDAYPIVEVFLNTHRDRYVTATASTA
Ga0187220_122623523300017768SeawaterSLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAFPIVEVWLNHHRDRFVTATASTA
Ga0181430_100415013300017772SeawaterDLKFHVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0181430_114299823300017772SeawaterSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVIGKAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASSA
Ga0181432_104404023300017775SeawaterPDQTYHIQASLSLSAAELLIVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0181432_105112913300017775SeawaterQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGQSSYYLLAAGGLETELTCRVIGRSKLPDEGNDDAYPIVEVWLNTHRDRYVTATASTA
Ga0181395_119483123300017779SeawaterGVSATDIKLFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTQTGQSSYYLDGASGTEATAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0181423_114692623300017781SeawaterASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIRKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0181566_1090305723300018426Salt MarshFVITDPDQTYYIQASLSLSAAELLVVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVVGKAQFPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0193545_1012974623300019025MarineGTSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGNTTTGNSSYYLLAASGGETEQVARVIGKKKDGEETDDTDAFPIVEVFLNTHRDRYVTATASTA
Ga0182065_137318623300019271Salt MarshATDVKFFVITDPDQTYYIQASLSLSAAELLVVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVIGKAQFPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0206125_1030959213300020165SeawaterQKFARYWNGGISATDIKFFVITDPDQTYYIQCSLTLSAAEAAIVRNYNVTVSSTASSGSTVTGQSSYYLLAATGAETELAARVVGRAQYPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0211477_1021732823300020374MarineDPDQTYYIQCSLSLSANELMVTKNYNVTVSSTASSGNTTTGQSSYYLLAASGGETEQVARVIGKKKDGEETDDTDAFPIVEVFLNTHRDRYVTATASTA
Ga0211670_1052354023300020434MarineFFLITDPNQTYYIQCSLSLSANELMVIKNYNTTVSSTASSGNTTTGQSSYYCLAASGAESEQQLRVIDKIQDDGETDSDAYPIVEVWLNMHRDRYVTATASSA
Ga0211708_1020357313300020436MarineKFSRQWNGGLSATDIKFFVITDPDQTYYIQASLTVSAAELLVVKNYNVTVSSTASSGNTVTGQSSYYLDGASGVESAAAVRAIGRAKFPDEGSDDAKPILEVWLNHHRDRFVTATASTA
Ga0211518_1036477123300020440MarineVLNGEQKFSRHWTTGTSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGNTTTGNSSYYLLAASGGETEQVARVIGKKKDGEETDDTDAFPIVEVFLNTHRDRYVTATASTA
Ga0211579_1077533313300020472MarineHIATTLKPSGVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGEINVVKNYAVTVSSTASSGDTTTGQSSYYLLAASGAETELAARVVKKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0206693_123638623300021353SeawaterGTSATDVKFFVITNPDQTYHIQCSLTLSAAEAAICLNYPVTVSSTASSGNTITGQSSYYLLAAGGAETELTCRVIGRSKDPDEKTNDAYPIVEVWLNTHRDRYVTATASTA
Ga0213869_1033495523300021375SeawaterPGGVSATDIKFFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAFPIVEVWLNHHRDRFVTATASTA
Ga0206681_1027964223300021443SeawaterGGTSATDVKFFVITNPDQTYYIQCSLTLSAAEAAICKNYPVTVSSTASSGSTVTGQSSYYLLAAGGLETELTCRVIGRSKLPDEGNDDAYPIVEVWLNTHRDRYVTATASTA
Ga0226832_1045420323300021791Hydrothermal Vent FluidsVITDPDQTYYIQASLSLSAAELAIVRNYNVTVSSTASSGSTTTGQSSYYLLAASGAETEQAARVIGRAQLPDEGDSDAYPIVEVFLSGHRNNFVKAQVSTSV
Ga0212021_106015823300022068AqueousDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0212021_107404513300022068AqueousITDPDQTYYIQASLSLSAVELLIVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0196889_103103913300022072AqueousQKFSRHWNGGLSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVIGKAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0212022_104960823300022164AqueousANQTYHIQCSLTLSAAEALIVKNYNVTVSSTASSGSTTTGQSSYYLMASSGAETELPARVIGRAQLPDESDGDAYPIVEVYLNTHRDNYVTATASTA
Ga0196887_109213623300022178AqueousTDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTATGQSSYYLDGASGTEATAAVRVIGKAQYPDEKDSDAYPIVEVWINQHRDRYVTATASTA
(restricted) Ga0233412_1037523823300023210SeawaterDIKFFVITDPDQTYHIQCSTTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDAASGTEAVAAVRGIGRAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0257020_13793613300023445MarineTSATDVKFFVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGNSSYYLLAAGGLETELTCRVLGRAKFPGEGNDDAYPIVEVWLNTHRDRYVTATASTA
(restricted) Ga0255050_1012873423300024052SeawaterTNTDQTYHIQCSLTLSAAEAAICKNYPVTVSSTASSGSTVTGQSSYYLLAAGGAETELTCRVIGRSKDPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
(restricted) Ga0255051_1026392413300024057SeawaterGGTSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSVASSGNTVTGQSSYYLDGASGAETQLAVRVIGKAKYPDEKDSDAYPIVECWINNHRDRFVTATASTA
Ga0209992_1020702423300024344Deep SubsurfaceSRYWPGGTSATDLKFFVITDPDQTYHIQCSLTLSAAEALIVKNYNVTVSSTASSGSTVTGQSSYYLLAASGAETEQAARVIGRAQFPDEGDSDAYPIVEVFLNTHRDRYVTATASTA
(restricted) Ga0255048_1059383423300024518SeawaterLNGEQKFSRYWGTGTSAAGYSDVKFFIITDPDQTYYIQCSLSLSANELMVTKNYNVTVSSTASSGSTVTGQSSYYLLAASGAETEQAARVIGKKRDGEETDDTDAYPIVEVFLNTHRDRYVTATASTA
Ga0207897_11979613300025047MarineFFVITNPDQTYYIQCSLTLSAAEAAICKNYPVTVSSTASSGSTVTGQSSYYLLAAGGLETELTCRVLGRSKLPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0207898_100469713300025049MarineYYIQASLSLSAAELLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0207892_100778323300025050MarineATDIKFFVITNPEQAYYIQASLSLSAAELLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0207887_102902023300025069MarineATDIKFFVITDPDQSYYIQASLSLSANELVVAKNYNVTVSSTASSGSTVTGQSSYYLDGASGAESEKAVRVVGKAKYPDEKDSDAYPIVEVWLNTHRDRYVTATASSA
Ga0208668_102064413300025078MarinePGGTSATDVKFFVITNPDQTYYIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGQSSYYLLAAGGAETELTCRVIGRSKLPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0208668_109602923300025078MarineQKFSRYWPGGTSATDVKFFVITDPDQVYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNDDAYPIVEVWLNTHRDRYVTATASTA
Ga0207890_101624633300025079MarinePDQTYYIQASLSLSAAELAIVRNYNVTVSSTAASGSTVTGQSSYYLDGASGVESSAAVRVIGRAKYPDEKDSDAYPIVEVWLNHHRDRFVGATASTA
Ga0207890_106865913300025079MarineVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVLGRAQFPDELDSDAFPIVEVYIANHRDRFVTATASSA
Ga0208156_107856823300025082MarineYIQASTSLCVAELLIQKNYNVTVSSTASSGNTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0208791_104104623300025083MarineNGGISATDIKFFVITDPDQTYYIQCSLTLSAAEAAIVKNYNVTVSSTASSGNTVTGQSSYYLLASTGAETELAARVVGRAQFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0208157_108124313300025086MarineEQKFSRYWNGGVSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATAST
Ga0208013_108270023300025103MarineIQCSLTLSAAEAAIVRNYSATVSSTASSGSTVTGQSSYYLLAASGAETELACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0208013_110390413300025103MarineQKFSRYWGQGTSAAGYSDVKFFIITDPDQTYYIQCSLSLSANELMITKNYNVTVSSTASSGNTTTGNSSYYLMASSGAETELAARVIGKKRDGEETDDTDAYPIVEVFLNTHRDRYVTATASTA
Ga0208553_109670323300025109MarineNGEQKFSRYWPGGTSATDVKFFVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAAGGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA
Ga0208553_114811723300025109MarineGGTSATDIKFFVITNPDQTYHIQCSLTLSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGTEAVAAVRGIGRAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0208158_103039613300025110MarineSGVFAGCQYVEDGEQKFRRHWTGGTSVTDLKFHVITDPDQVYYIQASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIRKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0208158_104051613300025110MarineYWPGGTSATDIKFFVISDPDQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0208158_104867623300025110MarineCSFVLNGEQKFSRHWTTGTSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGDTTTGNSSYYLLAASGGETEQVARVIGKKRDGEENDDSDAFPIVEVFLNTHRDRYVTATASTA
Ga0208790_107372923300025118MarineKFFVITNPDQTYYIQCSLTLSAAEAAIVRNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0209535_107022213300025120MarineKFSRYWPGGVSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTRTGQSSYYLDGASGTEATAAVRVLGKAQYPDEKDSDAFPIVEVWINQHRDRYVTATASTA
Ga0209434_102051643300025122MarineATDVKFFVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAASGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA
Ga0209434_105231923300025122MarineNGYSDVKFFLITDPNQTYYIQCSTKLSAAELMIVKNYNVTVSSTASSGNTTTGQSSYYLDAASGAESEKQARVIGLKQDDGETEDSDSYPIVEVWLNMHRDRYVTATASSA
Ga0209434_109175123300025122MarineNGEQKFSRYWSGGTSATDIKFFVITNPDQTYHIQCSLTLSAAEMLIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGTEAVAAVRGIGRAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0209644_103253423300025125MarineTDPDQVYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNDDAYPIVEVWLNTHRDRYVTATASSA
Ga0209644_109755313300025125MarineYIQCSTKLSAAELMIVKNYNVTVSSTASSGNTTTGQSSYYLDAASGAESEKQARVIGLKQDDGETEDSDSYPIVEVWLNMHRDRYVTATASSA
Ga0208919_104618513300025128MarineGTSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGDTTTGNSSYYLLAASGGETEQVARVIGKKRDGEENDDSDAFPIVEVFLNTHRDRYVTATASTA
Ga0208919_109647313300025128MarineDIKFHVVTDPDQSYYIQASLSLSANELIVAKNYNVTVSSTASSGSTVTGQSSYYLDGASGAESEKTVRVVGKAKYPDEKDSDAYPIVEVWLNMHRDRYVTATASSA
Ga0208919_115311623300025128MarineLKPSGVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGEINVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAESEQAARVVKRAELPEEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0209232_103340243300025132MarinePNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGDTVTGNSSYYLLAASGGETEQVARVIGKKKDGEENDDSDAFPIVEVFLNTHRDRYVTATASTA
Ga0208299_121941413300025133MarineFVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAAGGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA
Ga0209336_1007884013300025137MarineKFSRYWPGGVSATDIKFFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDTDAFPIVEVWLNHHRDRFVTASASTA
Ga0209336_1014379223300025137MarineSRYWPGGTSATDIKFFVITDPDQTYHIQCSLTLSAAEALIVRNYNVTVSSTASSGSTVTGQSSYYLMASSGAETELAARVIGRAQYPDESDTDAFPIVEVFLNTHRDRYVTATASTA
Ga0209634_102528053300025138MarineEPKFSRFWNGGVSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVIGRAQFPDELDSDAFPIVEVYIANHRDRFVTATASS
Ga0209756_108007313300025141MarineRYWPGGTSATDVKFFVITDPDQTYYIQCSLTLSAAEAAVVKNYNVTVSSTASSGNTVTGQSSYYLLAATGAETELAARVVGRAQFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0209756_131853323300025141MarineQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAQFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0209337_107096013300025168MarinePKFSRFWNGGVSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVLGRAQFPDELDSDAFPIVEVYIANHRDRFVTATASSA
Ga0209337_129637013300025168MarineFSRYWNGGLSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTADSGSTVTGQSSYYLDGASGTEAAAAVRVIGRAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0209337_130486123300025168MarineWTGGTSVTDLKFHVITDPDQVYYIQASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIRKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0207882_100873033300025218Deep OceanLITDPNQTYYIMCSTKLSAAELMIVKNYNVTVSSAGSSGNTTTGQSSYYLDAASGAETELQARVIGLKQDDGETEDSDSYPIVEVWLNMHRDRYVTATASTNL
Ga0207904_102955323300025248Deep OceanQASLSLSAAELIIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVGATASTA
Ga0208182_102411413300025251Deep OceanYWNGGVSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0207876_100679413300025259Deep OceanVITNPDQAYYIQASLSLSAAELVIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVGATASTA
Ga0208029_108043213300025264Deep OceanDQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0208179_109667523300025267Deep OceanYWPGGTSATDIKFFVISDPDQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0208813_104128313300025270Deep OceanPGGTSATDVKFFVITNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAASGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA
Ga0208183_102513623300025274Deep OceanGGTSATDIKFFVITNPDQTYYIQASTSLCVAELLIQKNYNVTVSSTASSGNTVTGQSSYYLDGASGLETELPVRVIGKAKYPDEKDSDAYPIVEVWLNTHRDRYVTATASTA
Ga0208183_105213213300025274Deep OceanSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVEVWINQHRDRYVTATASTA
Ga0208183_109948913300025274Deep OceanYIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGNSSYYLLAASGAETELTCRVIGRAKFPDEGNDDAYPIVEVWLNTHRDRYVTATASTA
Ga0208814_102030313300025276Deep OceanSATDIKFFVITDPDQTYYIQASLSLSAAELAIVLNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVLGRAQFPDEAESDIYPIVEVYINNHRDRFVTATASTA
Ga0208180_107723623300025277Deep OceanSRYWPGGTSATDIKFFVITDPDQIYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0208180_111073013300025277Deep OceanSFVLNGEQKFSRHWTTGTSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVQKNYNCTVSSTASSGNTTTGNSSYYLLAASGGETEQVARVIGKKKDGEETDDTDAFPIVEVFLNTHRDRYVTATASTA
Ga0207417_104949713300025278Deep OceanITNPDQTYYIQCSLTLSAAEAAICLNYPVTVSSTASSGSTVTGQSSYYLLAAGGAETELTCRVIGRSKLPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0208449_111732013300025280Deep OceanTNPDQVYYIQCSLTLSAAEAAICLNYPVTVSSTASSGDTVTGNSSYYLLAASGAETELTCRVIGRAKFPSESSDDAYPIVEVWLNTHRDRYVTATASTA
Ga0208449_112379113300025280Deep OceanIYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0207881_106422023300025281Deep OceanPNQTYYIQCSTKLSAAELMLVRNYNVTVSSAGSSGNTTTGQSSYYLDADSGDESQKQARVIGLKQDDGETEDSDSYPIVEVWLNMHRDRYVTATASSA
Ga0208030_106682413300025282Deep OceanNGSTSATDIKFFVITNPDQTYFIQASLSLSVAELLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATGQVRVIGKAKYPDEKDSDAYPIVEVWLNQHRDRYVTATASTA
Ga0208030_111576723300025282Deep OceanAYYIQASLSLSAAELLITKNYNVTVSSTASSGNTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0208030_116915713300025282Deep OceanTDPDQIYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0208315_113238323300025286Deep OceanSANGYSDVKFFIITDPNQTYYIQCSLSLSANELMVTKNYNVTVSSTASSGNTTTGQSSYYLLAATGAETELAARVIGKLQDDGEKDSDAYPIVEVWLNTHRDRYVTATASTA
Ga0207903_102988113300025287Deep OceanNPDQTYHIQCSTTLSAAEMLIVKNYNVTVSSTASSGSTTTGQSSYYMDAASGTEAVAAVRGIGRAKFPDEKDTDAYPIVEVYLNTHRDRYVTATASTA
Ga0208934_1002905103300025293Deep OceanGGTSATDIKFHVVTDPDQSYYIQASLSLSANELIVAKNYNVTVSSTASSGSTVTGQSSYYLDGASGAESEKTVRVVGKAKYPDEKDSDAYPIVEVWLNMHRDRYVTATASSA
Ga0208181_106223813300025300Deep OceanTYYIQASLSLSVAELLPVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATGAVRVIGKAKYPDEKDSDAYPIVEVWINQHRDRYVTATASTA
Ga0208450_112377113300025301Deep OceanPDQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0208684_102098643300025305Deep OceanIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0208303_107464623300025543AqueousFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQVYYIQASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIKKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0208643_105403413300025645AqueousSCVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQVYYIQASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIKKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0208134_110322713300025652AqueousATLKPSGVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQVYYIQASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIKKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0209832_102996943300025830Pelagic MarineQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAFPIVEVWLNHHRDRFVTATASTA
Ga0209757_1008199113300025873MarinePDQVYYIQCSLTLSAAEAAIVKNYTATVSSTASSGNTTTGQSSYYLLAASGAETELACRVLGRAKFADEGNDDAYPIVEVWLNTHRDRYVTATASSA
Ga0209757_1011973813300025873MarineASLSLSAAELLITKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0209309_1022437413300025881Pelagic MarineKFSRHWNGGLSATDIKFFVITDPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAAAAVRVIGKAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0208317_100653713300026117Marine OceanicIQCSLTLSAAEAAICKNYPVTVSSTASSGSTVTGQSSYYLLAAGGLETELTCRVIGRSKLPDEKTNDAYPIVEVWLNTHRDRYVTATASTA
Ga0209384_104294523300027522MarineQASLSLSAAELLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0209383_105146333300027672MarineKFSRYWNGGTSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTVTGQSSYYLDGASGAETQLAVRVIGKAKYPDEKDSDAYPIVEVWINNHRDRFVTATASTA
Ga0209071_113036923300027686MarineKFFVITNPDQTYHIQCSLTLSAAETLIVKNYNVTVSSTASSGSTTTGQSSYYLMASSGAETELAARVIGRAQLPDENGTDAYPIVEVYLNTHRDNYVTATASSA
Ga0209279_1001827413300027771MarineRYWPGGTSATDVKFFVITDPDQVYYIQCSLTLSAAEAAIVKNYTATVSSTASSGSTVTGQSSYYLMASSGAETELACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASSA
Ga0209402_1016562213300027847MarineTSATDIKFFVITNPDQAYYIQASLSLSAAELIIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVGATASTA
Ga0209712_1066327313300027849MarineKFFVITNADQTYHIQCSLTLSAAEALIVRNYNVTVSSTASSGNTTTGQSSYYLMASSGAETELAARVIGRAQLPDENGTDAYPIVEVYLNTHRDNYVTATASSA
(restricted) Ga0255054_1035856923300027856SeawaterPDQTYYIQASLSLSAGELAIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGTEASAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
(restricted) Ga0255053_1004179243300027868SeawaterYYIQCSLTLSAAEAAVAKNYTVTVSSTASSGSTVTGQSSYYLMASSGAETELAARVVGRAQYPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
(restricted) Ga0255055_1029599623300027881SeawaterCSLTLSAAEAAIVRNYTATVSSTASSGSTVTGQSSYYLLAASGAETALACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASSA
Ga0256382_110735413300028022SeawaterKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0256382_112362913300028022SeawaterNSLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0256380_101672323300028039SeawaterRSLSLSAVELLIVKNYNVTVSSTASSGSTTTGQSSYYLDGASGTEAAAAVRVIGKAQYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0256380_103709723300028039SeawaterKFFVITNPDQTYHIQCSLTLSAAEAAICLNYPVTVSSTASSGNTVTGQSSYYLLAASGAETELTCRVIGRSKDPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0256380_105518923300028039SeawaterNIQCSLSLSANELMVTKNYNVTVSSTASSGNTTTGQSSYYLLAATGAETELAARVIGKLQDDGEKDSDAYPIVEVWLNTHRDRYVTATASTA
Ga0256417_112213513300028233SeawaterKPSGIFAGCSYVLNGEQKFSRYWGTGTSAAGYSDVKFFIITDPDQTYYIQCSLSLSANELMVTKNYNVTVSSTASSGSTVTGQSSYYLLAASGAETEQAARVIGKKRDGEETDDSDAYPIVEVFLNTHRDRYVTATASTA
Ga0256383_10638213300028448SeawaterGTSATDIKFFVISDPDQTYYIQASLTLSAAEMLIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEAVAAVRGIARAAFPDEGDGDAYPIVEVYLNTHRDRYVTATASTA
Ga0256383_12184723300028448SeawaterQCSLTLSAAEAAIVRNYTATVSSTASSGSTVTGQSSYYLLAASGAETELACRVLGRAKFPDEGNNDAYPIVEVWLNTHRDRYVTATASTA
Ga0135222_100159413300029301Marine HarborVFPSHDLVEGDVSATDIKFFVITDPDQTYYIQASLTVSAAELLVVKNYNVTVSSTASSGNTVTGQSSYYLDGASGVESAAAVRAIGRAKFPDEGSDDAKPILEVWLNHHRDRFVTATAST
Ga0135226_101154923300029308Marine HarborVSQSRSRPSGVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGEINVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVVKRAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0183748_103105713300029319MarineGGTSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGNTTTGQSSYYLDGASGAESEKQVRVVGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0183755_107620713300029448MarineIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVEVWINQHRDRYVTATASTA
Ga0135217_10636113300029635Marine HarborFPSHDPRVGVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGEINVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVVKRAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0183757_101447113300029787MarineGTSAAGYSDVKFFIITDPDQTYYIQCSLSLSANELMVTKNYNVTVSSTASSGNTTTGQSSYYLLAASGAETEQAARVIGKKRDGEETDDTDAFPIVEVFLNTHRDRYVTATASTA
Ga0308137_105758313300030722MarineFHVITDPDQVYYIQASLSLSVGELNIVRNYNVTVSSTASSGNTVTGQSSYYLMASSGAETELAARVIKRAEFPDEQDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0308140_104883113300030727MarineTSATDIKFFVITDPDQTYYIQASLSLSANELLIVKNYNCTVSSTASSGSTVTGQSSYYLDGASGVETAKGVARVVGRAMFPDEKDGDAYPIVEVWLNLHRDRFVTATAAAAI
Ga0308136_103306613300030728MarineDIKFFVLTDPDQTYHIQASLSLSAVELLIVKNYNVTVSSTASSGNTRTGQSSYYLDGASGVESSAAVRVIGKAKYPDEKDTDAYPIVEVWINHHRDRFVGATASTA
Ga0308145_105246713300031378MarineIQCSTTLSAAEMLIVKNYNVTVSSTASSGSTTTGQSSYYMDAASGTEAVAAVRGVGRAKFPDEKDTDAYPIVEVYLNTHRDRYVTATASSA
Ga0307993_114679523300031602MarineDQTYHIQCSLTLSSAETLIVKNYNVTVSSTASSGNTTTGQSSYYLMASSGAETELAARVIGRAQLPDENDGDAYPIVEVYLNTHRDNYVTATASSA
Ga0302118_1009924613300031627MarineVENGEPKFSRYWNGGTSATDIKFFVITDPDQTYYIQASLSLSAAELAIVANYNVTVSSTASSGNTVTGQSSYYLMGSSGAETQLAVRVIGRAKYPDEKDSDAYPIVECWINNHRDRFVTATASTA
Ga0308012_1044439713300031647MarineSATDIKFFVITDPDQTYYIQASLSLSAAELAIVLNYNVTVSSTASSGNTVTGQSSYYLDGASGTEASAAVRVIGRAKYPDEAESDIYPIVEVYINNHRDRFVTATASTA
Ga0302139_1026161413300031693MarineIKFFVITDPDQTYYIQASLSLSVGELAIVKNYNVTVSSTADSGSTVTGQSSYYLDGASGTEAAAAVRVIGRAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA
Ga0315315_1117779713300032073SeawaterKPSGVFAGCQYVEDGEQKFRRHWTGGTCVTDLKFHVITDPDQIYYIQASLSLSVGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAATGAETELAARVVKRAELPNEKDSDAFPIVEVWLNTHRDRYVTATASSA
Ga0316203_107287513300032274Microbial MatIQPFIAATLKPSGVFAGCQYVEDGEQKFRRHWTGGTSVTDLKFHVITDPDQVYYIQASLSLSIGELNVVKNYNVTVSSTASSGDTTTGQSSYYLLAASGAETEQAARVIRKAELPDEKDSDAFPIVEVWLNTHRDRYVTATASTA
Ga0310342_10247393613300032820SeawaterCSYVYNGEQKFARYWGTGTSANGYSDVKFFLITDPNQTYYIQCSTKLSAAELMIVKNYNVTVSSTASSGNTTTGQSSYYLDAASGAESEKQARVIGLKQDDGETEDSDSYPIVEVWLNMHRDRYVTATASSA
Ga0326756_018333_1_3423300034629Filtered SeawaterSANGYSDVKFFLITDPNQTYYIMCSTKLSAAELMIVKNYNVTVSSAGSSGNTTTGQSTYYLDAASGAESEKQARVIGLKQDDGETEDSDSYPIVEVWLNMHRDRYVTATASSA
Ga0326756_046466_2_3103300034629Filtered SeawaterFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTASSGSTVTGQSSYYLDGASGTEATAAVRVIGKAKYPDEKDSDAYPIVECWINQHRDRYVTATASTA
Ga0326741_025930_700_10293300034654Filtered SeawaterSATDIKFFVITDPDQTYYIQASLSLSAAELAIVKNYNVTVSSTADSGSTVTGQSSYYLDGASGTEAAAAVRVIGRAKYPDEKDSDAYPIVEVWLNHHRDRFVTATASTA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.