 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F012366 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 281 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVE |
| Number of Associated Samples | 165 |
| Number of Associated Scaffolds | 281 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.57 % |
| % of genes near scaffold ends (potentially truncated) | 54.45 % |
| % of genes from short scaffolds (< 2000 bps) | 95.02 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.377 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (33.096 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.943 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.246 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 281 Family Scaffolds |
|---|---|---|
| PF13467 | RHH_4 | 2.14 |
| PF04392 | ABC_sub_bind | 1.42 |
| PF13505 | OMP_b-brl | 1.07 |
| PF13676 | TIR_2 | 1.07 |
| PF03734 | YkuD | 1.07 |
| PF01068 | DNA_ligase_A_M | 0.71 |
| PF03466 | LysR_substrate | 0.71 |
| PF13458 | Peripla_BP_6 | 0.36 |
| PF00903 | Glyoxalase | 0.36 |
| PF03480 | DctP | 0.36 |
| PF02536 | mTERF | 0.36 |
| PF02556 | SecB | 0.36 |
| PF00805 | Pentapeptide | 0.36 |
| PF00027 | cNMP_binding | 0.36 |
| PF07045 | DUF1330 | 0.36 |
| PF02586 | SRAP | 0.36 |
| PF07750 | GcrA | 0.36 |
| PF01740 | STAS | 0.36 |
| PF00872 | Transposase_mut | 0.36 |
| PF02798 | GST_N | 0.36 |
| PF00144 | Beta-lactamase | 0.36 |
| PF11195 | DUF2829 | 0.36 |
| PF01551 | Peptidase_M23 | 0.36 |
| PF03631 | Virul_fac_BrkB | 0.36 |
| PF04909 | Amidohydro_2 | 0.36 |
| PF04325 | DUF465 | 0.36 |
| PF13358 | DDE_3 | 0.36 |
| PF13442 | Cytochrome_CBB3 | 0.36 |
| PF02774 | Semialdhyde_dhC | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 281 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.42 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.07 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.07 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.71 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.71 |
| COG1952 | Preprotein translocase subunit SecB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.36 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.36 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.36 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.36 |
| COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.36 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.36 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.36 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.36 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.36 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.36 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.36 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.38 % |
| All Organisms | root | All Organisms | 25.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 33.10% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.14% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.78% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.78% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.42% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.07% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.71% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.71% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.36% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026870 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_12348110 | 2124908045 | Soil | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEESVG |
| F62_08869810 | 2170459010 | Grass Soil | LRWFWWLTVNSPMTRADRVATLKEAKAQFQKSWDAWKAWAKLEEVP |
| F64_02642800 | 2170459011 | Grass Soil | MNADGPMTRSDRVATLEEAKAQLQASWDAWKAWAKLEEVD |
| FA3_02739790 | 2170459023 | Grass Soil | FRSFAVQGPMTRADRVATFEEAKAQFLKSCDAWKAWAKLERCPELR |
| FG2_07392460 | 2189573004 | Grass Soil | VPMTRSNRVATLDEAKAQFQKSWDAWKAWAKLEETE |
| deepsgr_02837830 | 2199352025 | Soil | RWFVANCSGPITRSDRVATLEKARAQFQKSAWKAWAKLEEVP |
| JGI10216J12902_1061024303 | 3300000956 | Soil | MVHSANHNGRMTRADKVATLEEAKAQFQKSWDAWKAWAKLEETA* |
| Ga0063454_1013832502 | 3300004081 | Soil | MNVNGPMTRSGHMPTLEEAKAQFQESWDDWKAWAKLEELE* |
| Ga0062594_1005903181 | 3300005093 | Soil | LNGPMKRSDRVASLEEAKDQFKTSWEAWKAWANLEERDQAEL* |
| Ga0062594_1018098201 | 3300005093 | Soil | MTVTGPMTRSDRVATLEEAKAQLRKSWDAWKVWAKLEEVD* |
| Ga0062594_1025856901 | 3300005093 | Soil | MNANVPMTRSDRVATLEEAKAQFQKELGRVEARARMEETE* |
| Ga0062594_1028385971 | 3300005093 | Soil | LRWFWSLTVNGPMTRSGRVATLEEAKAQFQKSWDAWKAWAKLEETE* |
| Ga0062594_1029187821 | 3300005093 | Soil | TVNGPMTRADRVATLEEAKAQFQKSWDAWKAWAKLEEIE* |
| Ga0066869_101220621 | 3300005165 | Soil | WSMTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVP* |
| Ga0068868_1008324822 | 3300005338 | Miscanthus Rhizosphere | FWSMTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEIE* |
| Ga0070689_1016861701 | 3300005340 | Switchgrass Rhizosphere | MNVNGPMTRSGHMPTLEEAKAQFQKSWDAWKAWAKVEEVP* |
| Ga0070692_100916845 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVDPPITRFDKAASLEEAKTQFQKSWDAWKVWAKLEEVD* |
| Ga0070671_1012863291 | 3300005355 | Switchgrass Rhizosphere | MTRSDKVATLEEAKAQFQKSWNAWKAWAKLEEVA*ASPRALA |
| Ga0070674_1003425292 | 3300005356 | Miscanthus Rhizosphere | MTATAGPMTRSGRGATLEEAKAQLWKSWDAWKAWANLEEID* |
| Ga0070663_1018006742 | 3300005455 | Corn Rhizosphere | LRWFWSMTVNGPMTRSDRVTTLEEAKAQFQKSWDAWKAWAKLKEVV* |
| Ga0070662_1003497613 | 3300005457 | Corn Rhizosphere | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVE* |
| Ga0070672_1005097273 | 3300005543 | Miscanthus Rhizosphere | MTRSDKVATLEEAKAQFQKSWNAWKAWAKLEEVA* |
| Ga0070672_1013841952 | 3300005543 | Miscanthus Rhizosphere | MTRSNRVATLEEAKAQFQRNWDAWKAWAKLEETE* |
| Ga0070693_1013423972 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MNANGPMTRSGRVATLEEAKAQFQKSWDAWKAWAMLEEVP* |
| Ga0070664_1001831564 | 3300005564 | Corn Rhizosphere | MTRSDRVAALEEAKAQFQKSWDAWKAWAMLEEVP* |
| Ga0070664_1007769742 | 3300005564 | Corn Rhizosphere | LRWFWSLIVNGPMTRSDRVATLEDAKAQFQKSWDAWKAWAKLEEVP* |
| Ga0068857_1006601123 | 3300005577 | Corn Rhizosphere | MTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVA* |
| Ga0068854_1004353182 | 3300005578 | Corn Rhizosphere | MTRSDKVATLEEAKAQFQKSWGAWKAWAKLDEVD* |
| Ga0068864_1002593365 | 3300005618 | Switchgrass Rhizosphere | TVNGPMTRSDRVATLEKAKAQFQKSWDAWKAWAKLQEVP* |
| Ga0068864_1013176792 | 3300005618 | Switchgrass Rhizosphere | NGPMTRSDRVATLEEAKAQFQKSWDAWKAWASLEETE* |
| Ga0068851_102267781 | 3300005834 | Corn Rhizosphere | MTVNDPMTRSDRVAALEEAKAQFQKSWDAWKAWAMLEEVP* |
| Ga0068870_100537815 | 3300005840 | Miscanthus Rhizosphere | LRWFWSLTVNGPMTRSGRVPTLQEAKAQFQKSWDAWKAWAKLEEVA* |
| Ga0068862_1006176784 | 3300005844 | Switchgrass Rhizosphere | VNGPMTRADRVATLEEAKAQFQKSWDAWKAWAKLEEIE* |
| Ga0075365_100213667 | 3300006038 | Populus Endosphere | MTRSDKVATLEEAKAQFQKSWDAWKAWAKLKEMSEAT* |
| Ga0075365_110861352 | 3300006038 | Populus Endosphere | FWSLTVNGPMTRSDRVAPLKEAQAQSQKSWDAWKVWAKLDEVID* |
| Ga0070712_1012189992 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VPIALTVNGPITRVATLDDAKAQFQKSWMAWKAWAKLEGLEGRP* |
| Ga0097621_1015057311 | 3300006237 | Miscanthus Rhizosphere | FWSMTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVP* |
| Ga0097621_1023531222 | 3300006237 | Miscanthus Rhizosphere | LVTGSMTRSDRVATLEEAKAQFQKRWDEWKAWANLEERG* |
| Ga0074057_121367392 | 3300006605 | Soil | MTVNGPMTRSGRVATLEEARAQLRKSWDAWKAWANLEEID* |
| Ga0079222_115303901 | 3300006755 | Agricultural Soil | AVQGPMTRSNRVATFEEAKAQFQKSWDAWKAWAKLEETE* |
| Ga0068865_1002377663 | 3300006881 | Miscanthus Rhizosphere | LPWFWSMNANGPMTRSDKVATLKEAKAQFQKSWGAWKAWAKLEGVE* |
| Ga0068865_1020267362 | 3300006881 | Miscanthus Rhizosphere | MTVDPPITRFDKAASLEEAKAQFQKSWDAWKVWAKLEEVD* |
| Ga0075424_1027052722 | 3300006904 | Populus Rhizosphere | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVV* |
| Ga0074063_142396802 | 3300006953 | Soil | MTRADRVATLEEAKAQFQKSWDAWKAWAKLEEIE* |
| Ga0105240_125195191 | 3300009093 | Corn Rhizosphere | GPMTRSDRVAALEEAKAQFQKSWDAWKAWAMLEEVP* |
| Ga0105240_126930631 | 3300009093 | Corn Rhizosphere | MTRSGRVATLEEAKAQLRKSWDAWKAWANLEEID* |
| Ga0105245_128048901 | 3300009098 | Miscanthus Rhizosphere | VNGPMTRSGRVATLEEAKAQVQKSWDAWKAWAKVEEVP* |
| Ga0105247_100794091 | 3300009101 | Switchgrass Rhizosphere | MTGNGPMTRSDRVATLEEAKAQSQKSWDAWKAWAKLEEVP* |
| Ga0105247_101653474 | 3300009101 | Switchgrass Rhizosphere | FWSLTVNGPMRSDRVATLEEAKAQFQKSWDAWKAWAKMEEVA* |
| Ga0099792_102212343 | 3300009143 | Vadose Zone Soil | RWFWSLTVNGPMTRSDRVATLEDAKAQFQKSWDAWKVWAKLEEVD* |
| Ga0105243_116628091 | 3300009148 | Miscanthus Rhizosphere | MNVNGPTTRSGHMPTLEEAKAQFQKSWDAWKAWAKVEEVP* |
| Ga0111538_126310811 | 3300009156 | Populus Rhizosphere | PMTRSDRVATLEEAKAQFQKSWKAWKAWAKLEGRP* |
| Ga0111538_129500712 | 3300009156 | Populus Rhizosphere | MTRSDRVATFEEAKAQFQKSWEAWKAWAKLKEAP* |
| Ga0111538_132141331 | 3300009156 | Populus Rhizosphere | MTANGPMTRSDKVATLEEAKAQFQKSWDAWKTWAKLEE |
| Ga0105242_109356524 | 3300009176 | Miscanthus Rhizosphere | IGPMTRSDRVATLEEAKAQLRKSWDAWKVWAKLEEVD* |
| Ga0105237_120659011 | 3300009545 | Corn Rhizosphere | TVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVPPSGG* |
| Ga0105237_121006041 | 3300009545 | Corn Rhizosphere | GPMTRSDRVATLEEAKAQFQKSWDAWKVWAKLEEVD* |
| Ga0105238_112228792 | 3300009551 | Corn Rhizosphere | MTVNGPMTRSGRGATLEEAKAQLWKSWDAWKAWANLEEID* |
| Ga0105249_104609704 | 3300009553 | Switchgrass Rhizosphere | SLTVNGPMTRSGRVATLEEAKAQFQKSWDAWKAWAKVEEVP* |
| Ga0105249_119596401 | 3300009553 | Switchgrass Rhizosphere | MTRSGRVATVDEAKAQFQQSWDAWKAWANLEETP* |
| Ga0105249_130992781 | 3300009553 | Switchgrass Rhizosphere | MTVNVPMTRSDRVATLEEAKAQFQKSWDAWKTWAKLEEAE* |
| Ga0126313_102059802 | 3300009840 | Serpentine Soil | MRQANGDMRTSNRVATLEIAKAEFEAAWLAWKAWAKLDEVE* |
| Ga0126313_113801661 | 3300009840 | Serpentine Soil | PMTRSNRVATLGEAKAQFQKGWNEWKAWAMLEELG* |
| Ga0126305_113022072 | 3300010036 | Serpentine Soil | MNANGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEETE* |
| Ga0134128_126105371 | 3300010373 | Terrestrial Soil | MTVNGPMTRSDRVATLEEAKAQFQKRSDAWKAWAKLEESVG* |
| Ga0105239_105904661 | 3300010375 | Corn Rhizosphere | PMTRCDKVATLEEAKVQFRKSWDAWKAWVELREDT* |
| Ga0105239_107519382 | 3300010375 | Corn Rhizosphere | MTVIGPMTRSDRVATLEEAKAQLRKSWDAWKVWAKLEEVD* |
| Ga0105239_120686551 | 3300010375 | Corn Rhizosphere | WVWSLTVNGPMTRSDKVATLEEAKAQFQKSWDAWKAWAKLEETP* |
| Ga0134127_131309171 | 3300010399 | Terrestrial Soil | MTRSDKVSTLEEAKAQFQKSWDAWKAWAKLKEMSEAT* |
| Ga0134122_104154833 | 3300010400 | Terrestrial Soil | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKTWAKLEEAE* |
| Ga0134122_111483391 | 3300010400 | Terrestrial Soil | MTRADRVATLEEAKAQFQKSWDAWKAWANLEEVP* |
| Ga0134121_121519362 | 3300010401 | Terrestrial Soil | LRWFWSMTVNGPMTRSDKVATLEEAKAQFQKSWNAWKAWAKLEE* |
| Ga0105246_102427173 | 3300011119 | Miscanthus Rhizosphere | MTRSDKVATLEEAKAQFQKSWDAWKAWAKLEEVL* |
| Ga0105246_108501461 | 3300011119 | Miscanthus Rhizosphere | SMRWFWSLTVNGRMTRADRVATLEEAKALFQKSWDVWKA* |
| Ga0105246_110602201 | 3300011119 | Miscanthus Rhizosphere | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAK |
| Ga0126317_101704342 | 3300011332 | Soil | MTVNGPMTRSGRVPSLEEAKAQFQKSWDAWEAWAKLEE |
| Ga0150985_1012993601 | 3300012212 | Avena Fatua Rhizosphere | MNANGPMTRSGRVATLEEAKAQFQKSWDAWKAWAQLKESK* |
| Ga0150985_1033166052 | 3300012212 | Avena Fatua Rhizosphere | MTRSDRVATLKEAKAQFQKSWDAWKAWAKMEEVL* |
| Ga0150985_1038444271 | 3300012212 | Avena Fatua Rhizosphere | NRQRSMTHSDRVATLEEAKSQFQKSWDAWKAWAKMEEAPGES* |
| Ga0150985_1053994471 | 3300012212 | Avena Fatua Rhizosphere | MTRSNRVATLEEAKAQFQKSWEARKAWAELEEVP* |
| Ga0150985_1070886932 | 3300012212 | Avena Fatua Rhizosphere | MTVNGPMTRSNGVTTLEDVKAQFQKSWDEWKTWAKLEELP* |
| Ga0150985_1089963001 | 3300012212 | Avena Fatua Rhizosphere | MTRSGRVATLEEAKAQFQKNGDAWKAWAKLEEVP* |
| Ga0150985_1096697402 | 3300012212 | Avena Fatua Rhizosphere | MTRSDRVATLEEAKAQFQKSWDAWKAWAKLEGTD* |
| Ga0150985_1111508932 | 3300012212 | Avena Fatua Rhizosphere | MTRSDRVATFEGAKAQFQKSWEAWKMWAKMEEEIG |
| Ga0150985_1121819281 | 3300012212 | Avena Fatua Rhizosphere | MNANGPMTRSDRGATLEEAKAQLQKSWDAWKAWAKLEETK* |
| Ga0150985_1173377942 | 3300012212 | Avena Fatua Rhizosphere | MTVNGPMTRADRVATLEEAKAQFQKSWDAWKAWAKLEEIE* |
| Ga0150985_1228285192 | 3300012212 | Avena Fatua Rhizosphere | MTVNGPMTRSDRVATIEEAKAQFQKSWDAWKAWAKMEEV* |
| Ga0150984_1026595392 | 3300012469 | Avena Fatua Rhizosphere | MTRSDRVARLEEAKAQFQKSWNAWKAWAKMEETP* |
| Ga0150984_1090087713 | 3300012469 | Avena Fatua Rhizosphere | MTRSDRVATLEDAKAQLRKSWDAWKVWALLKEVD* |
| Ga0150984_1101485821 | 3300012469 | Avena Fatua Rhizosphere | MTRSDKVATLKEAKAQFQKCWDEWKAWAKLEETE* |
| Ga0150984_1154391361 | 3300012469 | Avena Fatua Rhizosphere | MTRADKVATLEEAKAQFQKSWDAWKAWAKLEEVA* |
| Ga0150984_1181084921 | 3300012469 | Avena Fatua Rhizosphere | MNANSPMTRADRVATLEKAKADLQKSWHEWKAWAKLQEVE* |
| Ga0150984_1223576593 | 3300012469 | Avena Fatua Rhizosphere | MTRSDRVATLEEAKAQFQKSWEARKAWAELEEVP* |
| Ga0150984_1230931741 | 3300012469 | Avena Fatua Rhizosphere | LRWFWSMTANGPMTRAGRVATLEEAKAHFQKSWDAWKVWANLEAVP* |
| Ga0137398_101717842 | 3300012683 | Vadose Zone Soil | MTRADRVATLEEAKAKFQKSWDAWKAWVKLEEVA* |
| Ga0137398_112629361 | 3300012683 | Vadose Zone Soil | PLTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVPGES* |
| Ga0157299_103412582 | 3300012899 | Soil | MNANGPMTRSGRVATLEEAKAQFQKSWNAWKAWAERLNFFP* |
| Ga0157290_102048052 | 3300012909 | Soil | MTVTGPMTRSGRVATLEEAKAQLRKNWDAWKAWAKLEEID* |
| Ga0157302_104295802 | 3300012915 | Soil | LRWFWSLTVNGPRTRSDRVATLEEAKAQFQKSWDARKAWAKMEEVW* |
| Ga0137419_118926961 | 3300012925 | Vadose Zone Soil | MTRSGRLATLEEAKAHFQKSWDAWKAWAKLEEAP* |
| Ga0162653_1000032031 | 3300012937 | Soil | TVNGPMTCSDRVATLEEAKAQFQKSWDAWKAWAKLEEVQ* |
| Ga0162653_1000110992 | 3300012937 | Soil | LTVNPPMARSGRVATQEEAKAQFQKSWDAWKCWAKLEEVA* |
| Ga0162650_1000082181 | 3300012939 | Soil | VVPIALTVNGPITRVATLDEAKAQFQKSWDAWKAWAKL |
| Ga0162650_1000459941 | 3300012939 | Soil | MTRSDKVATLEEVKAQFQKSWDAWKAWAKLEEMD* |
| Ga0162650_1000892891 | 3300012939 | Soil | LTLNGQMTRADRVATLDEAKAQFQKSWDAWKAWTKLEEVV* |
| Ga0164300_100222342 | 3300012951 | Soil | LTINCPTTRSDRVATLEEAKAQFQKSWDAWKAWAKLDEVD* |
| Ga0164300_102728663 | 3300012951 | Soil | MARSNKVATLEEAKAQSQKSWDAWKAWAKLKEMSEAT* |
| Ga0164300_103700391 | 3300012951 | Soil | MTVNGPMTRSDRVATLAEAKAQFLKSWDAWKAWAKLEESD* |
| Ga0164300_104403983 | 3300012951 | Soil | MTRSDRVATLEEAKAQLRKSWDAWKVWAKLEEVD* |
| Ga0164300_105127101 | 3300012951 | Soil | WFWSITVNGPMTRSDRVATLEEAKAQFQKRSDAWKAWAKLEESVG* |
| Ga0164303_109332172 | 3300012957 | Soil | RWLWSITVNGPMTRSDRVATLEDAKAQFQKSWDSWKVWAKLEEVD* |
| Ga0164303_111886022 | 3300012957 | Soil | MTVNGPMTRSDRGATLEEAKAQFQKSWDAWKTWAKLEEAE* |
| Ga0164299_103145962 | 3300012958 | Soil | MTRSDRVATLEEAKAQFQKRWDEWKAWANLEERG* |
| Ga0164301_103662771 | 3300012960 | Soil | RWFWSLTVNGPMTRSDRVATLEEAKAQFQKSWDSWKAWAMLEEVE* |
| Ga0164301_105865992 | 3300012960 | Soil | SLTVNGPMTRSDRVATLEKAKAQFQKSWDAWKAWAKLQEVP* |
| Ga0164301_109383181 | 3300012960 | Soil | NGPMTRSDRVATLEEAKAQFQKRSDAWKAWAKLEESVG* |
| Ga0164301_114843022 | 3300012960 | Soil | MTVNGPMTRSDRVATLDEAKAQFQKSWDAWKAWAKLEETE* |
| Ga0164302_107964162 | 3300012961 | Soil | MTVTGPMARSGRVATLEEAKAQFQQSWDAWKTWANLEEMP* |
| Ga0164302_113222031 | 3300012961 | Soil | LTVNGPMTRSDRVASLEEAKAQFQKSWDAWKAWANLEETE* |
| Ga0164308_106943071 | 3300012985 | Soil | MTRSDKVATLEEAKAQFQKSWDAWKAWAKLEESVG* |
| Ga0164308_109859562 | 3300012985 | Soil | MTVNGPMTRADRVATLEEAKAQFQKSWEAWKAWAKLEEVP* |
| Ga0164308_111184162 | 3300012985 | Soil | GPMTRSDKVATLEEAKAQFQKSWNARKAWAKLEETE* |
| Ga0164307_108349782 | 3300012987 | Soil | VNGPMTRSDRVATLDEAKAQFQKSWDAWKAWAKLEETE* |
| Ga0164307_110731261 | 3300012987 | Soil | MMRSDKVATLEEAKAQFQKSWDAWKAWANLEEVP* |
| Ga0164305_101182095 | 3300012989 | Soil | MTRSDKVATLEEAKAQFQKSWDAWKAWANLEEVP* |
| Ga0164305_115291732 | 3300012989 | Soil | MNANGPMTRADRVATLEEAKAQFQKSWEAGKAWAKLEEAP* |
| Ga0163162_104448663 | 3300013306 | Switchgrass Rhizosphere | MSANGPMTRSDKVATLEEAKAQFQKSWDAWKVWAKLEEVD* |
| Ga0163162_108429051 | 3300013306 | Switchgrass Rhizosphere | MTRSDRVATLEDAKAQFQKSWDSWKVWAKLEEVD* |
| Ga0163162_111029123 | 3300013306 | Switchgrass Rhizosphere | MARSGRVASLEEAKAQFQKSWDAWKAWAKLEEVPP |
| Ga0163162_112255853 | 3300013306 | Switchgrass Rhizosphere | FWSMTVNGPMTRSDRVATFEDAKEQFQKSWGAWKAW* |
| Ga0163162_112481451 | 3300013306 | Switchgrass Rhizosphere | GPMTRSDRVATLDEAKAQFQKSWDAWKAWAKLEETE* |
| Ga0163162_118533222 | 3300013306 | Switchgrass Rhizosphere | RWFWSLTVNGPMTRSDKVATLEEAKAQFQKSWNAWKAWAKLEEVA* |
| Ga0163162_125344151 | 3300013306 | Switchgrass Rhizosphere | MTRSNRVATPEEAKAQFQRNWDAWKAWAKLEETE* |
| Ga0157375_103379264 | 3300013308 | Miscanthus Rhizosphere | MTVNGPMTRSDRVATLDEAKAQFQKSWKAWKAWAKLEGRP* |
| Ga0157375_113205571 | 3300013308 | Miscanthus Rhizosphere | MTRANRVATFEEAKAQFQKSWDAWKAWAKVEEVP* |
| Ga0157375_125888692 | 3300013308 | Miscanthus Rhizosphere | TVNGPMTRADRVATLEEAKAQFQNSWDTWKAWAKLEETD* |
| Ga0163163_130956842 | 3300014325 | Switchgrass Rhizosphere | LTVNPPMARSNKVATLDEAKAQLRKSWDAWKAWAELVETE* |
| Ga0157380_112231631 | 3300014326 | Switchgrass Rhizosphere | MTGNGPMTRSDRVATLEEAKAQSQKSWDAWKAWAKLEEVP |
| Ga0157380_117959321 | 3300014326 | Switchgrass Rhizosphere | MTVNGPMTRSGRVATLEEAKAQLWKSWDAWKAWANLEEID* |
| Ga0157380_124440721 | 3300014326 | Switchgrass Rhizosphere | MTRSDRVATLEEAKAQFQKSWECLEAWAKLEEVPGES* |
| Ga0157380_133900343 | 3300014326 | Switchgrass Rhizosphere | VNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVP* |
| Ga0157377_108665123 | 3300014745 | Miscanthus Rhizosphere | MTVNGPMTRSDRVATLEEAKAQFQKSWNAWKAWAKLEEVA* |
| Ga0157377_112935092 | 3300014745 | Miscanthus Rhizosphere | MTRSGRVATLEEAKAQFQKSWDAWKAWAKLEEVP* |
| Ga0157379_105371404 | 3300014968 | Switchgrass Rhizosphere | MTRSGRVATLEEAKAQFQKSWDAWKAWAKLEEIE* |
| Ga0157379_110895701 | 3300014968 | Switchgrass Rhizosphere | MNVNGPTTRSGHMPTLEEAKAQFQKSWDAWKAWAKLEEMS* |
| Ga0157376_105841901 | 3300014969 | Miscanthus Rhizosphere | MTRADRVATLEEAKAQFQKSWDAWKAWAKLEEVE* |
| Ga0157376_107972511 | 3300014969 | Miscanthus Rhizosphere | TVNGPMTRSGRVATLEEAKAQFQKSWNAWKAWAKLEE* |
| Ga0157376_121976342 | 3300014969 | Miscanthus Rhizosphere | RSDKVATLEEAKAQFQKSWDAWKAWAKLKEMSEAT* |
| Ga0132258_100876878 | 3300015371 | Arabidopsis Rhizosphere | MTANGPMTRAGRVATLEEAKAHFQKSWDAWKVWANLEAVP* |
| Ga0132258_104701245 | 3300015371 | Arabidopsis Rhizosphere | MTRSDRVATLEEAKAQFQKRSDAWKAWAKLEESVG* |
| Ga0132258_104935006 | 3300015371 | Arabidopsis Rhizosphere | MTVNGPMTRSDRVATLEEAKAQFQKSWDEWKAWAKLEETQFARRRR* |
| Ga0132258_109721772 | 3300015371 | Arabidopsis Rhizosphere | VTRADKVATLEEAKAQFQKSWDAWKAWAELKECE* |
| Ga0132258_111714711 | 3300015371 | Arabidopsis Rhizosphere | MTVNGPMTRADRVATLEEAKAQFQKSWDSWKAWAKLEEVE* |
| Ga0132258_116981012 | 3300015371 | Arabidopsis Rhizosphere | MNANGPMTRADRVATLEEAKAQFQKSWHAWKAWAKLEEVE* |
| Ga0132258_124231365 | 3300015371 | Arabidopsis Rhizosphere | MTVNGPMTRSDRVATLAEAKAQFLKSWDAWKAWAKLEE |
| Ga0132258_127011521 | 3300015371 | Arabidopsis Rhizosphere | MKRLDRVATLEEAKAQFQQSWDAWKTWANLEEMP* |
| Ga0132258_131500432 | 3300015371 | Arabidopsis Rhizosphere | MTVNGPMTRSDRVTTLEEAKAQFQKSWDAWKAWAKLKEVV* |
| Ga0132256_1011650813 | 3300015372 | Arabidopsis Rhizosphere | MTVNGPMTRADRVATLEKAKAQFQKSWDSWKAWAKLEEVE* |
| Ga0132256_1031224131 | 3300015372 | Arabidopsis Rhizosphere | WSLTVNPPMARSGRVATLEEAKAQLRKSWDAWKAWAGLVKNG* |
| Ga0132257_1023855622 | 3300015373 | Arabidopsis Rhizosphere | MTVNGPMTRSDRVTTLEEAKAQFQKSWDAWKAWAKLEEVP* |
| Ga0132255_1057460461 | 3300015374 | Arabidopsis Rhizosphere | PMTRSDRVATLAEAKAQFLKSWDAWKAWAKLEESD* |
| Ga0163161_110928181 | 3300017792 | Switchgrass Rhizosphere | LRWFWSLTVNGPMTRSDRVATLDEAKAQFQKSWDAWKAWAKLEETE |
| Ga0184608_100792303 | 3300018028 | Groundwater Sediment | VTGPMTRSDRVATLAEAKAQFQKSWDAWKAWAKLEEAD |
| Ga0184634_101078321 | 3300018031 | Groundwater Sediment | QPPMTRSGRLATLEEAKAQFQKSWNAWKAWAKLEEVP |
| Ga0184635_102237251 | 3300018072 | Groundwater Sediment | MTVNGPMTRSGRVATLEEARAQLWKSWDAWKAWANLEEI |
| Ga0184624_100404394 | 3300018073 | Groundwater Sediment | MTVNGPMTRSDRVATFEEAKAGFQKSWDAWKAWAKLEEVP |
| Ga0184624_100586863 | 3300018073 | Groundwater Sediment | MTATAGPMTRSGRGATLEEAKAQLWKSWDAWKAWADLEEID |
| Ga0184624_100598392 | 3300018073 | Groundwater Sediment | MNVNGPMTRSDRVATLEEAKARFQKNWNAWKAWAKLEEMP |
| Ga0184624_100796233 | 3300018073 | Groundwater Sediment | VVPIALTVNGPITRVATLDEAKAQFQKSWDAWKAWAKLEESVG |
| Ga0184624_102868981 | 3300018073 | Groundwater Sediment | MTVNGPMTRSGRVATLEEARAQLWKSWAAWKAWANLEEID |
| Ga0184633_101568083 | 3300018077 | Groundwater Sediment | LRWFWSLTVNPPMTRSDKVATLEEAKAQFQKSWDAWKA |
| Ga0184633_104441992 | 3300018077 | Groundwater Sediment | VTVNGPMTRSDRVATLEEAKAQFQKSWDAWKKGAKLEEID |
| Ga0184625_105942022 | 3300018081 | Groundwater Sediment | WFWSMTVNGPMTRSDRVATFEEAKAGFQKSWDAWKAWAKLEEMP |
| Ga0184639_105094122 | 3300018082 | Groundwater Sediment | MTVNGPMTRSDRVATFEEAKAGFQKSWDAWKAWAKLEEVTGES |
| Ga0184628_104038882 | 3300018083 | Groundwater Sediment | MTVNGPMTRSGRVATLEEARAQPRKSWDAWKAWANLEEID |
| Ga0190269_116069841 | 3300018465 | Soil | MTVNGPMTRADRVSTLKEAKAQFQKSWDVSKAWAKLEETP |
| Ga0190270_102190863 | 3300018469 | Soil | MNVNGPMTRSGHMPTLEEAKAQFQKSWDDSKAWGMEELE |
| Ga0190270_110588441 | 3300018469 | Soil | MNVNGPMTRSGHMPTLEEAKAQFQKSWDAWKAWAKVEEVP |
| Ga0190270_122392292 | 3300018469 | Soil | MTVDPPITRFDKAASLEEAKAQFQKSWDAWKVWAKLEEVD |
| Ga0190270_126608382 | 3300018469 | Soil | TVNGPMTRSDRVATLEEARAQFQKSWDTWKAWAKLEETE |
| Ga0190274_103335533 | 3300018476 | Soil | MTRSGRVATLEETKAQFQKSWDAWKAWANLEEPGSVSWDT |
| Ga0190274_103759023 | 3300018476 | Soil | FWSLTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEAG |
| Ga0190274_111612944 | 3300018476 | Soil | VNGPMTRADRVATLEVAKAWVKKCWDGWKAWAKLEEALK |
| Ga0190274_129762851 | 3300018476 | Soil | MTVNGPMTGADRVATLEEAKVQFQKSWDAWKAWAKLEETE |
| Ga0190271_103637191 | 3300018481 | Soil | MTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVADES |
| Ga0190271_106167802 | 3300018481 | Soil | MTVNGPMTRSGRVETLEEARAQLRKSWDAWKAWANLEEID |
| Ga0190271_120721902 | 3300018481 | Soil | MTVNGPMTGADRVATLEEAKAQFQKSWDAWKAWAKLEETE |
| Ga0190267_110569802 | 3300019767 | Soil | NLRWFWSLTVTGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVP |
| Ga0193705_11032192 | 3300019869 | Soil | NLRWFWSLTVNGPMTRADRVWRPWRRRRPQFQKSWDAWKAWAKLEEVP |
| Ga0193718_10595411 | 3300019999 | Soil | HSASHNGPMTRADRVATLDEAKVQFQKSWDAWKAWAKLEEVA |
| Ga0193697_10159765 | 3300020005 | Soil | MTINGPMTRSDRVATLEEAKAQFRKSWEAWKAWAKLEEAP |
| Ga0193697_10766361 | 3300020005 | Soil | MTVDPPIARFDKAASLEEAKAQFQKSWDAWKGWAKSEEVD |
| Ga0193696_10801632 | 3300020016 | Soil | VNGPITRVATLDEAKAQFQKSWDAWKAWAKLEESVG |
| Ga0193696_11108171 | 3300020016 | Soil | FWTLTVNGPMTRAHRVATLEEAKAQFQKSWDAWKAWAKLEEVP |
| Ga0210382_100589931 | 3300021080 | Groundwater Sediment | FWSLTVNGPMTRADRVATLEEAKAKFQKSWDAWKAWVKLEEGP |
| Ga0210380_100050607 | 3300021082 | Groundwater Sediment | MTVNGPMTRSGRVATLEEARAQLRKSWDAWKAWANLEEID |
| Ga0210380_1000658512 | 3300021082 | Groundwater Sediment | MTATAGPMTRSGRGATLEEAKAQLWKSWDAWKAWANLEEID |
| Ga0193699_100243624 | 3300021363 | Soil | RWWSTHSANHNGPMTRADRVATLDEAKVQFQKSWDAWKAWAKLHEVP |
| Ga0193709_10747491 | 3300021411 | Soil | RCFWSLTVNGPMTRSDRVATLEETKAQFQKSWDSWKAWVKLEEGP |
| Ga0193695_10501354 | 3300021418 | Soil | RRVHRSDRVATLDEAKAHFQKSWDAWKAWAKLEEVPGES |
| Ga0222621_10383593 | 3300021510 | Groundwater Sediment | MTVNGPMTRSDRVATLEEAKAQFQKSWEAWKAWAKLEEE |
| Ga0222625_13648551 | 3300022195 | Groundwater Sediment | MTRSDRVATLEEAKAQFQKNWDAWKAWAKLEEVPGES |
| Ga0224452_11141592 | 3300022534 | Groundwater Sediment | WFWSLTVNGPMTRADRVWRPWRRRRPQFQKSWDAWKAWAKLEEVP |
| Ga0222622_102067663 | 3300022756 | Groundwater Sediment | MPVNGPMTRSDRVATLEEAKAHFQKSWDAWKAWAKLEEAE |
| Ga0222622_110975681 | 3300022756 | Groundwater Sediment | LRWFWSFTLHGPMTRSDRAATLEEAKAQFQKSWDAWKAWAKIEEAP |
| Ga0207697_102568112 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDPMTRSDRVAALEEAKAQFQKSWDAWKAWAMLEEVP |
| Ga0207653_101683133 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | SLRWFWSLTVNGPMTRSDKVATLEEAKAQFQKSWNAWKAWAKLEEVA |
| Ga0207642_101449041 | 3300025899 | Miscanthus Rhizosphere | TVNDPMTRSDRVAALEEAKAQFQKSWDAWKAWAMLEEVP |
| Ga0207680_101617593 | 3300025903 | Switchgrass Rhizosphere | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVE |
| Ga0207645_103186421 | 3300025907 | Miscanthus Rhizosphere | ASLRWFWSLTVNGPMTRSGRVPTLQEAKAQFQKSWDAWKAWAKLEEVA |
| Ga0207693_105605111 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | WFWSMTVNGPMTRADRVATLEEAKAQFQKSWDAWKAWAKLEEIE |
| Ga0207693_108649361 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VPIALTVNGPITRVATLDDAKAQFQKSWMAWKAWAKLEGLEGRP |
| Ga0207657_102252772 | 3300025919 | Corn Rhizosphere | MTVIGPMTRSDRVATLEEAKAQLRKSWDAWKVWAKLEEVD |
| Ga0207681_110162571 | 3300025923 | Switchgrass Rhizosphere | EHLRWFWSLTVNGPRTRSDRVATLEEAKAQFQKSWDARKAWAKMEEV |
| Ga0207701_106069532 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEMP |
| Ga0207709_103520051 | 3300025935 | Miscanthus Rhizosphere | RWFWSMTVTGPMTRSDRVATLEEAKAQLRKSWDAWKVWAKLEEVD |
| Ga0207691_102519801 | 3300025940 | Miscanthus Rhizosphere | TVNGPMTRSGRVATLEEAKAQFQKSWDAWKAWAKLEEVP |
| Ga0207691_114236661 | 3300025940 | Miscanthus Rhizosphere | LTVNGPMTRSDKVATLEEAKAQFQKSWDAWKAWAKLEEVP |
| Ga0207668_108958532 | 3300025972 | Switchgrass Rhizosphere | MPRSDRVATLEEAKAQFQKSWECLEAWAKLEEVPGES |
| Ga0207640_111092031 | 3300025981 | Corn Rhizosphere | LRWFWSLTVNGPMTRSDRVATLEKAKAQFQKSWDAWKAWAKLQEVP |
| Ga0207677_110941951 | 3300026023 | Miscanthus Rhizosphere | PMTRSDRVATLEEAKAQLRKSWDAWKVWAKLEEVD |
| Ga0207703_107912941 | 3300026035 | Switchgrass Rhizosphere | SMTVNGPMTRADRVATLEEAKAQFQKNCDAWKAWAKLEEIE |
| Ga0207678_119392921 | 3300026067 | Corn Rhizosphere | WSMTVNGPMTRADRVATLEEAKAQFQKSWDSWKAWAKLEEVE |
| Ga0207641_125675431 | 3300026088 | Switchgrass Rhizosphere | GPMTCSDRVATLEKAKAQFQKSWDAWKAWAKLQEVP |
| Ga0207683_104106891 | 3300026121 | Miscanthus Rhizosphere | MTRADRVATLGEAEAQFHKSWDAWKAWAKLEEVENGEA |
| Ga0207683_120578761 | 3300026121 | Miscanthus Rhizosphere | GSMTRSDRVATLEEAKAQFQKRWDEWKAWANLEERG |
| Ga0208762_10040251 | 3300026870 | Soil | PMTRSGRVATLEEAKAQLWKSWDAWKAWAKLEEMP |
| Ga0209488_103193033 | 3300027903 | Vadose Zone Soil | LRWFWSLTVNGPMTRSDRVATLEDAKAQFQKSWDAWKVWAKLEEVD |
| Ga0268264_115868992 | 3300028381 | Switchgrass Rhizosphere | SMTVNGPMTRADRVATLEEAKAQFQNSWDTWKAWAKLEETD |
| Ga0268264_116558632 | 3300028381 | Switchgrass Rhizosphere | MTRSDRVATLEEAKAQFQKSWECLEAWAKLEEVPGES |
| Ga0307295_100198813 | 3300028708 | Soil | MTVNGPMTRSNRVATLEEAKAQFQKTWDAWKAWAKLEEAP |
| Ga0307322_101719982 | 3300028710 | Soil | RWFWSLTVNGPMTRADREATLEEAKAQFQKSWDAWKAWAKLEEAP |
| Ga0307293_100612291 | 3300028711 | Soil | NGPMTRSDRVATLEEAKAQFQKSWDPWKAWAKLEEVA |
| Ga0307293_101040191 | 3300028711 | Soil | CFWSLTVNGPMTRSDRVATLEETKAQFQKSWDSWKAWAKLEEVPGES |
| Ga0307313_100108083 | 3300028715 | Soil | MTVNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEETE |
| Ga0307313_100108901 | 3300028715 | Soil | PMTRLDRVATLEEAKAQFQKSWDAWKAWVKLEEGP |
| Ga0307298_101310171 | 3300028717 | Soil | MTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVPGES |
| Ga0307307_101853911 | 3300028718 | Soil | FWSLTVNGPMTRSDRVATLEETKAQFQKSWDSWKAWAKLEEVPGES |
| Ga0307307_103005892 | 3300028718 | Soil | MTVNGPMTRSNRVATLEEAKAQFQKTWDAWKAWAKLERH |
| Ga0307301_102129291 | 3300028719 | Soil | LTVNGPMTRADRVATLEEAKAKFQKSWDAWKAWVKLEEGP |
| Ga0307317_102108541 | 3300028720 | Soil | MPVNGPMTRSDRVATLEEAKAHFQKSWDAWKAWAKLEE |
| Ga0307315_100448313 | 3300028721 | Soil | FWSFALHGPMTRSDRAATLEEAKAQFQKSWDAWKAWAKLEEAP |
| Ga0307297_100299431 | 3300028754 | Soil | GPMARSGRVTTLEDTKAQFQKSWDAWKAWAKLEEVPGES |
| Ga0307316_100439651 | 3300028755 | Soil | WSLTVNGPMTRADRVPTLEEAKAQFQKSWDAWKAWAKLEEAP |
| Ga0307282_100446131 | 3300028784 | Soil | VNGPMTRSDRVATLEEAKAQFQKNWDAWKAWAKLEEVTGES |
| Ga0307282_101091131 | 3300028784 | Soil | MTVNGPVTRADRVATLEEAKAQFQKSWDAWKAWAKLEEVP |
| Ga0307282_104453121 | 3300028784 | Soil | MTVNGPMTRSGRVATLEEAKAQFQKSWDVWTAWAKLEETD |
| Ga0307323_101205711 | 3300028787 | Soil | LRWFWSMTITGPMTRADRVATLEEAKAQFQKSWDTWKAWAKLEEVD |
| Ga0307323_101287251 | 3300028787 | Soil | SMTINGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVD |
| Ga0307323_103749881 | 3300028787 | Soil | MEKIGKRSDRVPSLEEAKAQLKAAWDRWKAWAELAE |
| Ga0307294_103795222 | 3300028810 | Soil | LHGPMTRSDRAATLEEAKAQFQKSWDEWKAWAKMEETE |
| Ga0307292_104429201 | 3300028811 | Soil | MTRSDRVATLEEAKGQFQKSWDAWKAWAKLEEVPAES |
| Ga0307302_100932691 | 3300028814 | Soil | PMTHSDRVATLEEAKAQFPKTWDAWKAWAKLEEAP |
| Ga0307302_102160221 | 3300028814 | Soil | MNANGPMTRSDRVATLEEAKAQLQASWDAWKAWAMLEEVP |
| Ga0307296_103686012 | 3300028819 | Soil | WSFAVQGPMTTRADKVATLEEAKAQFQKSWDAWKAWVKLEEVP |
| Ga0307310_105570271 | 3300028824 | Soil | FWSLTVNGPMTRSDRVATLEEAKAQFQKNWDAWKAWAKLEEVTGES |
| Ga0307312_107841681 | 3300028828 | Soil | MTVNGPMTRSNRVATLEEAKAQFQKTWDAWKAWAKLEEVP |
| Ga0307286_102877091 | 3300028876 | Soil | MARSDKVATLEEAKAQFETAWRQWLAWAELQELPLNKS |
| Ga0307286_103461931 | 3300028876 | Soil | MTVNGPMTRSGRVATLEEVRAQLRKSWDAWKAWANLEEID |
| Ga0307278_100957411 | 3300028878 | Soil | MTVNSPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEETE |
| Ga0307278_101972171 | 3300028878 | Soil | MTVNPPMTRSGRVATLEEAKAHFQKSWDAWKAWAKLEEVP |
| Ga0307300_100668093 | 3300028880 | Soil | FWSLTVNGPMTRADRVWRPWRRRRPQFQKSWDAWKAWAKLEEVP |
| Ga0307300_103606761 | 3300028880 | Soil | LTVNGPMTRSDKVATLEEAKAQFQNSWDAWKAGAGLREVP |
| Ga0307277_103202771 | 3300028881 | Soil | TVNGPMTRSDRVATLEDAKAQFQKSWDAWKVWAKLEEVD |
| Ga0307277_104290931 | 3300028881 | Soil | QRSCTRADRVATLEEAKAQFQKSWDAWKAWAKLEEVP |
| Ga0307308_102687971 | 3300028884 | Soil | LRWFWSMTVNPPMTRSGRVATLEEAKAHFQKSWDAWKAWAKLEEAP |
| Ga0307308_103750081 | 3300028884 | Soil | NGPMTRSDRVATLEETKAQFQKSWDSWKAWAKLEEVPGES |
| Ga0308203_10908251 | 3300030829 | Soil | MNANGPMTRSGRVASLEEAKAQFQKSWDAWKAWAK |
| Ga0308202_11135831 | 3300030902 | Soil | RWFWSMNANGPMTRSDRVATLEEAKARFQKSWDAWKAWAKLEEVP |
| Ga0308202_11631411 | 3300030902 | Soil | VNGSMRGSRGDLEEAKAQLQKSWDAWKAWTMLEEVP |
| Ga0308206_10926982 | 3300030903 | Soil | WFWSFAVQGPMTRADKVATLEEAKAQFQKSWDAWKAWAKLEEVPCES |
| Ga0308189_105241921 | 3300031058 | Soil | MAVNGPMTRSDRVATLEEAKAQFQKSWDPWKAWAKLEEVA |
| Ga0308204_101682301 | 3300031092 | Soil | DRLRWFWSLTVTGPMTRSDRVATLEEAKADAWKAWAKLKETE |
| Ga0308204_103201902 | 3300031092 | Soil | WFWSFTLHGPMTRSDRVATLEEAKVQFQKSWNAWKAWAKLEEVA |
| Ga0308199_10088323 | 3300031094 | Soil | MTRSDRMATLEEAKAQFQKNWDAWKAWAKLEVVPCVR |
| Ga0308181_10734171 | 3300031099 | Soil | NGPMTRADRVATLEDAKAQFQKSWDAWKAWAKLEEVPGES |
| Ga0307498_100228391 | 3300031170 | Soil | FWSLTVNPMARSDRVATLEEAKAQLKKSWDAWKAWAKLKETV |
| Ga0170824_1279332242 | 3300031231 | Forest Soil | VNGSMTRPDRVATLEETKAEFQKSWDAWKAWAKLEEAP |
| Ga0310904_104095263 | 3300031854 | Soil | VNGPMTRSDRVATLEEAKAQFQKSWDAWKAWAKLEEVP |
| Ga0310890_112821521 | 3300032075 | Soil | VVPFALTVNGPITRVATLDEAKAQFQKSWDAWKAWAKLEES |
| Ga0247830_104019942 | 3300033551 | Soil | MTVNGPMTRSNRVASLEEAKAQFQKSWDERETWAKLEEVE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |