NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012502

Metagenome / Metatranscriptome Family F012502

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012502
Family Type Metagenome / Metatranscriptome
Number of Sequences 280
Average Sequence Length 40 residues
Representative Sequence KDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG
Number of Associated Samples 228
Number of Associated Scaffolds 280

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.57 %
% of genes from short scaffolds (< 2000 bps) 89.29 %
Associated GOLD sequencing projects 217
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(10.714 % of family members)
Environment Ontology (ENVO) Unclassified
(20.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.929 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.94%    β-sheet: 0.00%    Coil/Unstructured: 88.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 280 Family Scaffolds
PF00334NDK 36.79
PF01361Tautomerase 28.57
PF00549Ligase_CoA 4.64
PF06649DUF1161 3.57
PF08442ATP-grasp_2 2.50
PF02629CoA_binding 2.14
PF13649Methyltransf_25 1.07
PF00326Peptidase_S9 1.07
PF03551PadR 0.71
PF02922CBM_48 0.71
PF13302Acetyltransf_3 0.71
PF01609DDE_Tnp_1 0.71
PF14534DUF4440 0.71
PF13662Toprim_4 0.36
PF02635DrsE 0.36
PF02567PhzC-PhzF 0.36
PF00583Acetyltransf_1 0.36
PF01042Ribonuc_L-PSP 0.36
PF02055Glyco_hydro_30 0.36
PF00903Glyoxalase 0.36
PF00892EamA 0.36
PF02885Glycos_trans_3N 0.36
PF04434SWIM 0.36
PF01346FKBP_N 0.36
PF03473MOSC 0.36
PF03992ABM 0.36
PF11455MazE-like 0.36
PF00076RRM_1 0.36
PF08241Methyltransf_11 0.36
PF07883Cupin_2 0.36
PF12867DinB_2 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 280 Family Scaffolds
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 36.79
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 28.57
COG0045Succinyl-CoA synthetase, beta subunitEnergy production and conversion [C] 7.14
COG0458Carbamoylphosphate synthase large subunitAmino acid transport and metabolism [E] 5.00
COG0074Succinyl-CoA synthetase, alpha subunitEnergy production and conversion [C] 4.64
COG0026Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)Nucleotide transport and metabolism [F] 2.50
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 2.50
COG1042Acyl-CoA synthetase (NDP forming)Energy production and conversion [C] 2.50
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.71
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.71
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.71
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.71
COG3293TransposaseMobilome: prophages, transposons [X] 0.71
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.71
COG5421TransposaseMobilome: prophages, transposons [X] 0.71
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.71
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.71
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.36
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.36
COG0545FKBP-type peptidyl-prolyl cis-trans isomerasePosttranslational modification, protein turnover, chaperones [O] 0.36
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.36
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.36
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 0.36
COG5520O-Glycosyl hydrolaseCell wall/membrane/envelope biogenesis [M] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.50 %
UnclassifiedrootN/A12.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01C8NF6All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300000567|JGI12270J11330_10012197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5643Open in IMG/M
3300000789|JGI1027J11758_12735644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter523Open in IMG/M
3300000789|JGI1027J11758_12904545All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300000955|JGI1027J12803_102244865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis536Open in IMG/M
3300001305|C688J14111_10210120All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Edwardsbacteria606Open in IMG/M
3300002245|JGIcombinedJ26739_100823176All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300003324|soilH2_10119987All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300004082|Ga0062384_100652962All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter719Open in IMG/M
3300004092|Ga0062389_104486853All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300004121|Ga0058882_1416737All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300005167|Ga0066672_10313568All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300005332|Ga0066388_107774499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter537Open in IMG/M
3300005364|Ga0070673_101941859All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005437|Ga0070710_10003164All Organisms → cellular organisms → Bacteria7800Open in IMG/M
3300005467|Ga0070706_101561616All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300005540|Ga0066697_10686285All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter561Open in IMG/M
3300005541|Ga0070733_10037771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3012Open in IMG/M
3300005541|Ga0070733_10076420All Organisms → cellular organisms → Bacteria2115Open in IMG/M
3300005549|Ga0070704_101096768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter723Open in IMG/M
3300005555|Ga0066692_10666842All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300005559|Ga0066700_10097671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1919Open in IMG/M
3300005561|Ga0066699_10556653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter822Open in IMG/M
3300005578|Ga0068854_100015244All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5088Open in IMG/M
3300005607|Ga0070740_10358131All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005610|Ga0070763_10967715Not Available509Open in IMG/M
3300005614|Ga0068856_101030110Not Available841Open in IMG/M
3300005650|Ga0075038_10583356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae527Open in IMG/M
3300005841|Ga0068863_100792799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter945Open in IMG/M
3300005876|Ga0075300_1041554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter644Open in IMG/M
3300006047|Ga0075024_100396135All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300006050|Ga0075028_100385087All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006050|Ga0075028_100976407All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300006052|Ga0075029_101021440All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300006059|Ga0075017_100071747All Organisms → cellular organisms → Bacteria → Acidobacteria2366Open in IMG/M
3300006059|Ga0075017_100254227All Organisms → cellular organisms → Bacteria1286Open in IMG/M
3300006059|Ga0075017_101055599All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300006059|Ga0075017_101311967All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300006059|Ga0075017_101340600All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006102|Ga0075015_100863067All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006162|Ga0075030_100585422All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300006172|Ga0075018_10118972All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300006175|Ga0070712_101154593Not Available673Open in IMG/M
3300006176|Ga0070765_100419114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1252Open in IMG/M
3300006354|Ga0075021_10006222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6330Open in IMG/M
3300006796|Ga0066665_10362084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1186Open in IMG/M
3300006797|Ga0066659_10839768Not Available763Open in IMG/M
3300006797|Ga0066659_11487618All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006800|Ga0066660_11111215All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300006854|Ga0075425_100764433All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300006871|Ga0075434_101299813All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300006904|Ga0075424_102472594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui544Open in IMG/M
3300006954|Ga0079219_11120576All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300007265|Ga0099794_10462479All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300007982|Ga0102924_1002597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae19557Open in IMG/M
3300007982|Ga0102924_1133748All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300007982|Ga0102924_1261119All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300009012|Ga0066710_103492903All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300009012|Ga0066710_103796005All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009029|Ga0066793_10218399Not Available1108Open in IMG/M
3300009090|Ga0099827_10668869All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300009090|Ga0099827_11735618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300009137|Ga0066709_103027208All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300009156|Ga0111538_13177290All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300009174|Ga0105241_10109156All Organisms → cellular organisms → Bacteria2213Open in IMG/M
3300009520|Ga0116214_1242729All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300009520|Ga0116214_1246740Not Available678Open in IMG/M
3300009521|Ga0116222_1027495All Organisms → cellular organisms → Bacteria2535Open in IMG/M
3300009522|Ga0116218_1081328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1476Open in IMG/M
3300009525|Ga0116220_10421829All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300009552|Ga0116138_1013929All Organisms → cellular organisms → Bacteria2610Open in IMG/M
3300009617|Ga0116123_1080221Not Available887Open in IMG/M
3300009631|Ga0116115_1094034All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300009643|Ga0116110_1307490All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300009683|Ga0116224_10393979All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300009700|Ga0116217_10640177All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300010048|Ga0126373_12632396Not Available561Open in IMG/M
3300010336|Ga0134071_10097161All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300010341|Ga0074045_10173990All Organisms → cellular organisms → Bacteria1452Open in IMG/M
3300010359|Ga0126376_11038462Not Available823Open in IMG/M
3300010360|Ga0126372_13204638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300010361|Ga0126378_10641767All Organisms → cellular organisms → Bacteria1175Open in IMG/M
3300010366|Ga0126379_11154501All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300010371|Ga0134125_11178920Not Available837Open in IMG/M
3300010379|Ga0136449_100863174Not Available1482Open in IMG/M
3300010379|Ga0136449_102848796All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300010398|Ga0126383_10347492All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300010398|Ga0126383_11876317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300011088|Ga0138576_1166511All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300011269|Ga0137392_10789328All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300011271|Ga0137393_11300211All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300011271|Ga0137393_11377233Not Available594Open in IMG/M
3300012096|Ga0137389_10873089All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300012198|Ga0137364_11110987All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012201|Ga0137365_11153514All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012205|Ga0137362_10914861All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300012206|Ga0137380_10918287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300012212|Ga0150985_118475313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300012354|Ga0137366_10267240All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300012361|Ga0137360_11538603All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300012362|Ga0137361_10283656All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300012362|Ga0137361_11866863Not Available518Open in IMG/M
3300012510|Ga0157316_1034922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter628Open in IMG/M
3300012917|Ga0137395_10896327All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300012917|Ga0137395_11310274All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012923|Ga0137359_10223103All Organisms → cellular organisms → Bacteria → Acidobacteria1683Open in IMG/M
3300012924|Ga0137413_10519981All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300012924|Ga0137413_10748890All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300012925|Ga0137419_11681533All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300012929|Ga0137404_11276127All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300012930|Ga0137407_10187618All Organisms → cellular organisms → Bacteria1848Open in IMG/M
3300012930|Ga0137407_11935311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter562Open in IMG/M
3300012944|Ga0137410_11328536All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300012971|Ga0126369_13612113Not Available507Open in IMG/M
3300012971|Ga0126369_13683033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300012989|Ga0164305_10356583All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300012989|Ga0164305_10568796All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300014150|Ga0134081_10042286Not Available1346Open in IMG/M
3300014151|Ga0181539_1117937All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300014159|Ga0181530_10516861All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300014162|Ga0181538_10023048All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4283Open in IMG/M
3300014169|Ga0181531_10012005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4969Open in IMG/M
3300014169|Ga0181531_10158576All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300014502|Ga0182021_10432893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1563Open in IMG/M
3300014655|Ga0181516_10634149All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300014657|Ga0181522_10050050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2348Open in IMG/M
3300014657|Ga0181522_10247959All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300014969|Ga0157376_11125526All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300015241|Ga0137418_10566073All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300016750|Ga0181505_10325937All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300017925|Ga0187856_1348210All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300017930|Ga0187825_10376784All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300017940|Ga0187853_10264533All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300017943|Ga0187819_10199618All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300017943|Ga0187819_10345414All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300017948|Ga0187847_10272007All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300017955|Ga0187817_11039365All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300017955|Ga0187817_11131899All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300017972|Ga0187781_11361229All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300017975|Ga0187782_10355747All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300017975|Ga0187782_10553912All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300017975|Ga0187782_10877575All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M
3300018003|Ga0187876_1271174All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300018006|Ga0187804_10102386All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300018009|Ga0187884_10431134Not Available530Open in IMG/M
3300018022|Ga0187864_10138874All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300018024|Ga0187881_10429218All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300018025|Ga0187885_10539100All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018027|Ga0184605_10240504All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300018037|Ga0187883_10404448All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300018042|Ga0187871_10122295All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella1485Open in IMG/M
3300018042|Ga0187871_10522943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis657Open in IMG/M
3300018043|Ga0187887_10077435All Organisms → cellular organisms → Bacteria2015Open in IMG/M
3300018062|Ga0187784_10143791All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1948Open in IMG/M
3300018062|Ga0187784_10385299All Organisms → cellular organisms → Bacteria → Proteobacteria1134Open in IMG/M
3300018085|Ga0187772_10307612All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300018088|Ga0187771_10134452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2021Open in IMG/M
3300018088|Ga0187771_10372441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1202Open in IMG/M
3300018088|Ga0187771_11917429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300018090|Ga0187770_10211988All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300018090|Ga0187770_10241044Not Available1400Open in IMG/M
3300018468|Ga0066662_10087167All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2159Open in IMG/M
3300018482|Ga0066669_10336725All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300019082|Ga0187852_1278228All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300019264|Ga0187796_1484791All Organisms → cellular organisms → Bacteria → Proteobacteria801Open in IMG/M
3300019278|Ga0187800_1053129All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300019877|Ga0193722_1045137All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300019887|Ga0193729_1045580Not Available1799Open in IMG/M
3300019999|Ga0193718_1043575All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300020579|Ga0210407_10703426All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300020581|Ga0210399_11209062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300020583|Ga0210401_10995931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis697Open in IMG/M
3300021168|Ga0210406_11061380All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300021170|Ga0210400_10825998All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300021402|Ga0210385_10195785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1467Open in IMG/M
3300021403|Ga0210397_10785509All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300021404|Ga0210389_11320721Not Available552Open in IMG/M
3300021405|Ga0210387_10247012All Organisms → cellular organisms → Bacteria → Acidobacteria1560Open in IMG/M
3300021406|Ga0210386_10134758All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2054Open in IMG/M
3300021433|Ga0210391_10145124All Organisms → cellular organisms → Bacteria1869Open in IMG/M
3300021433|Ga0210391_10854048All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300021478|Ga0210402_10527476All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300021478|Ga0210402_11173173All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300021479|Ga0210410_10336887All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300021479|Ga0210410_11053788All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300021479|Ga0210410_11617139All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300022509|Ga0242649_1079281All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300022523|Ga0242663_1052103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300022533|Ga0242662_10209472All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300022557|Ga0212123_10842737All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300022724|Ga0242665_10213431Not Available642Open in IMG/M
3300022734|Ga0224571_109910All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300025134|Ga0207416_1011838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5353Open in IMG/M
3300025134|Ga0207416_1112745All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300025500|Ga0208686_1123193Not Available536Open in IMG/M
3300025612|Ga0208691_1017600All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300025910|Ga0207684_10917488All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300025910|Ga0207684_11097740All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300025927|Ga0207687_10337090All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1225Open in IMG/M
3300025934|Ga0207686_11735877All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300025960|Ga0207651_10895253All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300026023|Ga0207677_11498579All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300026035|Ga0207703_11507632All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300026304|Ga0209240_1080285All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300026309|Ga0209055_1236500All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300026374|Ga0257146_1081463All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300026499|Ga0257181_1067219All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300026508|Ga0257161_1115716All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300026532|Ga0209160_1273533All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300026551|Ga0209648_10821285All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300026557|Ga0179587_10649038All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300027168|Ga0208239_1028337Not Available549Open in IMG/M
3300027605|Ga0209329_1022517All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300027645|Ga0209117_1189564All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300027745|Ga0209908_10098441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis720Open in IMG/M
3300027745|Ga0209908_10163701Not Available592Open in IMG/M
3300027795|Ga0209139_10185896All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300027869|Ga0209579_10398135All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300027882|Ga0209590_10584428All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium719Open in IMG/M
3300027884|Ga0209275_10407911All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300027898|Ga0209067_10182948All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300027911|Ga0209698_10771590All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300028536|Ga0137415_10685300All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300028673|Ga0257175_1030924All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300028780|Ga0302225_10072958All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1688Open in IMG/M
3300029882|Ga0311368_10469795All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300029883|Ga0311327_10377733All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300029955|Ga0311342_11024657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300029999|Ga0311339_10071945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4454Open in IMG/M
3300029999|Ga0311339_10186060All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2375Open in IMG/M
3300029999|Ga0311339_11271862Not Available669Open in IMG/M
3300030399|Ga0311353_10732176Not Available850Open in IMG/M
3300030520|Ga0311372_11036949All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300030520|Ga0311372_11186447All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300030580|Ga0311355_10294172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1636Open in IMG/M
3300030677|Ga0302317_10473947Not Available546Open in IMG/M
3300030991|Ga0073994_12030339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300031010|Ga0265771_1008297Not Available726Open in IMG/M
3300031057|Ga0170834_101094209All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300031234|Ga0302325_10190005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3562Open in IMG/M
3300031234|Ga0302325_11676903All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300031234|Ga0302325_11895398Not Available741Open in IMG/M
3300031247|Ga0265340_10551749All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031249|Ga0265339_10568526All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300031258|Ga0302318_10039099All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300031446|Ga0170820_13832470All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031525|Ga0302326_10261403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2808Open in IMG/M
3300031525|Ga0302326_13738402Not Available500Open in IMG/M
3300031564|Ga0318573_10323236All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031679|Ga0318561_10664385All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300031708|Ga0310686_106366149Not Available762Open in IMG/M
3300031715|Ga0307476_10574244All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300031716|Ga0310813_10052117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3017Open in IMG/M
3300031718|Ga0307474_10015426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5538Open in IMG/M
3300031718|Ga0307474_10020470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4818Open in IMG/M
3300031754|Ga0307475_10849000Not Available723Open in IMG/M
3300031823|Ga0307478_10574026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis943Open in IMG/M
3300031823|Ga0307478_11047837All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300031833|Ga0310917_10995231All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis562Open in IMG/M
3300031912|Ga0306921_11243606All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300031947|Ga0310909_10603432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300031996|Ga0308176_12509398All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300032160|Ga0311301_11060463All Organisms → cellular organisms → Bacteria1061Open in IMG/M
3300032160|Ga0311301_12954356Not Available513Open in IMG/M
3300032180|Ga0307471_101336291All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300032180|Ga0307471_101950373All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300032205|Ga0307472_100514123All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1036Open in IMG/M
3300032205|Ga0307472_100836427All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300032205|Ga0307472_101656735All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300032782|Ga0335082_10224693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1769Open in IMG/M
3300032783|Ga0335079_11224037All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300032805|Ga0335078_11893810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter644Open in IMG/M
3300032828|Ga0335080_10014712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8318Open in IMG/M
3300032898|Ga0335072_11195904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300033158|Ga0335077_12002798All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300033805|Ga0314864_0001835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3938Open in IMG/M
3300033808|Ga0314867_070249Not Available815Open in IMG/M
3300034163|Ga0370515_0184412All Organisms → cellular organisms → Bacteria891Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.71%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.36%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.36%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.64%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.29%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.21%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.14%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.14%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.14%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.50%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.79%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.79%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.43%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.07%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.07%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.71%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.71%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.36%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.36%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.36%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.36%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.36%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.36%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.36%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.36%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.36%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.36%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.36%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.36%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.36%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005876Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011088Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019264Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022509Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022734Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3Host-AssociatedOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027168Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031010Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_052174602170459019Switchgrass, Maize And Mischanthus LitterYKDDAALEAHRAAPHFLQYAKKELPKVADRVDGNLFEPLG
JGI12270J11330_1001219773300000567Peatlands SoilYEQYKDAAALEAHRAAPHFLQMAKKDLPKLGDRIEGHLYEPLG*
JGI1027J11758_1273564433300000789SoilALEAHRTSSHFLQYAKKELPKLGERVEGNLYEPLE*
JGI1027J11758_1290454533300000789SoilDAALEAHRVAPHFLQHAKKDLPKVADRVEGHLFEPLG*
JGI1027J12803_10224486513300000955SoilYKDDAALEAHRTSSHFLQYAKKELPKLGERVEGNLYEPLE*
C688J14111_1021012033300001305SoilAALDLHRRTPHFFQYARTELPKVAERVSGELYEPV*
JGIcombinedJ26739_10082317613300002245Forest SoilDDAALEAHRTAPHFLQYARKELPKVAERVEGNLFEPLG*
soilH2_1011998733300003324Sugarcane Root And Bulk SoilYKDDAALEAHRTSPHFLQYAKKDLPKIADRVEGNLYELLG*
Ga0062384_10065296223300004082Bog Forest SoilIYEQYKDDAALEAHRTTPHFMQLAKKELPKIAERTEGHLYEPLG*
Ga0062389_10448685313300004092Bog Forest SoilYEQYKDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG*
Ga0058882_141673713300004121Forest SoilFIYEQYKDDAALEAHRAAAHFLQHAKKELPKIADRTEGHLFEPLG*
Ga0066672_1031356813300005167SoilQYTDDAALEAHRTAPHFLRYAKKDLPKIADRVEGNLYEPLQ*
Ga0066388_10777449913300005332Tropical Forest SoilYEQYKDDAALEAHRTAPHFLQHAKKELPKIADRVEGHLFEPLG*
Ga0070673_10194185923300005364Switchgrass RhizosphereRRFFIYELYKDDAALEAHRTTSHFLQYARKELPKIADRVEGNLYEPLG*
Ga0070710_1000316413300005437Corn, Switchgrass And Miscanthus RhizosphereEQYKDDAALEAHRTTPHFLQYARKDLPKVADRIEGHLYEPLG*
Ga0070706_10156161623300005467Corn, Switchgrass And Miscanthus RhizosphereKDDAALEAHRTSPHFLQMAKKDLPKLGDRTEGHLFEPLG*
Ga0066697_1068628533300005540SoilYKDDSALEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG*
Ga0070733_1003777113300005541Surface SoilQYKDDAALEAHRNASHFLQFARKDLPKIADRVEGHLFEPLG*
Ga0070733_1007642073300005541Surface SoilLEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG*
Ga0070732_1104411423300005542Surface SoilDAALQAHRNSPHFLKYAKEELPRIADRVEGELYEPM*
Ga0070704_10109676813300005549Corn, Switchgrass And Miscanthus RhizosphereEQYKDDAALEAHRAAPHFLQYAKKELPKFGDRVEGHLYEPLG*
Ga0066692_1066684213300005555SoilKDDAALEAHRSAPHFLQYARKDLPKIADRVEGHLLEPLA*
Ga0066700_1009767153300005559SoilAALEAHRATAHFLQYARKELPRVADRVEGVVYEPLG*
Ga0066699_1055665323300005561SoilDDAALEAHRSAPHFLQFAKKDLPKIADRVEGNLFEPLG*
Ga0068854_10001524463300005578Corn RhizosphereDDAGLGGHRAAPHFLQYAKKDLPKIADRVEGHLLEPLA*
Ga0070740_1035813113300005607Surface SoilQYQDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG*
Ga0070763_1096771513300005610SoilAALEAHRAAPHFLQYARKDLPKVADRVEGHLYEALE*
Ga0068856_10103011013300005614Corn RhizosphereKDDAALEAHRAAPHFLQYAKKDLPKIADRVEGNLFEPLG*
Ga0075038_1058335623300005650Permafrost SoilKDEAALEAHRTTPHFLQYARKELTKVADRVEGNLYEPLE*
Ga0068863_10079279933300005841Switchgrass RhizosphereKDDAALEAHRAAPHFIQFAKKELPKLADRVEGHLYEPLG*
Ga0075300_104155433300005876Rice Paddy SoilIYEQYKDDAALEAHRTATHFLQHAKKDLPKIADRVEGHLFDPLG*
Ga0075024_10039613533300006047WatershedsYKDDAALEAHRAAPHFLQYAKKELPKLADRVEGHLYEPLS*
Ga0075028_10038508713300006050WatershedsYKDDAALEAHRSATHFLQFAKKDLPKLADRVEGHLYEPLG*
Ga0075028_10097640713300006050WatershedsYKDDGALEAHRAAPHFLQHARKELPKFAERTEGHLYEPLG*
Ga0075029_10102144023300006052WatershedsYKDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG*
Ga0075017_10007174763300006059WatershedsDDTALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG*
Ga0075017_10025422713300006059WatershedsEQYKDDAALEAHRTSPHFLQLAKKELPKLGDRTEGHLFEPLG*
Ga0075017_10105559913300006059WatershedsYKDDAALEAHRAAPHFLQHAKKELPRVADRIEGHLFEPLG*
Ga0075017_10131196723300006059WatershedsQYKDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG*
Ga0075017_10134060023300006059WatershedsQYKDDAALEAHRAAPHFLQFAKKELPRVADRVEGQVYEALG*
Ga0075015_10086306713300006102WatershedsQYKDDAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG*
Ga0075030_10058542213300006162WatershedsEQYKDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG*
Ga0075018_1011897243300006172WatershedsYKDDAALEAHRAAPHFLQFAKKELPKIADRVEGQLYEPLG*
Ga0070712_10115459323300006175Corn, Switchgrass And Miscanthus RhizosphereLEAHRAAPHFLQHARKDLPKIADRVEGHLFVPLG*
Ga0070765_10041911433300006176SoilAALEAHRAAPHFLQYARKDLPKVADRVEGHLYEALG*
Ga0075021_10006222103300006354WatershedsYKDDAALEAHKSAPHFLEYAKKSLPKIADRIEGQLYSPLD*
Ga0066665_1036208413300006796SoilDAALEAHRSAPHFLQYARKDLPKIADRVEGHLLEPLAQPM*
Ga0066659_1083976823300006797SoilLEAHRAASHFLQYAKKDLPKIADRVEGNLFEPLG*
Ga0066659_1148761813300006797SoilQYKDDSALEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG*
Ga0066660_1111121523300006800SoilEQYKDEAALEAHRAASHFLQYAKKDLPKIADRVEGNLFEPLG*
Ga0075425_10076443313300006854Populus RhizosphereAALEAHRAAPHFLQYARKELPKIADRLEGHLFEPLGDA*
Ga0075434_10129981323300006871Populus RhizosphereLEAHRAAPHFLQYARKELPKIADRLEGHLFEPLGDA*
Ga0075424_10247259413300006904Populus RhizosphereFKDDAALEAHRATPHFLKYGKKELPRVADRVDGQLYDALD*
Ga0079219_1112057623300006954Agricultural SoilYEQYKDDAALEAHRTTAHFLQYAKKDLPKVADRLEGHLFEPLG*
Ga0099794_1046247933300007265Vadose Zone SoilEQYKDDAALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG*
Ga0102924_1002597233300007982Iron-Sulfur Acid SpringYEQYKDDAALEAHRAAPHFLQFAKKELPKIADRVDGQLYEPLG*
Ga0102924_113374843300007982Iron-Sulfur Acid SpringYEQYKDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG*
Ga0102924_126111913300007982Iron-Sulfur Acid SpringQYKDDAALEAHRTAPHFLQHAKKDLPKIADRVEGNLFEPLG*
Ga0066710_10349290313300009012Grasslands SoilYKDDAAFEAHRTAPHFLQYAKKDLPKIADRVEGNLYEPIE
Ga0066710_10379600513300009012Grasslands SoilQYKDDSALEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG
Ga0066793_1021839943300009029Prmafrost SoilLEAHRTAPHFLQLAKKDLPKLGDRIEAHLFEPLG*
Ga0099830_1128863433300009088Vadose Zone SoilDEAALEAHRNSPHFLKHAKEELPRIAERVEGEPYEPI*
Ga0099827_1066886913300009090Vadose Zone SoilEQYQDDSAIEAHRSASHFLQYAKKDLPKIADRTEGNLYEPLG*
Ga0099827_1173561813300009090Vadose Zone SoilYKDDAALEAHRTAPHFLQYARKDLPKVAERVEGHLYEALV*
Ga0066709_10302720823300009137Grasslands SoilFFIYEQYKDEAALEAHRAASYFLQYAKKDLPKIADRVEGNLFEPLG*
Ga0111538_1317729013300009156Populus RhizosphereDDAALEAHRTSSHFLQYAKKELPKLGERIEGNLYEPLG*
Ga0105241_1010915623300009174Corn RhizosphereYKDDAALEAHRTTAHFLQYAKKDLPKVADRLEGHLFEPLG*
Ga0116214_124272913300009520Peatlands SoilDAALEAHRAAPHFLQFGKKDLPKIADRTEGHLFEPLG*
Ga0116214_124674033300009520Peatlands SoilIYEQYKDDAALEAHRAAPHFLQHAKKELPRIADRVESQLYEPLG*
Ga0116222_102749563300009521Peatlands SoilDAALEAHRAAPHFLQYAKKDLPKVADRVEGHLFEPLG*
Ga0116218_108132833300009522Peatlands SoilYKDDAALEAHRAAPHFLQFGKKDLPKIADRTEGHLFEPLG*
Ga0116220_1042182913300009525Peatlands SoilAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG*
Ga0116138_101392963300009552PeatlandIEAHRTAPHFLQFAKKDLPKVADRIEGHLFEPLG*
Ga0116123_108022133300009617PeatlandYKDAAALEAHRTAPHFLQFAKKDLPKVAARIEGHLFEPLG*
Ga0116115_109403413300009631PeatlandDDAAIEAHRTAPHFLQFAKKDLPKVADRIEGHLFEPLG*
Ga0116110_130749013300009643PeatlandAALEAHRSSPHFLQLAKKELPKLGDRTEGHLFEPLG*
Ga0116224_1039397913300009683Peatlands SoilLEAHRTSPHFLQMAKKDLIKVADRTEGHLFEPLG*
Ga0116217_1064017723300009700Peatlands SoilYEQYKDAAALEAHRAAPHFLQMAKKDLPKLGDRIEGHLYEPLGKL*
Ga0126373_1263239613300010048Tropical Forest SoilLEAHRAAPHFLQYAKKELPKLADRVDGQLYEPLA*
Ga0134071_1009716143300010336Grasslands SoilAALEAHRAAPHFLQYARKGLPKVAERVEGHLLVPIEDAQSK*
Ga0074045_1017399013300010341Bog Forest SoilYKDDAALEAHRATPHFLQHAKKELPKIADRTEGHLFEPLG*
Ga0126376_1103846213300010359Tropical Forest SoilDAALEAHRNAPHFLQYAKKDLPKVADRVEGHLLEPLVP*
Ga0126372_1320463813300010360Tropical Forest SoilKDDAALEAHRAAPHFLQFAKKELTKVADRVEGNLFEPLG*
Ga0126378_1064176713300010361Tropical Forest SoilYKDDAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG*
Ga0126379_1115450113300010366Tropical Forest SoilYKDDAALEAHRAAPHFLQHAKKELPKIADRVEGHLFEPLG*
Ga0134125_1117892013300010371Terrestrial SoilQYKDDAALESHRGTPHFLQHAKKELPKVADRVDGQLYEPLG*
Ga0136449_10086317443300010379Peatlands SoilFIYEQYKDDAALEAHRTAAHFLQYARKDLLKVADRVEGHLFEPIG*
Ga0136449_10284879633300010379Peatlands SoilYEQYKDAAALEAHRVAAHFLQFARKDLPKIADRVEGHLYEPLG*
Ga0126383_1034749233300010398Tropical Forest SoilDAALEAHRAAPHFLQHAKKELPKIADRVEGHLFEPLG*
Ga0126383_1187631713300010398Tropical Forest SoilKDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG*
Ga0138576_116651113300011088Peatlands SoilKDDAALEAHRTSPHFLQYARKELPKVADRVEGHLYEAMG*
Ga0137392_1078932813300011269Vadose Zone SoilKDDAALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG*
Ga0137393_1130021133300011271Vadose Zone SoilIYEQYQDDAALEAHRTASHFLQLAKKDLPKIADRVEGHLFEPLG*
Ga0137393_1137723323300011271Vadose Zone SoilIYEQYKDDAALEAHRSTSHFLQYARKELPKVADRVEGNLYEALG*
Ga0137389_1087308913300012096Vadose Zone SoilALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG*
Ga0137364_1111098733300012198Vadose Zone SoilDDAALEAHRTAPHFLQYAKKDLPKIADRVEGSLYDPLQ*
Ga0137365_1115351433300012201Vadose Zone SoilAALEAHRTAPHFLQYAKKDLPKIADRVEGSLYDPLQ*
Ga0137362_1091486133300012205Vadose Zone SoilDAALEAHRTAPHFLQWAKKDLPKIADRVEGHLFEPLG*
Ga0137380_1091828713300012206Vadose Zone SoilKDDAALEAHRNAPHFLQYAKKELPKMADRVEGQLYEPLG*
Ga0150985_11847531323300012212Avena Fatua RhizosphereSSDLAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLA*
Ga0137366_1026724013300012354Vadose Zone SoilLEAHRAAPHFLQHAKKDLPKVADRIEGHLYEPLG*
Ga0137360_1153860313300012361Vadose Zone SoilKDDAALEAHRTAPHFLQLAKKDLPKIADRVEGHLFEPLG*
Ga0137361_1028365613300012362Vadose Zone SoilDAALEAHRTAPHFLQYARKELPKVAERVEGNLFEPLG*
Ga0137361_1186686313300012362Vadose Zone SoilLEAHRSAPHFLQYAKKELPKIADRVEGQLYEPLG*
Ga0157316_103492213300012510Arabidopsis RhizosphereIYEQYKDDAGLEGHRAAPHFLQYAKKDLPKIADRVEGHLLEPLA*
Ga0137395_1089632713300012917Vadose Zone SoilKDDAALEAHRAAPHFLQFAKKDLPKVADRTEGHLFEPLG*
Ga0137395_1131027423300012917Vadose Zone SoilYEQYKDDAALEAHRNAPHFLQYAKKELPKMADRVEGQLYEPLG*
Ga0137359_1022310313300012923Vadose Zone SoilDDAAIEAHRAAPHFLQYVRKDLPKMADRTEGNLYEPLE*
Ga0137413_1051998113300012924Vadose Zone SoilQYKDDAALEAHRAAPHFLQFAKKDLPKVADRTEGHLFEPLG*
Ga0137413_1074889033300012924Vadose Zone SoilEQYKDDAALEAHRAAPHFLQFAKKDLPKVADRTEGHLFEPLG*
Ga0137419_1168153323300012925Vadose Zone SoilAALEAHRAAPHFLQFAKKDLPKVADRTEGHLFEPLG*
Ga0137404_1127612733300012929Vadose Zone SoilFIYEQYKDDAGLEAHRAATHFLQFAKKDLPKVADRVEGHLYEPLG*
Ga0137407_1018761843300012930Vadose Zone SoilIYEQYKDDAGLEAHRAAPHFLQFARKQLPKIAERVEGNLFEPLG*
Ga0137407_1193531113300012930Vadose Zone SoilALEAHRASPHFLQYAKKELPKLGERVEGNLYAPIGD*
Ga0137410_1132853623300012944Vadose Zone SoilEQYKDDAGLEAHRAAPHFLQFARKELPKIAERVEGNLFEPLG*
Ga0126369_1361211323300012971Tropical Forest SoilAALEQHRNAAHFLQYAKKDLPKVADRVEGHLLEPLV*
Ga0126369_1368303323300012971Tropical Forest SoilQYKDDAALEAHRAAPHFLQHAKKELPKIADRVEGHLFEPLG*
Ga0164305_1035658343300012989SoilAALEAHRAAPHFLQYAKKELPKLGDRVEGHLYEPLG*
Ga0164305_1056879613300012989SoilDDAALEAHRAAPHFIQFAKKELPKLADRVEGHLYEPLS*
Ga0134081_1004228643300014150Grasslands SoilLEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG*
Ga0181539_111793713300014151BogVYEQYKDDAALEAHRASAHFLQLAKKELPKLGDRTEGHLFEPLG*
Ga0181530_1051686133300014159BogAALEAHRAAPHFLQFGKKDLPKIADRTEGHLFEPLG*
Ga0181538_1002304873300014162BogYKDDAAIEAHRAAPHFLQMAKKDLPKIADRVEGHLFEPLG*
Ga0181531_1001200573300014169BogDDAALEAHRTLPHFLQFAKKDLPKIADRTEGHLFEPLG*
Ga0181531_1015857643300014169BogLEAHRAAPHFLQYAKKELPKLGERIEGQLYEPLG*
Ga0182021_1043289313300014502FenYEQYKDDAAIEAHRAAPHFLQFAKKDLPKVADRIEGHLFEPIG*
Ga0181516_1063414933300014655BogDAALEAHRASPHFMQYAKKELPKVAERVEGNLYEPLG*
Ga0181522_1005005013300014657BogYEQYKDDAALEAHRAAPHFLQYARKDLPKVADRVEGHLYEPLG*
Ga0181522_1024795913300014657BogYKDDAALEAHRAAPHFLQHARKDLPKVADRVEGHLFEPLG*
Ga0157376_1112552623300014969Miscanthus RhizosphereQYKDDAALEAHRAAPHFLQYARKELPKIADRLEGHLFEPLGDA*
Ga0137418_1056607313300015241Vadose Zone SoilKDDAALEAHRTASHFLQYARKDLPKIADRIEGHLFEPLG*
Ga0181505_1032593723300016750PeatlandEQYQDDAALEAHRAAPHFLQLAKKDLPKIADRTEGHLFEPLG
Ga0187856_134821023300017925PeatlandYEQYKDDAAIEAHRTAPHFLQMAKKDLPKIADRIEGHLFEPLG
Ga0187825_1037678433300017930Freshwater SedimentDDAALEAHRATPHFLQYAKKELPKLGDRVEGNLFEPLG
Ga0187853_1026453333300017940PeatlandAALEAHRAAPHFLQMAKKDLPKIADRTEGHLFEPLG
Ga0187819_1019961843300017943Freshwater SedimentQYKDDAALEAHRAAPHFLQYVKKELPKLGDRIEGQLYEPLG
Ga0187819_1034541413300017943Freshwater SedimentDDAALEAHRTTPHFLQMAKKDLVKVADRTEGHLFEPLG
Ga0187847_1027200713300017948PeatlandQYKDDAALEAHRATPHFLQHAKKELPKIADRTEGHLFEPLG
Ga0187817_1103936513300017955Freshwater SedimentIYEQYKDDAAIEAHRSAPHFLQLAKKDLPKIADRTEGHLFEPLG
Ga0187817_1113189913300017955Freshwater SedimentALEAHRNAQHFLQFARKDLPKIADRVEGHLFEPLG
Ga0187781_1136122923300017972Tropical PeatlandALEAHRAAPHFLQMAKKDLPKIADRTEGHLFVPLG
Ga0187782_1035574713300017975Tropical PeatlandEQYKDDAALEAHRSAPHFLRYAKKELPKLGDRIEGQLYEPLG
Ga0187782_1055391213300017975Tropical PeatlandAALEAHRTTPHFLQYARKDLPKIADRVEGHLYEALG
Ga0187782_1087757523300017975Tropical PeatlandDAALEAHRAAPYFLQFARKDLPKVADRVEGQLFEPLG
Ga0187876_127117423300018003PeatlandEQYQDDAALEAHRASPHFLQLAKKDLPKIADRTEGHLFEPLG
Ga0187804_1010238613300018006Freshwater SedimentKDDAALEAHRAAPHFLQFGKKDLPKIADRTEGHLFEPLG
Ga0187884_1043113423300018009PeatlandDDAALEAHRTSPHFLLHARKELPKVADRVEGHLYEALG
Ga0187864_1013887413300018022PeatlandALEAHRAAPHFLQLAKKDLPKIADRTEGHLFEPLG
Ga0187881_1042921833300018024PeatlandDDAALEAHRNAPHFLQYARKDLPRIAERVEGHLFEPLG
Ga0187885_1053910013300018025PeatlandEQYKDDAALEAHRAAPHFLQHAKKDLPKVADRVEGHLFEPLG
Ga0184605_1024050443300018027Groundwater SedimentEQYKDDAALEAHRATPHFLQYARKELPRIADRVEGVVYEPLG
Ga0187883_1040444813300018037PeatlandKDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG
Ga0187871_1012229513300018042PeatlandEQYKDDAALEAHRAAPHFLQMGKKDLPKIADRTEGHLFEPLG
Ga0187871_1052294323300018042PeatlandEQYQDDAALEAHRASPHFLQMAKKDLPKLGDRTEGHLFEPLG
Ga0187887_1007743553300018043PeatlandDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG
Ga0187784_1014379113300018062Tropical PeatlandDDAALEAHRSAPHFLRYVKKELPKLGDRIEGNLYEALG
Ga0187784_1038529913300018062Tropical PeatlandDAALEAHRAAPHFLQYAKKELPKLGDRIEGHLFTPVG
Ga0187772_1030761213300018085Tropical PeatlandKDDAALEAHRTSPHFLQMAKKDLIKVADRTEGHLFEPLG
Ga0187771_1013445213300018088Tropical PeatlandKDDAALEAHRAAPHFLQYAKKELPKLGERIEGHLFTPVG
Ga0187771_1037244113300018088Tropical PeatlandDDAALEAHRTTPHFLQMAKKDLPKVADRTEGHLFEPIG
Ga0187771_1191742913300018088Tropical PeatlandALEAHRAAPHFLQYAKKELPKLGDRIEGHLFTPVG
Ga0187770_1021198853300018090Tropical PeatlandYEQYKDDAALEAHRTAPHFLQFAKKDLPRVADRVEGHLFEPLG
Ga0187770_1024104413300018090Tropical PeatlandKDDAALEAHRTTHHFLQMAKKELPKIADRTEGHLFEPIG
Ga0066662_1008716713300018468Grasslands SoilKEDAETRSPRPAPHFLQFAKRDLPKIADRVEGNLFELLG
Ga0066669_1033672543300018482Grasslands SoilIYEQYKDDSALEAHRAARHFLQYVKKELPKIADRVEGHLYEPLG
Ga0187852_127822833300019082PeatlandAIEAHRTAPHFLQMAKKDLPKIADRIEGHLFEPLG
Ga0187796_148479113300019264PeatlandIYEQYKDDAALEAHRVAPHFLQFARKDLPKLADRVEGHLFEPLG
Ga0187800_105312913300019278PeatlandKDDAALEAHRTTPHFLQMAKKDLPKVADRTEGHLFEPLG
Ga0193722_104513713300019877SoilQYKDDAALEAHRAAPHFLQYARKELPRIADRVEGVVYEPLG
Ga0193729_104558043300019887SoilYEQYSGDAALEAHRTAPHFLQYAKKELPKVAERVQGDLYVPLDEPV
Ga0193718_104357533300019999SoilQYKDDAALEAHRAAPHFLQLAKKELPKVADRVEGHLFEPLA
Ga0210407_1070342613300020579SoilEQYKDDAALEAHRASPHFLQYVKKELPRVGDRVEGQLYEPLG
Ga0210399_1120906213300020581SoilKDDAALEAHRAAPHFLQFARKELPKVADRVEGNLFEPLG
Ga0210401_1099593133300020583SoilYEQYKDDAALEAHRAAPHFLQYAKKELPRHGDRVEGQLYEPLG
Ga0210406_1106138013300021168SoilYKDDAALEAHRAAPHFLQYVKKELPKIGDRVEGHLYEPLG
Ga0210400_1082599813300021170SoilKDDAALEAHRAAPHFLQYAKKELPKLGERIEGQLYEPLG
Ga0210385_1019578513300021402SoilYEQYKDDAALEAHRAASHFLQYARKDLPKVADRMEGHLYEALG
Ga0210397_1078550933300021403SoilALEAHRAAPHFLQYARKELPKIAERTEGNLYEPLG
Ga0210389_1132072123300021404SoilYEQYKGDAALEAHRAAPHFLQYAKKDLPRVADRIDGQLYEPLA
Ga0210387_1024701213300021405SoilEQYKDDAALEAHRAAPHFLQYAKKELPKFGERIEGHLYEPLA
Ga0210386_1013475813300021406SoilKDDAALEAHRATTHFLQYARKDLPKVADRVEGNLFEPLE
Ga0210391_1014512413300021433SoilALEAHRGAPHFLQHARKDLPKIADRVEGHLFEPLG
Ga0210391_1085404833300021433SoilAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG
Ga0210402_1052747643300021478SoilQYKDDAALEAHRATTHFLQYARKELSKVADRVEGNLYEPLG
Ga0210402_1117317313300021478SoilDAALEGHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG
Ga0210410_1033688743300021479SoilKDDAALEAHRVAPHFLQHAKKDLPKIADRVEGHLFEPLG
Ga0210410_1105378813300021479SoilQYKDDAALEAHRNAPHFLQFARKELPKLADRVEGHLFEPLG
Ga0210410_1161713923300021479SoilEQYKDDAALEAHRGAPHFLQHARKDLPKVADRVEGHLFEPLG
Ga0242649_107928113300022509SoilDDAALEAHRAAPHFLQHAKKDLPKVADRVEGHLYEPLG
Ga0242663_105210323300022523SoilYEQYKDDAALEAHRAAPHFLQHAKKDLPKFADRVEGHLFEPLG
Ga0242662_1020947233300022533SoilAALEAHRASPHFLLHARKELPKVADRVEGHLYEALG
Ga0212123_1084273713300022557Iron-Sulfur Acid SpringYVQYKDDAALESHRATTHFLQYARKELPKVADRVEGNLFEPLG
Ga0242665_1021343133300022724SoilALEAHRAAPHFLQYAKKELPKFGERIEGHLYEPLG
Ga0224571_10991033300022734RhizosphereKDDTALEAHRNAPHFLQYARKDLPRIAERVEGHLFEPLG
Ga0207416_101183873300025134Iron-Sulfur Acid SpringYEQYKDDAALEAHRAAPHFLQFAKKELPKIADRVDGQLYEPLG
Ga0207416_111274533300025134Iron-Sulfur Acid SpringKDDAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG
Ga0208686_112319323300025500PeatlandEQYKDDASLEAHRNAPHFLQYARKDLPRIADRVEGHLFEPLG
Ga0208691_101760053300025612PeatlandQYKDDAALEAHRAAPHFLQHAKKDLPKIADRVEGHLFEPLG
Ga0207684_1091748823300025910Corn, Switchgrass And Miscanthus RhizosphereKDDAALEAHRTSPHFLQMAKKDLPKLGDRTEGHLFEPLG
Ga0207684_1109774033300025910Corn, Switchgrass And Miscanthus RhizosphereDAALEAHRTSPHFLQMAKKDLPKLGDRTEGHLFEPLG
Ga0207687_1033709043300025927Miscanthus RhizosphereEQYKDDAGLEAHRAAPHFLQYAKKELPKIADRVEGHLYEPIS
Ga0207686_1173587713300025934Miscanthus RhizosphereYEQYKDDAALEAHRAAPHFLQYAKKELPKIGDRVEGHLYEPLG
Ga0207651_1089525313300025960Switchgrass RhizosphereYEQYKDDAALEAHRASAHFLQYAKKELPKLGERVEGNLYSPVE
Ga0207677_1149857933300026023Miscanthus RhizosphereDDAALEAHRSAPHFLQHAKKDLPKIAERVEGQLFDLLG
Ga0207703_1150763233300026035Switchgrass RhizosphereYEQYKDDAALEAHRTSSHFLQYAKKELPKLGERIEGNLYEPLG
Ga0209240_108028543300026304Grasslands SoilDDAALEAHRTAPHFLQYARKDLPRIADRVEGHLFEPLG
Ga0209055_123650013300026309SoilYKDDAALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG
Ga0257146_108146323300026374SoilFIYEQYKDDAALEAHRAAPYFLQFVRKELPKVADRVEGNLFEPLG
Ga0257181_106721933300026499SoilQYKDDAALEAHRTAPHFLQLAKKDLPKIADRIEGHLYEPLG
Ga0257161_111571613300026508SoilYKDDAALEAHRAAAHFLQHAKKELPRVADRVEGHLFEPLG
Ga0209160_127353333300026532SoilEQYKDDSALEAHRAAPHFLQYVKKQLPKVADRVEGHLYEPLG
Ga0209648_1082128513300026551Grasslands SoilAALEAHRTAPHFLQYARKELPKVAERVEGNLFEPLG
Ga0179587_1064903833300026557Vadose Zone SoilYEQYKDDAALEAHRTSPHFLQLAKKDLPKIGDRTEGHLFEPLG
Ga0208239_102833723300027168Forest SoilQYKDDASLEAHRAAPHFLQYARKDLPKVADRVEGHLYEALG
Ga0209329_102251743300027605Forest SoilDAALEAHRTSPHFLQFAKKDLPKIGDRTEGHLFEPLG
Ga0209117_118956413300027645Forest SoilYKDDAALEAHRNTPHFLQYARKDLPKIADRVEGHLYDPLG
Ga0209908_1009844133300027745Thawing PermafrostMCIRDRYKDDAALESHRAAPHFLQFGKKELPKIAERTEGHLFEPLG
Ga0209908_1016370123300027745Thawing PermafrostMCIRDRYKDDAALEAHRCAPHFLQHARKDLPKIADRVEGHLFEPLG
Ga0209139_1018589623300027795Bog Forest SoilVGRLREAHRAAPHFLQYAKKELPRIADRTEGQLYEPLG
Ga0209579_1039813513300027869Surface SoilALEAHRAAPHFLQYAKKELPKVGDRVEGHLYAPLD
Ga0209590_1058442833300027882Vadose Zone SoilEQYQDDSAIEAHRSASHFLQYAKKDLPKIADRTEGNLYEPLG
Ga0209275_1040791133300027884SoilAALEAHRTSAHFLQHARKDLPKVADRVEGHLYEALG
Ga0209067_1018294843300027898WatershedsYKDDAALEAHRAAPHFLQHARKDLPKIADRVEGHLFEPLG
Ga0209698_1077159033300027911WatershedsALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG
Ga0137415_1068530013300028536Vadose Zone SoilQYKDDAALEAHRASSHFLQYAKKELPKLGERVEGNLYAPLG
Ga0257175_103092433300028673SoilEQYQDDAALEAHRAAPHFLQYAKKELPKFGDRVEGHLFAPLD
Ga0302225_1007295833300028780PalsaEQYKDDAALEAHRTTPHFLQYARKDLPRIADRVEGHLYEALA
Ga0311368_1046979513300029882PalsaYKDDTALEAHRASPHFLQMAKKDLPKLGDRTEGHLFEPLG
Ga0311327_1037773333300029883BogEQYKDDAALEAHRNAPHFLQYARKDLPKIADRVEGHLYEPLG
Ga0311342_1102465723300029955BogQYKDDAALEAHRAAPHFLQFGKKELPKIADRTEGHLFEPLG
Ga0311339_1007194573300029999PalsaDDAALEAHRAAPHFLQHARKDLPKFADRVEGHLFEPLG
Ga0311339_1018606013300029999PalsaALEAHRTTPHFLQMAKKDLPKIGERTEGHLFEPLG
Ga0311339_1127186213300029999PalsaKDDAALEAHRTTPHFLQYARKDLPRIADRVEGHLYEALG
Ga0311353_1073217633300030399PalsaKDDAALEAHRTSAHFLQFGKKELPKIADRTEGHLFEPLG
Ga0311372_1103694913300030520PalsaAALEAHRNAAHFLQFAKKDLPKVAERVEGHLFEPLG
Ga0311372_1118644713300030520PalsaYQDDAALEAHRAAPHFLQLAKKDLTKIADRTEGHLFEPLG
Ga0311355_1029417233300030580PalsaDAALEAHRTTPHFLQYARKDLPRIADRVEGHLYEALA
Ga0302317_1047394723300030677PalsaALEAHRSTPHFLQYARKELPKVADRVEGNLFEPLG
Ga0073994_1203033923300030991SoilEQYKDDAALEAHRTAPHFLQYAKKDLPKIADRVEGHLYEPLG
Ga0265771_100829713300031010SoilQYKDDAALEAHRNAPHFLQFARKDLPKIAERVEGHLFEPLG
Ga0170834_10109420913300031057Forest SoilKDDAALEAHRATPHFLQYAKKELPKLGDRVEGNLYEPLG
Ga0302325_1019000553300031234PalsaYEQYNDDAALEAHRAAPHFLQHARKDLPKFADRVEGHLFEPLG
Ga0302325_1167690313300031234PalsaIYEQYNDDAALEAHRAAPHFLQHARKDLPKFADRVEGHLFEPLG
Ga0302325_1189539813300031234PalsaDAALEAHRTTPHFLQMGKKDLPKIADRTEGHLFEPLG
Ga0265340_1055174923300031247RhizosphereDDAAIEAHRAAPHFLQFAKKDLPKVADRIEGHLFEPIG
Ga0265339_1056852613300031249RhizosphereQYQDDAALEAHRTAPHFLQMAKKDLPKIADRTEGHLFEPLG
Ga0302318_1003909913300031258BogEQYKDDAALEAHRSTPHFLQYARKDLPKVADRVEGNLFEPLG
Ga0170820_1383247013300031446Forest SoilYEQYKDDAALEAHRTAPHFLQHARKDLPKIADRVEGHLFEPLG
Ga0302326_1026140313300031525PalsaKDDAALEAHRTTPHFLQMGKKDLPKIADRTEGHLFEPLG
Ga0302326_1373840213300031525PalsaQYNDDAALEAHRAAPHFLQHARKDLPKVADRVEGHLFEPLG
Ga0318573_1032323613300031564SoilDDAGLEAHRAAAHFLQYAKKELPKIADRVEGNLYQPLD
Ga0318561_1066438513300031679SoilYKDDAGLEAHRAAAHFLQYAKKELPKIADRVEGNLYQPLD
Ga0310686_10636614913300031708SoilDDAALEAHRAAPHFLQYARKDLPKVADRVEGHLYEALG
Ga0307476_1057424413300031715Hardwood Forest SoilKDDAALEAHRTAPHFLQMAKKDLPKVAERTEGHLFEPLG
Ga0310813_1005211743300031716SoilDAALEAHRAAPHFLQYAKKELPKVADRVDGNLFEPLG
Ga0307474_1001542693300031718Hardwood Forest SoilALEAHRTASHFLQLAKKDLPKIADRVEGHLFEPLG
Ga0307474_1002047013300031718Hardwood Forest SoilDDAALEAHRTSPHFLQHARKDLLKVADRVEGHLYEALG
Ga0307475_1084900013300031754Hardwood Forest SoilYEQYKDDAALEAHRAAPHFLQHARKDLPKVADRVEGHLFEPLG
Ga0307478_1057402633300031823Hardwood Forest SoilEQYKDDAALEAHRAAPHFLKYARKELPKIADRVEGHLYEPLG
Ga0307478_1104783733300031823Hardwood Forest SoilKDDAALEAHRNAPHFLQYARKDLPKIADRVEGNLYEPLG
Ga0310917_1099523133300031833SoilYKDDAALEAHRAAPHFLRYARKELPKLGDRIEGQLYEPLG
Ga0306921_1124360613300031912SoilDAALEAHRSAPHFLQFARKELPKIADRVEGNLYEPIA
Ga0310909_1060343213300031947SoilKDDAALEAHRTAPHFLQHAKKDLPRIADRVEGHLFEPLG
Ga0308176_1250939813300031996SoilFIYEQYKDDGGLEAHRVAKHFMQYAKKELPRIADRMEGHLYEPLG
Ga0311301_1106046333300032160Peatlands SoilFIYEQYKDDAALEAHRTAAHFLQYARKDLLKVADRVEGHLFEPIG
Ga0311301_1295435613300032160Peatlands SoilAALEAHRAAPHFLQYAKKDLPKIGERVEGHLFEPLG
Ga0307471_10133629113300032180Hardwood Forest SoilYQDDAALEGHRTAPHFLQFAKKDLPKIADRIEGHLYEPLG
Ga0307471_10195037313300032180Hardwood Forest SoilEQYKDDAALEAHRATPHFLQYARKELPRVADRVEGVVYEPLG
Ga0307472_10051412313300032205Hardwood Forest SoilEQYKDDAALEAHRAAPHFLQYAKKELPKIADRVEGNLFEPLG
Ga0307472_10083642723300032205Hardwood Forest SoilAALEAHRAAPHFLQFAKKDLPKVADRVEGNLFEPLG
Ga0307472_10165673513300032205Hardwood Forest SoilELYQDDAALEAHRAAPHFLQYAKKELPRIADRVEGHLYEPLG
Ga0335082_1022469343300032782SoilALEAHRTAPHFLQHAKKDLPKIADRVEGHLFEPLG
Ga0335079_1122403733300032783SoilYKDDAALEAHRAAPHFLQYAKKELPKLGERIDGQLYEPLG
Ga0335078_1189381013300032805SoilELYKDDAALEAHRAAPHFLQYARKDLPKIADRVEGHLYEPLG
Ga0335080_1001471213300032828SoilKDDAGLEAHRATPHFLQYAKKELPKIAERVEGQLYDPLG
Ga0335072_1119590413300032898SoilDDAALEAHRSAPHFLQHARKDLPKVADRVEGHLFEPLG
Ga0335077_1200279833300033158SoilKDDAALEAHRAAPHFLQYAKKELPRHGDRVEGQLYEPLS
Ga0314864_0001835_2_1123300033805PeatlandAALEAHRTAPHFLQMAKKDLPKIADRTEGHLFEPLG
Ga0314867_070249_699_8153300033808PeatlandDDAALEAHRTAPHFLQFARKDLPKVADRVEGHLFEPLG
Ga0370515_0184412_755_8893300034163Untreated Peat SoilIYEQYKDDAALEAHRASPHFMLYAKKELPKVADRIDGNLYDPLG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.