NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012616

Metagenome / Metatranscriptome Family F012616

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012616
Family Type Metagenome / Metatranscriptome
Number of Sequences 279
Average Sequence Length 44 residues
Representative Sequence FGTGFPDWETGSVLAIFLLGVVAVLTIVFSRFLQPRQVAAD
Number of Associated Samples 219
Number of Associated Scaffolds 279

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.73 %
% of genes near scaffold ends (potentially truncated) 97.85 %
% of genes from short scaffolds (< 2000 bps) 93.91 %
Associated GOLD sequencing projects 200
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.566 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(14.695 % of family members)
Environment Ontology (ENVO) Unclassified
(25.448 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.971 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 37.68%    β-sheet: 0.00%    Coil/Unstructured: 62.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 279 Family Scaffolds
PF00528BPD_transp_1 48.39
PF08402TOBE_2 5.38
PF13594Obsolete Pfam Family 0.72
PF01329Pterin_4a 0.72
PF03928HbpS-like 0.72
PF03631Virul_fac_BrkB 0.36
PF02852Pyr_redox_dim 0.36
PF00348polyprenyl_synt 0.36
PF06011TRP 0.36
PF05977MFS_3 0.36
PF07969Amidohydro_3 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 279 Family Scaffolds
COG2154Pterin-4a-carbinolamine dehydrataseCoenzyme transport and metabolism [H] 0.72
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.36
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.36
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.57 %
UnclassifiedrootN/A1.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2067725003|GPWSG_F5G3JLY01EAR1BAll Organisms → cellular organisms → Bacteria512Open in IMG/M
2170459005|F1BAP7Q02H41OYAll Organisms → cellular organisms → Bacteria517Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101327635All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104788025All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300000881|JGI10215J12807_1083974All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300000891|JGI10214J12806_12348152All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300000956|JGI10216J12902_112424588All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300001205|C688J13580_1034554All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300001305|C688J14111_10249483All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300001686|C688J18823_10300995All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300001991|JGI24743J22301_10052623All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300002070|JGI24750J21931_1015701All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300002568|C688J35102_119493317All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300004081|Ga0063454_101967811All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300004153|Ga0063455_101221419All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300004479|Ga0062595_100528360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum896Open in IMG/M
3300004479|Ga0062595_100978300All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005164|Ga0066815_10098910All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300005174|Ga0066680_10505721All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300005177|Ga0066690_10822822All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005178|Ga0066688_10498695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum784Open in IMG/M
3300005178|Ga0066688_10856960All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005178|Ga0066688_10941925All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005179|Ga0066684_10127777All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300005179|Ga0066684_10153809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1461Open in IMG/M
3300005179|Ga0066684_10391985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum932Open in IMG/M
3300005181|Ga0066678_10631419All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300005181|Ga0066678_11100740All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005184|Ga0066671_10817469All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300005332|Ga0066388_100906721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1459Open in IMG/M
3300005332|Ga0066388_102241523All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300005355|Ga0070671_100964623All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300005434|Ga0070709_11162987All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005435|Ga0070714_100403991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1292Open in IMG/M
3300005435|Ga0070714_100691457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum984Open in IMG/M
3300005435|Ga0070714_101116509All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300005435|Ga0070714_102423659All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005436|Ga0070713_100171321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1945Open in IMG/M
3300005436|Ga0070713_101994512All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300005444|Ga0070694_100102533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2026Open in IMG/M
3300005445|Ga0070708_101876901All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300005459|Ga0068867_100523384All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300005467|Ga0070706_100362315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1351Open in IMG/M
3300005471|Ga0070698_100380535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1344Open in IMG/M
3300005471|Ga0070698_100529556All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300005471|Ga0070698_101819017All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005526|Ga0073909_10220493All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300005526|Ga0073909_10450310All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005530|Ga0070679_101220628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum697Open in IMG/M
3300005530|Ga0070679_102025284All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005535|Ga0070684_102283412All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005536|Ga0070697_101179849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300005538|Ga0070731_10326773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum1019Open in IMG/M
3300005540|Ga0066697_10168483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1298Open in IMG/M
3300005549|Ga0070704_101372054All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005549|Ga0070704_101489883All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005552|Ga0066701_10592917All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005553|Ga0066695_10491495All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300005558|Ga0066698_10742781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum642Open in IMG/M
3300005559|Ga0066700_10950913All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300005560|Ga0066670_10977490All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005566|Ga0066693_10196113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum781Open in IMG/M
3300005566|Ga0066693_10314867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300005568|Ga0066703_10769942All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005569|Ga0066705_10002373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7234Open in IMG/M
3300005569|Ga0066705_10490656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum769Open in IMG/M
3300005569|Ga0066705_10565124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum703Open in IMG/M
3300005575|Ga0066702_10508162All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300005587|Ga0066654_10381454All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300005587|Ga0066654_10866838All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005614|Ga0068856_100762494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum987Open in IMG/M
3300005718|Ga0068866_10596414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum745Open in IMG/M
3300005718|Ga0068866_11098555All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005764|Ga0066903_100516728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2031Open in IMG/M
3300005764|Ga0066903_101891149All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300005764|Ga0066903_106068938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum632Open in IMG/M
3300006032|Ga0066696_10069939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2030Open in IMG/M
3300006032|Ga0066696_10748165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum626Open in IMG/M
3300006034|Ga0066656_10414473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum873Open in IMG/M
3300006046|Ga0066652_100989967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum799Open in IMG/M
3300006049|Ga0075417_10183491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum985Open in IMG/M
3300006172|Ga0075018_10663143All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300006173|Ga0070716_101194800All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300006175|Ga0070712_100436090All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300006237|Ga0097621_100804739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum871Open in IMG/M
3300006358|Ga0068871_100571268All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300006576|Ga0074047_11797343All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300006604|Ga0074060_12064302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum910Open in IMG/M
3300006797|Ga0066659_11705040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300006806|Ga0079220_11050011All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300006806|Ga0079220_11929856All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300006845|Ga0075421_100412101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1620Open in IMG/M
3300006852|Ga0075433_10325114All Organisms → cellular organisms → Bacteria1360Open in IMG/M
3300006854|Ga0075425_101066136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium921Open in IMG/M
3300006854|Ga0075425_102975336All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300006903|Ga0075426_11022686All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300006954|Ga0079219_11991814All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009012|Ga0066710_102697566All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300009012|Ga0066710_102699737All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300009012|Ga0066710_104191178All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300009088|Ga0099830_10300226All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300009090|Ga0099827_10675273All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300009090|Ga0099827_11380083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300009093|Ga0105240_10891564All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300009098|Ga0105245_10838840All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300009098|Ga0105245_12901303All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300009101|Ga0105247_10219221All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300009137|Ga0066709_101397561All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300009143|Ga0099792_10818080All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300009162|Ga0075423_11062390All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300009174|Ga0105241_11052243All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300009174|Ga0105241_11060773All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300009176|Ga0105242_11652997All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300009177|Ga0105248_10929003All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300009545|Ga0105237_12355293All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300009551|Ga0105238_12520563All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300010047|Ga0126382_10558712All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300010048|Ga0126373_12366947All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300010301|Ga0134070_10125424All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300010303|Ga0134082_10468031All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300010320|Ga0134109_10248389All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300010323|Ga0134086_10293831All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300010335|Ga0134063_10516278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300010335|Ga0134063_10623944All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300010358|Ga0126370_11574224All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300010361|Ga0126378_11900440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300010364|Ga0134066_10144613All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300010371|Ga0134125_10596372All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300010371|Ga0134125_13060803All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010373|Ga0134128_10594300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1232Open in IMG/M
3300010375|Ga0105239_10801869All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300010376|Ga0126381_101919384All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300010376|Ga0126381_105129437All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300010379|Ga0136449_101775406All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300010396|Ga0134126_11072190All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300010398|Ga0126383_11370848All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300010398|Ga0126383_13455506All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300010880|Ga0126350_10140763All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300010880|Ga0126350_10407459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neoaurum718Open in IMG/M
3300011271|Ga0137393_11191171All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300012008|Ga0120174_1148680All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae550Open in IMG/M
3300012014|Ga0120159_1056960All Organisms → cellular organisms → Bacteria1212Open in IMG/M
3300012019|Ga0120139_1066964All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300012199|Ga0137383_10467483All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300012199|Ga0137383_10850248All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300012202|Ga0137363_11627258All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300012203|Ga0137399_11437624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300012206|Ga0137380_10209280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1767Open in IMG/M
3300012206|Ga0137380_10642159All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300012206|Ga0137380_11094628All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012208|Ga0137376_11578942All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300012211|Ga0137377_10181812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2019Open in IMG/M
3300012211|Ga0137377_11845652All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012354|Ga0137366_10429240All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300012354|Ga0137366_11030178All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300012356|Ga0137371_10862451All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300012362|Ga0137361_10150310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2080Open in IMG/M
3300012582|Ga0137358_10452768All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300012883|Ga0157281_1070116All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300012891|Ga0157305_10204405All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012893|Ga0157284_10344891All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300012897|Ga0157285_10209109All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300012901|Ga0157288_10278300All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300012907|Ga0157283_10423914All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300012927|Ga0137416_11009848All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300012929|Ga0137404_10109342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2242Open in IMG/M
3300012951|Ga0164300_10023076All Organisms → cellular organisms → Bacteria2184Open in IMG/M
3300012955|Ga0164298_10365511All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300012957|Ga0164303_11002849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300012958|Ga0164299_10622483All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300012960|Ga0164301_11256791All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300012971|Ga0126369_10394339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1420Open in IMG/M
3300012986|Ga0164304_10163697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1415Open in IMG/M
3300012986|Ga0164304_10567667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300012989|Ga0164305_10372893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1083Open in IMG/M
3300012989|Ga0164305_10660647All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300012989|Ga0164305_11871880All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300013100|Ga0157373_10099253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2049Open in IMG/M
3300013102|Ga0157371_10173526All Organisms → cellular organisms → Bacteria1541Open in IMG/M
3300013105|Ga0157369_11733315All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300013297|Ga0157378_10261765All Organisms → cellular organisms → Bacteria1660Open in IMG/M
3300013765|Ga0120172_1040257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1246Open in IMG/M
3300013770|Ga0120123_1056035All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300014056|Ga0120125_1131181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300014058|Ga0120149_1176747All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300014324|Ga0075352_1263604All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300014969|Ga0157376_11734109All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300015078|Ga0167660_1026859All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → unclassified Ramlibacter → Ramlibacter sp. Leaf400635Open in IMG/M
3300015358|Ga0134089_10265945All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300015372|Ga0132256_100736033All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300015372|Ga0132256_102573349All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300015373|Ga0132257_102499740All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300015374|Ga0132255_101565842All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300015374|Ga0132255_104557165All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300016294|Ga0182041_11808655All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300016357|Ga0182032_12068509All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300017656|Ga0134112_10400503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300017659|Ga0134083_10434549All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300017944|Ga0187786_10103157All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300017944|Ga0187786_10448396All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300017947|Ga0187785_10772704All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300017959|Ga0187779_10997889All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300017961|Ga0187778_10244048All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300017966|Ga0187776_10243849All Organisms → cellular organisms → Bacteria1147Open in IMG/M
3300018029|Ga0187787_10134391All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300018089|Ga0187774_11007064All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300018431|Ga0066655_11317977All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300018433|Ga0066667_12185696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300018468|Ga0066662_10608449All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300018468|Ga0066662_10700313All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300018482|Ga0066669_10156649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1684Open in IMG/M
3300018482|Ga0066669_11811676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300021363|Ga0193699_10102504All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300022886|Ga0247746_1177281All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300024288|Ga0179589_10560657All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300024323|Ga0247666_1034854All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300025318|Ga0209519_10041479All Organisms → cellular organisms → Bacteria2581Open in IMG/M
3300025906|Ga0207699_10171505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1452Open in IMG/M
3300025909|Ga0207705_11325288All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300025912|Ga0207707_11248177All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300025914|Ga0207671_10281467All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300025915|Ga0207693_10721152All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300025915|Ga0207693_11435173All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300025915|Ga0207693_11462443All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300025916|Ga0207663_11247559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300025921|Ga0207652_10146581All Organisms → cellular organisms → Bacteria2113Open in IMG/M
3300025925|Ga0207650_10319096All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300025927|Ga0207687_10560264All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300025928|Ga0207700_11581086All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300025928|Ga0207700_11959062All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300025929|Ga0207664_11775133All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300025938|Ga0207704_10350750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1149Open in IMG/M
3300025939|Ga0207665_10795242All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300025939|Ga0207665_11132889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300025940|Ga0207691_11330166All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300025949|Ga0207667_10875636All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300025981|Ga0207640_10266828All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300025981|Ga0207640_10378251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1146Open in IMG/M
3300026075|Ga0207708_10519045All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300026121|Ga0207683_10699753All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300026305|Ga0209688_1080105All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300026326|Ga0209801_1044376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2045Open in IMG/M
3300026330|Ga0209473_1201625All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300026552|Ga0209577_10502179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300027857|Ga0209166_10644047All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300027869|Ga0209579_10093585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1592Open in IMG/M
(restricted) 3300027995|Ga0233418_10307352All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300030336|Ga0247826_11363250All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300030511|Ga0268241_10129573All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300031184|Ga0307499_10263706All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031226|Ga0307497_10069092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1296Open in IMG/M
3300031544|Ga0318534_10442030All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300031544|Ga0318534_10460816All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300031640|Ga0318555_10243952All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300031668|Ga0318542_10230086All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300031740|Ga0307468_100448920All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300031744|Ga0306918_11054860All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300031754|Ga0307475_10791805All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300031779|Ga0318566_10062212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1792Open in IMG/M
3300031798|Ga0318523_10591822All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031819|Ga0318568_10711196All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300031831|Ga0318564_10456944All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031896|Ga0318551_10187389All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300031910|Ga0306923_10511605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1357Open in IMG/M
3300031912|Ga0306921_11025484All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300031938|Ga0308175_100170248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2112Open in IMG/M
3300031938|Ga0308175_102883420All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031954|Ga0306926_12357899All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300032008|Ga0318562_10205587All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300032013|Ga0310906_10177261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1272Open in IMG/M
3300032025|Ga0318507_10216492All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300032066|Ga0318514_10607514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300032160|Ga0311301_11736536All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300032180|Ga0307471_101780086All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300032342|Ga0315286_11322448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium699Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.58%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.58%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.23%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.15%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.15%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.51%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.79%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.43%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.08%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.08%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.08%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.08%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.72%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.72%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.72%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.72%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.36%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.36%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.36%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.36%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.36%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2067725003Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001205Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015078Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GPWSG_031976202067725003SoilGTGFPDWRTGSVLALFLLGVVGALTLVFARFLQPRQVAAD
E41_097529002170459005Grass SoilVDLFGAGFPDWETGSVLALFLIGVVAILTAVFSRFLQPQRVATE
INPhiseqgaiiFebDRAFT_10132763523300000364SoilGAGFPDWETGSVLALFLIAVVAVLTVVFSRFLQPRQVATD*
INPhiseqgaiiFebDRAFT_10478802513300000364SoilGNQIVDLFQTGFPDWETGSVLAIFLLGVVALLTVVFSRFLQPSQVAAD*
AP72_2010_repI_A100DRAFT_104280213300000837Forest SoilGYMYGNQIHDLFNGGFPDWQTGATLSLFLIGVIAALTLVCVRFLRLGEARVA*
JGI10215J12807_108397423300000881SoilFPDWETGSVLSIFLLVVVAALTVVFSRFLRTGQVAAR*
JGI10214J12806_1234815213300000891SoilYMYGNQIVDLFGTGFPDWATGSVLAMFLLAVVTVLTLVFSRFLRAGEPASG*
JGI10216J12902_11242458813300000956SoilGASGYMYGNQIVDLFGAGFPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVAAE*
C688J13580_103455423300001205SoilLFGTGFPDWQTGSVLALFLLGVVAVLTIVFSRFLQTREVTAG*
C688J14111_1024948323300001305SoilNQIVDLFGAGFPDWETGSVLALFLIAVVLVLTVVFSRFLQPQQVAAD*
C688J18823_1030099513300001686SoilMYGNQIVDLFGAGFPDWETGSVLALFLIAVVLVLTVVFSRFLQPQQVAAD*
JGI24743J22301_1005262313300001991Corn, Switchgrass And Miscanthus RhizosphereFGAGFPDWRTGSVLALFLLGVVVALTLVFARFLQPRQVATD*
JGI24750J21931_101570133300002070Corn, Switchgrass And Miscanthus RhizosphereGFPDWRTGSVLALFLLGVVVALTLVFARFLQPRQVATD*
C688J35102_11949331713300002568SoilLFGTGFPDWETGSVLAIFLLGVVGVLTIVFARFLQPRQVVADS*
Ga0063454_10196781113300004081SoilGTGFPDWETGSELALFLIVVVAVLTLVFSRFLQPSQVTTD*
Ga0063455_10122141923300004153SoilAGFPDWETGSVLALFLILVVGALTVVFSRFLQPAQVAAD*
Ga0062595_10052836013300004479SoilGGTGGYMYGNQIVDLFETGFPDWETGAALALFLIGVISVLTVVFVRFLRVGEARAA*
Ga0062595_10097830013300004479SoilDLFGAGFPDWETGSVLALFLIGVVVVLTVVFSRFLQPQTVAE*
Ga0066815_1009891013300005164SoilDLFGTGFPDWRTGSVLALFLLGVVGALSLVFARFLQPRQVATD*
Ga0066680_1050572123300005174SoilTGFPDWETGSVLAIFLFGVVTVLTVVFARFLQPRQVTAD*
Ga0066690_1082282213300005177SoilGYMYGNQIVDLFQNGFPDWETGAALALFLIGVISVLTVVFVRFLRVGEAQAA*
Ga0066688_1049869513300005178SoilYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTAIFARFIRAGQTAGS*
Ga0066688_1085696013300005178SoilYGNQIVDLFETGFPDWETGAALALFLIGVITVLTLVFVRFLRVGEARAA*
Ga0066688_1094192513300005178SoilSLVGGASGYMYGNQIVDLFGTGFPDWETGSVLAMFLFAVVTLLSLAFGRFLQPRQVAAG*
Ga0066684_1012777713300005179SoilYMYGNQIVDLFGTGFPDWETGSVLAIFLLGVVAALTLVFARFSQIRDVAAS*
Ga0066684_1015380933300005179SoilGYMYGNQIVDLFGTGFPDWETGSIPALFLIGVVAILTVVFSRFLQPGQVATD*
Ga0066684_1039198523300005179SoilDLFEAGFPDWETGSVLALFLLGVVAILTVVFARFLRAPRLETS*
Ga0066678_1063141913300005181SoilNQIVDLFGTGFPDWEAGSVLALFLLGVVAALAAIFARFIRAGQTAGG*
Ga0066678_1110074013300005181SoilGYMYGNQIVDLFGTGFPDWETGSVLAMFLFAVVTLLSLAFGRFLQPRQVAAG*
Ga0066671_1081746923300005184SoilLFGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG*
Ga0066388_10090672133300005332Tropical Forest SoilQIVDLFGTGFPDWRTGSVLALFLLGVVGALTLVFARFLQPRQVVAD*
Ga0066388_10224152323300005332Tropical Forest SoilTGFPDWETGSVLAIFLLIVVSVLTVVFARFLQPSQVAAD*
Ga0070671_10096462313300005355Switchgrass RhizosphereLFGTGFPDWRTGSVLALFLLGVVGALSLVFARFLQPRQVATD*
Ga0070709_1116298723300005434Corn, Switchgrass And Miscanthus RhizosphereLVGGASGYMYGNQIVDLFGTGFPDWETGSVLALFLLIVVAVLTVFCSRFLQPQKVAAD*
Ga0070714_10040399113300005435Agricultural SoilTGGYMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTALCSRFLQPQRVAAE*
Ga0070714_10069145713300005435Agricultural SoilLFGTGFPDWETGSVLAIFLLGVVGALTIVFARFLQPGEVTVD*
Ga0070714_10111650913300005435Agricultural SoilSLVGGASGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIQQDVPA*
Ga0070714_10242365923300005435Agricultural SoilLFGTGFPDWETGSVLAIFLLCVVAALTVVFSRFLQPKQVATE*
Ga0070713_10017132113300005436Corn, Switchgrass And Miscanthus RhizosphereGTGFPDWQTGSVLALFLLIVVAALTVLFARFLQPGQVSAD*
Ga0070713_10199451213300005436Corn, Switchgrass And Miscanthus RhizosphereYMYGNQIVDLFGTGFPDWESGSVLAIFLLGVVTVLTLVFGRFLRTDR*
Ga0070694_10010253333300005444Corn, Switchgrass And Miscanthus RhizosphereGYMYGNQIVDLFETGFPDWETGAALALFLIGVIAVLTVVFVRFLRVGEARTA*
Ga0070708_10187690123300005445Corn, Switchgrass And Miscanthus RhizosphereGNQIVDLFGTGFPDWETGSVLAIFLFGVVTVLTVVFTRFLQPRRVAAD*
Ga0068867_10052338423300005459Miscanthus RhizosphereVDLFGTGFPDWRQGSVLALFLLAVVALLNAIFSRFLAPQKTVAL*
Ga0070706_10036231513300005467Corn, Switchgrass And Miscanthus RhizosphereFGTGFPDWETGSVLAIFLLGVVTVLTVAFARFLQPRQVVAE*
Ga0070698_10038053533300005471Corn, Switchgrass And Miscanthus RhizosphereTGFPDWETGSVLSMFLLGVVAILTVVFARFLQPGEVTVD*
Ga0070698_10052955633300005471Corn, Switchgrass And Miscanthus RhizosphereFGTGFPDWETGSVLALFLIAVVAVLTVVFSRFLQPQQIATD*
Ga0070698_10181901723300005471Corn, Switchgrass And Miscanthus RhizosphereFGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG*
Ga0073909_1022049313300005526Surface SoilYGNQIVDLFGTGFPDWRQGSVLALFLLAIVAVLAGVFSRFLQPQKLEAL*
Ga0073909_1045031023300005526Surface SoilFGTGFPDWETGSVLALFLIAVVAVLTLTFSRFLQPRQMVAE*
Ga0070679_10122062823300005530Corn RhizosphereNQIADLFSTGFPDWETGSVLALFLLCVVAVLTVVFSRFMRAEATA*
Ga0070679_10202528423300005530Corn RhizosphereMYGNQIVDLFGTGFPDWETGSVLALFLIAVVALLTVAFSRFLQPQQVVAE*
Ga0070684_10228341223300005535Corn RhizosphereITDLFGTGFPDWRTGSVLALFLLAVVALLTAAFSRFLRPAEVHAD*
Ga0070697_10117984913300005536Corn, Switchgrass And Miscanthus RhizosphereTGFPDWTTGSVLALFLLGVVAALTVVFARFLQARQFGSG*
Ga0070731_1032677323300005538Surface SoilEFVTPSIVGGSSGYMYGNQIQQVFNGGFPDWQTGATLSLFLLGVIAALTLVFVRVLRIGEAAGA*
Ga0066697_1016848313300005540SoilGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVFVRFLRTGEAQTA*
Ga0070704_10137205423300005549Corn, Switchgrass And Miscanthus RhizosphereTGFPDWETGSVLALFLLGVVAVLTLVFSRFLTPSQVATE*
Ga0070704_10148988323300005549Corn, Switchgrass And Miscanthus RhizosphereTSGYMYGNQIADLFQTGFPDWETGSVLALFLLGVVTVLTLCFARFTQMREAA*
Ga0066701_1059291713300005552SoilISDLFSTGFPDWQTGSVLALFLLGVVALLTAALTRFLQFRDVATG*
Ga0066695_1049149513300005553SoilFQTGFPDWQTGSVLAIFLLGVVVVLTVVFSRFLQPRQVAAG*
Ga0066698_1074278123300005558SoilSLVGGSSGYMYGNQIHDLFNGGFPDWQTGATLSLFLLGVVAALTLVFVRFLRVGEARAA*
Ga0066700_1095091313300005559SoilDWETGSVLAIFLLGVVAVLTVVFGRFLQPRQVVAD*
Ga0066670_1097749013300005560SoilNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVFVRFLRAGEAQTA*
Ga0066693_1019611323300005566SoilNQIVDLFGTGFPDWETGSVLAIFLLGVVAVLTVAFARFLQPGQVATE*
Ga0066693_1031486723300005566SoilWETGSVLAIFLLGVVAVLSVVFARFLRPRQVAAT*
Ga0066703_1076994213300005568SoilWETGSVLALFLIGVVALLTVLFSRFLQPQRVAAE*
Ga0066705_1000237313300005569SoilSGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFGRFIQTEAPA*
Ga0066705_1049065613300005569SoilNQIVDLFQNGFPDWETGAALALFLIGVISVLTVVFVRFLRVGEAQAA*
Ga0066705_1056512423300005569SoilGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVFVRFLRAGEAQTA*
Ga0066702_1050816213300005575SoilDWETGSVLAIFLLGVVGVLSVVFARFLRPRGVAT*
Ga0066654_1038145413300005587SoilTGFPDWETGSVLAIFLLGVVAILTVVFARFLQPAEVTLD*
Ga0066654_1086683823300005587SoilWETGSVLSLFLLGVVAVLTVVFSRFLRSGQVAAN*
Ga0068856_10076249413300005614Corn RhizosphereGYMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE*
Ga0068866_1059641413300005718Miscanthus RhizosphereLYGNQIVDLFGAGFPDWETGSVLSIFLLVVVAALTVVFSRFLRTGQVAAR*
Ga0068866_1109855523300005718Miscanthus RhizosphereDLFGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG*
Ga0066903_10051672813300005764Tropical Forest SoilGGTGGYMYGNQIVDLFGAGGFPDWETGSVLALFLLAVIATLTVIFVRFLRAGEARIA*
Ga0066903_10189114913300005764Tropical Forest SoilASGYMYGNQIVDLFGSGFPDWETGSILALFLILVVAGLTVLFSRFLQPQQAGAS*
Ga0066903_10606893823300005764Tropical Forest SoilQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVLVRFLRAGEAQTA*
Ga0066903_10670316923300005764Tropical Forest SoilVDLFGTGFPDWRTGSVLALFLLVVVAALTAVFSRFLRLDGAAAR*
Ga0066696_1006993913300006032SoilGFPDWETGSILALFLIGVVAILTVVFSRFLQPGQVATD*
Ga0066696_1074816523300006032SoilQIVDLFGTGFPDWETGSVLALLLLAVIAALTVVFARFVQAREAPT*
Ga0066656_1041447313300006034SoilGGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVFVRFLRTGEAQTA*
Ga0066652_10098996713300006046SoilYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTAIFARFMRAGQTAGS*
Ga0075417_1018349123300006049Populus RhizosphereMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTVVFSRFLRSGQAAVG*
Ga0075018_1066314313300006172WatershedsDWETGSVLAMFLFVVVTVLTIGFARFLQPRQVVAD*
Ga0070716_10119480023300006173Corn, Switchgrass And Miscanthus RhizosphereGFPDWETGSVLAIFLLGIVGALTIVFARFLQPRQVATD*
Ga0070716_10157648713300006173Corn, Switchgrass And Miscanthus RhizosphereGFPDWETGSVLALFLLAVIAALTVLFARFVQAREAPA*
Ga0070712_10043609013300006175Corn, Switchgrass And Miscanthus RhizosphereGYMYGNQIVDLFQTGFPDWETGAVLALFLLAVILALTLVFVRFLRAGEARTA*
Ga0097621_10080473923300006237Miscanthus RhizosphereGNQIVLLFQTGFPDWETGSALALFLIGVITLLTLVFVRFLRVGEAQAT*
Ga0068871_10057126823300006358Miscanthus RhizosphereTSGYMYGNQIADLFSTGFPDWETGSVLALFLLGVVTVLTLFFARFTRVQEAA*
Ga0074047_1179734313300006576SoilGYMYGNQIVDLFGTGFPDWRTGAVLALFLLVVVGLLTIVFSRFLQARQVATD*
Ga0074060_1206430213300006604SoilMYGQQIVTLFQTGFPDWETGSALALFLIGVVAVLTLVFVRFLRVGEARAA*
Ga0066659_1170504023300006797SoilGTGFPDWETGSVLALFLIGVVTVLTVVFSRFLQPQQVIAE*
Ga0079220_1105001123300006806Agricultural SoilNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTALCSRFLQPQRVAAE*
Ga0079220_1192985623300006806Agricultural SoilDLFNTGFPDWETGSVLALFLILVVGALTVVFSRFLQPQQVTAE*
Ga0075421_10041210113300006845Populus RhizosphereGTGFPDWQTGSVLAIFLLLVVAVLTVVFGRFLQPRQVTAD*
Ga0075433_1032511413300006852Populus RhizosphereYMYGNQIADLFSTGFPDWETGSVLALFLLGVVAVLTLVFSRFTQMREAP*
Ga0075425_10106613613300006854Populus RhizosphereWETGSVLAIFLLGVVAALTLLFARFTQTRSVAAS*
Ga0075425_10297533613300006854Populus RhizosphereTGFPDWQTGSVLAIFLLLVVAVLTVVFARFLQPSQVTAD*
Ga0075426_1102268613300006903Populus RhizosphereGGASGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIQQDVPA*
Ga0079219_1199181423300006954Agricultural SoilYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTVVFSRFLRSGQAAVG*
Ga0066710_10269756613300009012Grasslands SoilSRDGNPIVRWLGSGLPAWATSSVLAIFLLGVVAVLTVVFARFLQPRQVAAD
Ga0066710_10269973713300009012Grasslands SoilDWETGSVLAIFLLGVVAALTIVFARFLRPREVAAG
Ga0066710_10419117823300009012Grasslands SoilGFPDWETGSVLAVFLLGVVAVLTAAFARVLQVRQVAGG
Ga0099830_1030022633300009088Vadose Zone SoilSLVGGATGYMYGNQIVDLFGTGFPDWETGAVLAMFLLGVVTVLTVAFSRFLQPRQVAAAD
Ga0099827_1067527323300009090Vadose Zone SoilFGTGFPDWETGSVLAIFLLGVVAVLTIVFSRFLQPRQVAAD*
Ga0099827_1138008323300009090Vadose Zone SoilLFGTGFPDWETGSVLSIFLLGVVATLTVVFARFLQPGDVTVD*
Ga0105240_1089156423300009093Corn RhizosphereVGGTGGYMYGNQIVDLFETGFPDWETGAALALFLIGVIAVLTVVFVRFLRVGEARTA*
Ga0105245_1083884013300009098Miscanthus RhizosphereYMYGNQIADLFQTGFPDWETGSVLALFLLGVVTVLTLCFARFTQLREPA*
Ga0105245_1290130323300009098Miscanthus RhizosphereVDKFGAGFPDWETGSVLALFLIIVVAILTAIFSRFLQPQRVAAE*
Ga0105247_1021922143300009101Switchgrass RhizosphereGFPDWRTGAVLALFLLAVVAGLSAVFSRFLQPQQLEAS*
Ga0066709_10139756113300009137Grasslands SoilGFPDWETGSVLAVFLLAIVAVLTAAFARVLQVRQVAGG*
Ga0099792_1081808013300009143Vadose Zone SoilFPDWETGAVLAMFLLVVVTMLTVVFARFLQPRQVATG*
Ga0075423_1106239013300009162Populus RhizosphereLFETGFPDWETGSVLAIFLLGVVTVLTIAFSRFLQPKQVSSG*
Ga0105241_1105224323300009174Corn RhizosphereGGYMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTTVCSRFLQPQRVAAE*
Ga0105241_1106077323300009174Corn RhizosphereSLVGGASGYMYGNQIVDLFGAGFPDWETGSVLALFLIIVVAILTAIFSRFLQPQRVAAE*
Ga0105242_1165299723300009176Miscanthus RhizosphereGFPDWETGSVLAIFLLGVVTLLTLLFSRFLQFRQAGTG*
Ga0105248_1092900313300009177Switchgrass RhizosphereLFATGFPDWRTGSVLALFLLGVVGALTLVFARFLQPRQVATD*
Ga0105237_1235529313300009545Corn RhizosphereLVGGTSGYMYGNQIADLFQTGFPDWETGSVLALFLLGVVTVLTLCFARFTQLREPA*
Ga0105238_1252056323300009551Corn RhizosphereFGAGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE*
Ga0126382_1055871223300010047Tropical Forest SoilWRTGSVLALFLLGVVVVLTLVFARFLQPRQVATD*
Ga0126373_1236694713300010048Tropical Forest SoilFPDWETGSVLALFLLAVIALLTAVFSRFLQVQQVPDR*
Ga0134070_1012542423300010301Grasslands SoilWRTGSVLAIFLLGVVAILIALFGRFLQVRTVGAD*
Ga0134082_1046803123300010303Grasslands SoilFGTGFPDWETGSVLAIFLLGVVALLTVVFARFLQPGQVAAD*
Ga0134109_1024838923300010320Grasslands SoilFGTGFPDWETGSVLAIFLLGVVGALTVVFARFLQPRQVAAD*
Ga0134086_1029383123300010323Grasslands SoilFPDWETGSVLSLFLLGVVAVLTVVFSRFLRSGQVAAN*
Ga0134063_1051627813300010335Grasslands SoilDLFGTGFPDWETGSVLSIFLLGVVAILTVVFARFLQPGEVTVD*
Ga0134063_1062394413300010335Grasslands SoilQTGFPDWQTGSVLAIFLLGVVVVLTVVFSRFLQPRQVAAG*
Ga0126370_1157422413300010358Tropical Forest SoilGTGFPDWQTGSVLALFLLVVVGLLTVVFARFLQPGQVSAD*
Ga0126378_1190044023300010361Tropical Forest SoilWETGSVLALFLLVVVAALTVVFAQFLQPEQMAAD*
Ga0134066_1014461323300010364Grasslands SoilVGGTSGYMYGNQIVDLFQTGFPDWETGAVLALFLLAVILALTLVFVRFLRVGEARPT*
Ga0134125_1059637213300010371Terrestrial SoilTGFPDWETGSVLAMFLLGVVALLTVAFSRFLQPRRVVTD*
Ga0134125_1306080323300010371Terrestrial SoilGNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTAVCSRFLQPQRVAAE*
Ga0134128_1059430033300010373Terrestrial SoilGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG*
Ga0105239_1080186913300010375Corn RhizosphereAGFPDWETGSVLSIFLLVVVAALTVVFSRFLRTGQVAAR*
Ga0126381_10191938423300010376Tropical Forest SoilGFPDWETGSVLALFLILVVAVLTVVFSRFLQSSQMAAD*
Ga0126381_10512943723300010376Tropical Forest SoilLFETGFPDWETGSVLALFLVGVVAVLTLVFARFLRPRELAAD*
Ga0136449_10177540623300010379Peatlands SoilVDLFGTGFPDWETGSVLAMFLLVVVTVLTVVFSRFLQPRQVATD*
Ga0134126_1107219023300010396Terrestrial SoilGFPDWETGSVLAMFLLGVVALLTVAFSRFLQPRRVVTD*
Ga0126383_1137084813300010398Tropical Forest SoilWQTGSVLALFLLVVVGLLTVVFARFLQPGQVSAD*
Ga0126383_1345550623300010398Tropical Forest SoilYGNQIVDLFGTGFPDWETGSVLALFLLAVIALLTAVFSRFLQVQQVPGR*
Ga0126350_1014076323300010880Boreal Forest SoilGFPDWETGSVLAMFLFGVVTILTVVFARFLQPRQLAAD*
Ga0126350_1040745923300010880Boreal Forest SoilSLVGGTSGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIGRGAAPA*
Ga0137393_1119117113300011271Vadose Zone SoilNQIVDLFGTGFPDWETGSVLAIFLFGVVTVLTVVFSRFLSVRRVTAG*
Ga0120174_114868023300012008PermafrostDWETGSVLSIFLLVVVATLTVVFARFLQPREVRAG*
Ga0120159_105696033300012014PermafrostGYMYGNQIVDLFGAGFPDWETGSVLALFLIGVVAVLTAVFSRSLQPQRVATE*
Ga0120139_106696423300012019PermafrostMYGNQIVDLFGTGFPDWETGSVLALFLLVVVAVLTGVFTRFMRVGQAARS*
Ga0137383_1046748313300012199Vadose Zone SoilQIVDLFGTGFPDWETGSVLAIFLFGIVTVLTVAFTRFLQPRRVAAD*
Ga0137383_1085024813300012199Vadose Zone SoilDLFETGFPDWETGSVLALFLLGVVVLLTVVFARFLQPKHVAAS*
Ga0137363_1162725823300012202Vadose Zone SoilMYGNQIVDLFGTGFPDWETGSVLAIFLFGVVTVLTVAFS
Ga0137399_1143762413300012203Vadose Zone SoilDWETGSVLAIFLLCVVTVLTVAFSRFLQPRRIAAD*
Ga0137380_1020928033300012206Vadose Zone SoilFPDWETGSVLAIFLFGIVTVLTVVFARFLQPRQVTAG*
Ga0137380_1064215913300012206Vadose Zone SoilDWETGSVLAIFLLGVVAVLTVAFSRFLQPRQVAAD*
Ga0137380_1109462823300012206Vadose Zone SoilVDLFGTGFPDWETGSVLAIFLLGVVTVLTVAFSRFLQPRRVAAD*
Ga0137376_1157894223300012208Vadose Zone SoilWEIGSVLAMFLLGVVTVLTVVFSRFLQPRRVATD*
Ga0137377_1018181233300012211Vadose Zone SoilGFPDWETGSVLAIFLLGVVGALTIVFARFLQPGEVTVD*
Ga0137377_1184565223300012211Vadose Zone SoilTSGYMYGNQIVDLFQQGFPDWETGATLALFLIAVISVLTFVFVRFLRLGEARVA*
Ga0137366_1042924013300012354Vadose Zone SoilTGFPDWETGSVLAIFLLGVVAVLTVVFARFLQPKQVVAE*
Ga0137366_1103017813300012354Vadose Zone SoilNQIVDLFGTGFPDWETGSVLALFLIAVVAVLTVVFSRFLQPQQIAAD*
Ga0137371_1086245123300012356Vadose Zone SoilFPDWETGSVLAIFLLGVVAVLTVVFGRFLQPRQVVAE*
Ga0137361_1015031033300012362Vadose Zone SoilFSTGFPDWETGSVLSIFLLGVVAILTVVFARFLQPGEVTVD*
Ga0137358_1045276813300012582Vadose Zone SoilTGFPDWETGSVLALFLLAVIAALTVVFARFIQQEAPA*
Ga0157281_107011623300012883SoilLFGTGFPDWRTGSVLALFLLGVVVALTLVFARFLQPRQVATD*
Ga0157305_1020440513300012891SoilDLFGTGFPDWETGSVLAIFLLLVVAVLTIVFARFLQPSQVTAD*
Ga0157284_1034489113300012893SoilTGFPDWETGSVLAIFLLLVVAVLTIVFARFLQPSQVTAD*
Ga0157285_1020910913300012897SoilTGFPDWRTGSVLALFLLGVVCALTLVFARFLQPRQVVAD*
Ga0157288_1027830023300012901SoilYGNQIVDLFVAGFPDWQTGSVLALFLLGVVAVLTIAFSRFLGAQAAAR*
Ga0157283_1042391423300012907SoilGTGFPDWQTGSVLAIFLLLVVAVLTIVFARFLQPSQVTAD*
Ga0137416_1100984823300012927Vadose Zone SoilFGTGFPDWETGAVLAMFLLGVVTVLTVAFSRFLQPRQVATD*
Ga0137404_1010934233300012929Vadose Zone SoilFPDWETGSVLAIFLFGVVTVLTVVFARFLQPRQVTAG*
Ga0164300_1002307643300012951SoilIVDLFGAGFPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVTAE*
Ga0164298_1036551123300012955SoilGFPDWETGSVLALFLLGVVAVLTLVFSRFLTPSQVATE*
Ga0164303_1100284923300012957SoilDWETGSVLALFLIAVVALLTVVFSRFLQPQQVVAE*
Ga0164299_1062248313300012958SoilQIVDLFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLTPSQVATE*
Ga0164301_1125679123300012960SoilSLVGGTSGYMYGNQIVDLFQTGFPDWETGAVLSLFVLAVILTLTLVFVRFLRVSEARTT*
Ga0126369_1039433913300012971Tropical Forest SoilWETGSVLALFLLGVVAVLTIVFSRFLRSGQVAAN*
Ga0164304_1016369733300012986SoilDWQTGSVLALFLLGVVAVLTIVFSRFLLSREVAAG*
Ga0164304_1056766723300012986SoilSGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTAVFSRFMQVRQVPA*
Ga0164305_1037289333300012989SoilGTGFPDWETGSVLAIFLFGVVTVLTLVFARFLQPRQVTAR*
Ga0164305_1066064723300012989SoilETGFPDWETGSVLALFLLGVVAVLTLVFSRFLTPSQVATE*
Ga0164305_1187188013300012989SoilNQIVDLFQTGFPDWETGAVLSLFVLAVILTLTLVFVRFLRVSEARTT*
Ga0157373_1009925333300013100Corn RhizosphereTGFPDWQTGSVLALFLLIVVAALTVLFARFLQPGQVSAD*
Ga0157371_1017352643300013102Corn RhizosphereYGNQIVDKFGAGFPDGETGSVLALFLIIVVAVLTTVCSRFLQPQRVAAE*
Ga0157369_1173331513300013105Corn RhizosphereGGYMYGNQIVDKFGAGFPDWETGSVLALFLIVVVAVLTALFSRFLQPQRAAAG*
Ga0157378_1026176513300013297Miscanthus RhizosphereNQIADLFGTGFPDWRTGSVLALFLRGVVVALTLVFARFLQPRQVATD*
Ga0120172_104025733300013765PermafrostGAPGYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVTVLTLAFGRFLRTDR*
Ga0120123_105603513300013770PermafrostGYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVTVLTLVFGRFLRTDR*
Ga0120125_113118123300014056PermafrostMYGNQIVDLFGTGFPDWETGSVLALFLIAVVAVLTVAFSRFLQPRQVAAE*
Ga0120149_117674723300014058PermafrostMYGNQITDLFGTGFPDWRTGSVLALFLLVVVGVLTAVFSRFNQVGSVARG*
Ga0075352_126360423300014324Natural And Restored WetlandsYGNQIVDLFGTGFPDWRSGAVLALFLLGVVGLLTIVFSRLLQPSHVATD*
Ga0157376_1173410913300014969Miscanthus RhizosphereQIVDLFGAGSPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVTAE*
Ga0167660_102685933300015078Glacier Forefield SoilPDWETGSVLAIFLFGVVTLLTVVFARFLQPGQVAAD*
Ga0134089_1026594513300015358Grasslands SoilTGFPDWETGSGLAIFLFGVVTVLTVVFTRFLQPRRVAAD*
Ga0132256_10073603313300015372Arabidopsis RhizosphereQIVDLFETGFPDWETGSVLAIFLLGVVVLLTIAFSRFLQPRQVSSG*
Ga0132256_10257334913300015372Arabidopsis RhizosphereVGGASGYMYGNQIVDLFGTGFPDWETGSVLALFLLGVVAVLTIVFSRFLRSGQVAAS*
Ga0132257_10249974023300015373Arabidopsis RhizosphereGRQIVDLFQTGFPDWETGDVPALFLLAVILALTLVFVRFLRAGEARAA*
Ga0132255_10156584213300015374Arabidopsis RhizosphereMYGNQIVDLFGTGFPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVTAE*
Ga0132255_10455716513300015374Arabidopsis RhizosphereGFPDWRTGSVLALFLLGVVAALTLVFARFLQPRQVAAD*
Ga0182041_1180865523300016294SoilFPDWETGSVLALFLLAVIAALTVVFARFIQRPVTP
Ga0182032_1206850913300016357SoilTGFPDWETGSVLAIFLLAVVALLTVVFSRFLQPRQVAQD
Ga0134112_1040050323300017656Grasslands SoilDWRTGSVLAVFLLAVVATLIALFGRFLQPRRLVAD
Ga0134083_1043454923300017659Grasslands SoilVGGPSGYMYGNQISDLFSTGFPDWETGSVLALFLLGVVTVLTAAFSRFMRLGEVASS
Ga0187786_1010315713300017944Tropical PeatlandLFGTGFPDWETGAVLAIFLLLVVTLLTVTFSRFLQPRQVAAD
Ga0187786_1044839613300017944Tropical PeatlandNQIVDLFGTGFPDWETGSVLAMFLLVVVTVLTVVFSRFLQPRQVATD
Ga0187785_1077270413300017947Tropical PeatlandMYGNQIVDLFQTGFPDWETGSVLAIFLLAVVVLLTLVFSRFLQPRQVSAG
Ga0187779_1099788923300017959Tropical PeatlandYMYGNQIVDLFGTGFPDWETGAVLAIFLLLVVTVLTITFSRFLQPRQVAAD
Ga0187778_1024404833300017961Tropical PeatlandYMYGNQIVDLFQTGFPDWETGSVLAIFLLGVVTLLTLVFSRFLQPKQVAAG
Ga0187776_1007521533300017966Tropical PeatlandFPDWQTGSVLALFLLLVVALLTIVFARFLGSRQATAG
Ga0187776_1024384913300017966Tropical PeatlandQIVDLFGTGFPDWETGSVLALFLILVVALLTVVFSRFLQPQRVATD
Ga0187787_1013439113300018029Tropical PeatlandGYMYGNQIVDLFGTGFPDWETGAVLAIFLLLVVTLLTVTFSRFLQPRQVAAD
Ga0187774_1100706413300018089Tropical PeatlandYLYGNQIVDLFGTGFPDWRTGSVLALFLLVVVAGLAAAFSRFLQPQQLEAS
Ga0066655_1131797723300018431Grasslands SoilARLFGTGFPDWETGSVLAIFLFVVVTVLTVVFARFLQPRQVTAG
Ga0066667_1218569623300018433Grasslands SoilFGTGFPDWETGSVLAIFLLGVVAALTIVFARFLQPGQVATD
Ga0066662_1060844923300018468Grasslands SoilYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAILTLVLTLVFVRFLRTGEAQTA
Ga0066662_1070031323300018468Grasslands SoilLVGGTSGYMYGNQIHDLFYAGFPDWETGAVLALFLIGVISALTLVFVRFLRLGDARTI
Ga0066669_1015664913300018482Grasslands SoilGFPDWETGSVLAIFLLGVVTVLTAAFSRFLQGRQVAGT
Ga0066669_1181167623300018482Grasslands SoilIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFGRFIQTEAPA
Ga0193699_1010250433300021363SoilIVDLFVTGFPDWQTGSVLALFLLGVVAVLTIVFSRFLQSREVTAG
Ga0247746_117728113300022886SoilTGFPDWETGSVLAIFLLLVVAVLTIVFARFLQPSQVTAD
Ga0179589_1056065713300024288Vadose Zone SoilDLFGTGFPDWQTGSVLALFLLGVVAVLTIVFSRFLQSREVTAG
Ga0247666_103485413300024323SoilLVGGATGYMYGNQIVDLFGTGFPDWETGSVLALFLIAVVAVLTIAFSRFLQPRQVVAE
Ga0209519_1004147913300025318SoilPAVPGGSAQTGSVLALFLLGVVAVLTAVFARFLQVRQVTTG
Ga0207699_1017150513300025906Corn, Switchgrass And Miscanthus RhizosphereTGFPDWETGSVLAIFLLAVVGALTIVFARFLQPRQVAAD
Ga0207705_1132528823300025909Corn RhizosphereGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE
Ga0207707_1124817723300025912Corn RhizosphereMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAVLTTVCSRFLQPQRVAAE
Ga0207671_1028146713300025914Corn RhizosphereGYMYGNQIVDKFGAGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE
Ga0207693_1072115213300025915Corn, Switchgrass And Miscanthus RhizosphereGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFSRFIQGRDAAPA
Ga0207693_1143517313300025915Corn, Switchgrass And Miscanthus RhizosphereGFPDWETGSVLALFLLAVIAALTAVFSRFIQQEVPA
Ga0207693_1146244323300025915Corn, Switchgrass And Miscanthus RhizosphereMYGNQIVDLFGAGFPDWETGSVLALFLIGVVAVLTVVFSRFLQPQQVAAD
Ga0207663_1124755923300025916Corn, Switchgrass And Miscanthus RhizosphereLFGTGFPDWETGSVLAIFLLGVVGALTIVFARFLQPGEVTVD
Ga0207652_1014658143300025921Corn RhizosphereGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG
Ga0207650_1031909613300025925Switchgrass RhizospherePDWRTGSVLALFLLGVVVALTLVFARFLQPRQVATD
Ga0207687_1056026423300025927Miscanthus RhizosphereYMYGNQIADLFQTGFPDWETGSVLALFLLGVVTVLTLCFARFTQLREPA
Ga0207700_1158108613300025928Corn, Switchgrass And Miscanthus RhizosphereFGTGFPDWQTGSVLALFLLIVVAALTVLFARFLQPGQVSAD
Ga0207700_1195906213300025928Corn, Switchgrass And Miscanthus RhizosphereYGNQIVDLFGTGFPDWETGSVLAIFLLGVVTVLTLVFGRFLRTDR
Ga0207664_1177513323300025929Agricultural SoilLFGTGFPDWETGSVLAIFLLCVVAALTVVFSRFLQPKQVATE
Ga0207704_1035075013300025938Miscanthus RhizosphereFPDWRTGAVLALFLLGVVVTLTLVFARFLQPRQVVAD
Ga0207665_1079524223300025939Corn, Switchgrass And Miscanthus RhizosphereFPDWETGAVLSIFLLAVVGVLSIVFARFLQPRQMAAD
Ga0207665_1113288913300025939Corn, Switchgrass And Miscanthus RhizosphereQIVDLFGTGFPDWETGSVLALFLLAVIAALTVLFARFVQAREAPA
Ga0207691_1133016623300025940Miscanthus RhizosphereADLFGTGFPDWRTGAVLALFLLGVVVALTLVFARFLQPRQVATD
Ga0207667_1087563623300025949Corn RhizosphereQIVDKFGAGFPDWETGSVLALFLIIVVAILTALFSRFLQPQRVAAE
Ga0207640_1026682833300025981Corn RhizosphereDWETGSVLALFLIIVVAVLTTVCSRFLQPQRVAAE
Ga0207640_1037825133300025981Corn RhizosphereDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG
Ga0207708_1051904513300026075Corn, Switchgrass And Miscanthus RhizosphereADLFGTGFPDWRTGSVLALFLLGVVGALSLVFARFLQPRQVATD
Ga0207683_1069975313300026121Miscanthus RhizosphereFPDWETGSVLALFLIGVVVVLTVAFSRFLQPQQVTAE
Ga0209688_108010523300026305SoilPDWETGSVLAIFLLGVVAVLTVVFARFLQPRQVVAD
Ga0209801_104437613300026326SoilPDWETGSVLSIFLLGVVAILTVVFARFLQPGEVTVD
Ga0209473_120162513300026330SoilYGNQIVDLFGTGFPDWETGSVLALFLLGVVAALTAIFARFIRAGQTAGG
Ga0209577_1050217923300026552SoilFPDWETGSVLALFLLAVIAALSVVFARFIQTEVPA
Ga0209166_1064404713300027857Surface SoilMHGNQIVDLFGTGFPDWETGSVLALFLLAVIAALSVVFARFIQTDVPA
Ga0209579_1009358533300027869Surface SoilGYMYGNQIVDLFGTGFPDWETGSVLALFLLVVIAALTAVFSRFLQLRQPAG
(restricted) Ga0233418_1030735213300027995SedimentFGTGFPDWRTGSVLALFLLGVVCALTLVFARFLQPRQVAAD
Ga0247826_1136325023300030336SoilFGTGFPDWQTGSVLALFLLGVVAVLTVVFSRFLQTREVTAG
Ga0268241_1012957313300030511SoilGAGFPDWETGSVLALFLIVVVAALTAVFSRFLQPQQVVAD
Ga0307499_1026370623300031184SoilLFGTGFPDWQTGSVLALFLLGVVALLTIVFSRFLQTREVTAG
Ga0307497_1006909213300031226SoilGFPDWETGSVLAIFLFGVVTVLTVVFARFLQPRQVTAG
Ga0318534_1044203023300031544SoilFPDWETGSVLALFLLGVVVVLTVVFARFLQPRRVAAD
Ga0318534_1046081623300031544SoilVDLFGTGFPDWETGSVLSLFLLGVVAALTVVFSRFMRVR
Ga0318555_1024395213300031640SoilQIVDLFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRDLAAD
Ga0318542_1023008613300031668SoilFGTGFPDWETGAVLAIFLLLVVATLTVVFARFLQPQQVATD
Ga0307468_10044892013300031740Hardwood Forest SoilDLFSTGFPDWRTGSVLALFLLAVVAVLTGAFSRFLGMRQTTS
Ga0306918_1105486013300031744SoilLFQTGFPDWETGSVLAIFLLAVVLVLTVVFSRFLQPKQVATD
Ga0307475_1079180513300031754Hardwood Forest SoilPDWETGSVLALFLLGVVAILTVAFSRFLQPRRVVTD
Ga0318566_1006221233300031779SoilFETGFPDWETGSVLALFLLGVVVVLTVVFARFLQPRRVAAD
Ga0318523_1059182223300031798SoilFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRDLAAD
Ga0318568_1071119613300031819SoilIESLFLGFPDWETGSVLAVFLLGVVAVLTIVFARFLQPRHAATD
Ga0318564_1045694413300031831SoilDWETGSVLALFLLGVVVVLTVVFARFLQPRRVAAD
Ga0318551_1018738933300031896SoilVDLFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRELAAD
Ga0306923_1051160533300031910SoilFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRELAAD
Ga0306921_1102548423300031912SoilLFGTGFPDWETGAVLAIFLLLVVATLTVVFARFLQPQQVATD
Ga0308175_10017024813300031938SoilFPDWETGSVLAIFLLGVVAVLMVVFSRFLQPRQVAAD
Ga0308175_10288342013300031938SoilNTGFPDWETGSVLALFLILVVGVLTVVFSRFLQPQQVTAE
Ga0306926_1235789923300031954SoilGTSGYMYGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIQRPVTP
Ga0318562_1020558713300032008SoilVDLFETGFPDWETGSVLALFLLGVVAVLTLVFSRFLQPRDLAAD
Ga0310906_1017726113300032013SoilGFPDWRTGSVLALFLLGVVGALTLVFARFLQPRQVAAD
Ga0318507_1021649223300032025SoilGNQIVDLFGTGFPDWETGSVLALFLLAVIAALTVVFARFIQRPVTP
Ga0318514_1060751423300032066SoilGFPDWETGSVLAIFLLGVVALLTVVFARFLQPQQVTAD
Ga0311301_1173653613300032160Peatlands SoilVDLFGTGFPDWETGSVLAMFLLVVVTVLTVVFSRFLQPRQVATD
Ga0307471_10178008613300032180Hardwood Forest SoilPDWETGAVLAMFLLAVVTILTVVFARFLQPSQVATD
Ga0315286_1132244813300032342SedimentPDWRTGSVLAIFLLVVVAALTAAFSRFLQVRPVAAN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.