Basic Information | |
---|---|
Family ID | F012740 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 277 |
Average Sequence Length | 42 residues |
Representative Sequence | MTHEEARTIMRRIANDYDRLAKLAEEQLADQERGATGDKT |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 277 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.17 % |
% of genes near scaffold ends (potentially truncated) | 67.87 % |
% of genes from short scaffolds (< 2000 bps) | 94.95 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.264 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.881 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.819 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.675 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 277 Family Scaffolds |
---|---|---|
PF06411 | HdeA | 4.69 |
PF05901 | Excalibur | 2.17 |
PF04392 | ABC_sub_bind | 1.08 |
PF01381 | HTH_3 | 1.08 |
PF01527 | HTH_Tnp_1 | 0.72 |
PF00196 | GerE | 0.36 |
PF00581 | Rhodanese | 0.36 |
PF00816 | Histone_HNS | 0.36 |
PF00486 | Trans_reg_C | 0.36 |
PF00665 | rve | 0.36 |
PF00389 | 2-Hacid_dh | 0.36 |
PF04347 | FliO | 0.36 |
PF02826 | 2-Hacid_dh_C | 0.36 |
PF00211 | Guanylate_cyc | 0.36 |
PF00872 | Transposase_mut | 0.36 |
PF00314 | Thaumatin | 0.36 |
PF13156 | Mrr_cat_2 | 0.36 |
PF13467 | RHH_4 | 0.36 |
PF10108 | DNA_pol_B_exo2 | 0.36 |
PF09851 | SHOCT | 0.36 |
PF01548 | DEDD_Tnp_IS110 | 0.36 |
PF13340 | DUF4096 | 0.36 |
PF08734 | GYD | 0.36 |
PF00216 | Bac_DNA_binding | 0.36 |
PF12833 | HTH_18 | 0.36 |
PF00226 | DnaJ | 0.36 |
COG ID | Name | Functional Category | % Frequency in 277 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.08 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.36 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.36 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.36 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.36 |
COG2916 | DNA-binding protein H-NS | Transcription [K] | 0.36 |
COG3190 | Flagellar biogenesis protein FliO | Cell motility [N] | 0.36 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.36 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.36 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.36 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.36 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 51.26 % |
Unclassified | root | N/A | 48.74 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig229442 | Not Available | 565 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1020273 | Not Available | 1055 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10021130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1784 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10025857 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10104207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10167257 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1019099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1297 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1021255 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1044371 | Not Available | 801 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1090127 | Not Available | 538 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1036255 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300000893|AP72_2010_repI_A001DRAFT_1007369 | Not Available | 2017 | Open in IMG/M |
3300005181|Ga0066678_10433077 | Not Available | 874 | Open in IMG/M |
3300005332|Ga0066388_100080905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3620 | Open in IMG/M |
3300005332|Ga0066388_102032258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1031 | Open in IMG/M |
3300005332|Ga0066388_103613689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300005332|Ga0066388_104293917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 726 | Open in IMG/M |
3300005332|Ga0066388_105108459 | Not Available | 666 | Open in IMG/M |
3300005332|Ga0066388_105138924 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300005332|Ga0066388_105929943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
3300005332|Ga0066388_106162590 | Not Available | 605 | Open in IMG/M |
3300005332|Ga0066388_106222170 | Not Available | 602 | Open in IMG/M |
3300005332|Ga0066388_106606238 | Not Available | 584 | Open in IMG/M |
3300005332|Ga0066388_106998635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300005332|Ga0066388_107242198 | Not Available | 557 | Open in IMG/M |
3300005332|Ga0066388_107243234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 557 | Open in IMG/M |
3300005332|Ga0066388_107420532 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005332|Ga0066388_107921716 | Not Available | 531 | Open in IMG/M |
3300005332|Ga0066388_108118427 | Not Available | 524 | Open in IMG/M |
3300005363|Ga0008090_15895855 | Not Available | 833 | Open in IMG/M |
3300005713|Ga0066905_100227380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1416 | Open in IMG/M |
3300005713|Ga0066905_100236056 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300005713|Ga0066905_101161174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
3300005713|Ga0066905_101231393 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300005713|Ga0066905_101264560 | Not Available | 662 | Open in IMG/M |
3300005713|Ga0066905_101448564 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005713|Ga0066905_101851059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
3300005713|Ga0066905_101924861 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005764|Ga0066903_101341769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1339 | Open in IMG/M |
3300005764|Ga0066903_102100288 | Not Available | 1087 | Open in IMG/M |
3300005764|Ga0066903_102994560 | Not Available | 915 | Open in IMG/M |
3300005764|Ga0066903_103334507 | Not Available | 867 | Open in IMG/M |
3300005764|Ga0066903_103506253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 845 | Open in IMG/M |
3300005764|Ga0066903_103590361 | Not Available | 835 | Open in IMG/M |
3300005764|Ga0066903_103782445 | Not Available | 813 | Open in IMG/M |
3300005764|Ga0066903_103932517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 797 | Open in IMG/M |
3300005764|Ga0066903_104299974 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300005764|Ga0066903_104584562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
3300005764|Ga0066903_104743128 | Not Available | 723 | Open in IMG/M |
3300005764|Ga0066903_104908323 | Not Available | 710 | Open in IMG/M |
3300005764|Ga0066903_104999288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 703 | Open in IMG/M |
3300005764|Ga0066903_105231063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
3300005764|Ga0066903_105245709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
3300005764|Ga0066903_106247169 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300005764|Ga0066903_106341113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
3300005764|Ga0066903_106533891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
3300005764|Ga0066903_106554591 | Not Available | 606 | Open in IMG/M |
3300005764|Ga0066903_106692024 | Not Available | 599 | Open in IMG/M |
3300005764|Ga0066903_106714640 | Not Available | 598 | Open in IMG/M |
3300005764|Ga0066903_106734621 | Not Available | 597 | Open in IMG/M |
3300005764|Ga0066903_106755919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
3300005764|Ga0066903_107651262 | Not Available | 556 | Open in IMG/M |
3300005764|Ga0066903_107874034 | Not Available | 547 | Open in IMG/M |
3300005764|Ga0066903_108178916 | Not Available | 535 | Open in IMG/M |
3300005764|Ga0066903_108637656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
3300009792|Ga0126374_10141535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1443 | Open in IMG/M |
3300009792|Ga0126374_11423232 | Not Available | 565 | Open in IMG/M |
3300010043|Ga0126380_10044282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2358 | Open in IMG/M |
3300010043|Ga0126380_10748347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 792 | Open in IMG/M |
3300010043|Ga0126380_11393373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300010046|Ga0126384_10105063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2092 | Open in IMG/M |
3300010046|Ga0126384_10254998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1420 | Open in IMG/M |
3300010046|Ga0126384_10448138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1101 | Open in IMG/M |
3300010046|Ga0126384_10553783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
3300010046|Ga0126384_10562291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 993 | Open in IMG/M |
3300010046|Ga0126384_11688964 | Not Available | 598 | Open in IMG/M |
3300010046|Ga0126384_11715895 | Not Available | 594 | Open in IMG/M |
3300010046|Ga0126384_12388158 | Not Available | 512 | Open in IMG/M |
3300010046|Ga0126384_12406093 | Not Available | 510 | Open in IMG/M |
3300010047|Ga0126382_10275963 | Not Available | 1247 | Open in IMG/M |
3300010047|Ga0126382_10947963 | Not Available | 749 | Open in IMG/M |
3300010047|Ga0126382_11873873 | Not Available | 566 | Open in IMG/M |
3300010047|Ga0126382_12051336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
3300010048|Ga0126373_10045606 | All Organisms → cellular organisms → Bacteria | 3876 | Open in IMG/M |
3300010048|Ga0126373_11630116 | Not Available | 710 | Open in IMG/M |
3300010048|Ga0126373_12292825 | Not Available | 600 | Open in IMG/M |
3300010329|Ga0134111_10359152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum gryphiswaldense → Magnetospirillum gryphiswaldense MSR-1 | 617 | Open in IMG/M |
3300010358|Ga0126370_11262986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. C9 | 690 | Open in IMG/M |
3300010358|Ga0126370_11455977 | Not Available | 649 | Open in IMG/M |
3300010359|Ga0126376_10243034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1525 | Open in IMG/M |
3300010359|Ga0126376_12282770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
3300010359|Ga0126376_13111750 | Not Available | 513 | Open in IMG/M |
3300010360|Ga0126372_11998621 | Not Available | 626 | Open in IMG/M |
3300010360|Ga0126372_12304358 | Not Available | 588 | Open in IMG/M |
3300010360|Ga0126372_12602306 | Not Available | 557 | Open in IMG/M |
3300010361|Ga0126378_10264249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1817 | Open in IMG/M |
3300010361|Ga0126378_11727498 | Not Available | 711 | Open in IMG/M |
3300010361|Ga0126378_11834498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
3300010361|Ga0126378_12463417 | Not Available | 594 | Open in IMG/M |
3300010362|Ga0126377_11406239 | Not Available | 771 | Open in IMG/M |
3300010362|Ga0126377_11969572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
3300010362|Ga0126377_12574152 | Not Available | 584 | Open in IMG/M |
3300010366|Ga0126379_10056376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3268 | Open in IMG/M |
3300010366|Ga0126379_10787057 | Not Available | 1050 | Open in IMG/M |
3300010366|Ga0126379_11750246 | Not Available | 726 | Open in IMG/M |
3300010376|Ga0126381_100431379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1844 | Open in IMG/M |
3300010376|Ga0126381_102119269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 809 | Open in IMG/M |
3300010376|Ga0126381_103072566 | Not Available | 662 | Open in IMG/M |
3300010398|Ga0126383_10409904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1394 | Open in IMG/M |
3300010398|Ga0126383_10580690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1190 | Open in IMG/M |
3300010398|Ga0126383_10635191 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300010398|Ga0126383_10701186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1091 | Open in IMG/M |
3300010398|Ga0126383_11171245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300010398|Ga0126383_11313982 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 813 | Open in IMG/M |
3300010398|Ga0126383_11625233 | Not Available | 735 | Open in IMG/M |
3300010398|Ga0126383_11632524 | Not Available | 734 | Open in IMG/M |
3300010398|Ga0126383_12305173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300010398|Ga0126383_13127233 | Not Available | 541 | Open in IMG/M |
3300010398|Ga0126383_13219018 | Not Available | 533 | Open in IMG/M |
3300010398|Ga0126383_13480248 | Not Available | 514 | Open in IMG/M |
3300012948|Ga0126375_10663466 | Not Available | 806 | Open in IMG/M |
3300012971|Ga0126369_10405892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1401 | Open in IMG/M |
3300012971|Ga0126369_10718822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1077 | Open in IMG/M |
3300012971|Ga0126369_11068593 | Not Available | 896 | Open in IMG/M |
3300012971|Ga0126369_11828027 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300012971|Ga0126369_11994019 | Not Available | 668 | Open in IMG/M |
3300012971|Ga0126369_12310095 | Not Available | 624 | Open in IMG/M |
3300012971|Ga0126369_12697059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
3300015371|Ga0132258_12178466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1392 | Open in IMG/M |
3300015372|Ga0132256_101714161 | Not Available | 737 | Open in IMG/M |
3300015373|Ga0132257_101130702 | Not Available | 989 | Open in IMG/M |
3300016270|Ga0182036_10064170 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2366 | Open in IMG/M |
3300016294|Ga0182041_10503405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1050 | Open in IMG/M |
3300016294|Ga0182041_11266380 | Not Available | 674 | Open in IMG/M |
3300016319|Ga0182033_11696948 | Not Available | 572 | Open in IMG/M |
3300016319|Ga0182033_12023122 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300016341|Ga0182035_10183526 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
3300016341|Ga0182035_10748711 | Not Available | 854 | Open in IMG/M |
3300016341|Ga0182035_11499523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
3300016357|Ga0182032_11148280 | Not Available | 667 | Open in IMG/M |
3300016357|Ga0182032_11444509 | Not Available | 596 | Open in IMG/M |
3300016371|Ga0182034_10294476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
3300016404|Ga0182037_10044323 | All Organisms → cellular organisms → Bacteria | 2929 | Open in IMG/M |
3300016404|Ga0182037_10743166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
3300016404|Ga0182037_11518411 | Not Available | 594 | Open in IMG/M |
3300016404|Ga0182037_11975633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 523 | Open in IMG/M |
3300016404|Ga0182037_12160884 | Not Available | 501 | Open in IMG/M |
3300016422|Ga0182039_10578476 | Not Available | 979 | Open in IMG/M |
3300016422|Ga0182039_11590839 | Not Available | 596 | Open in IMG/M |
3300016422|Ga0182039_12230275 | Not Available | 505 | Open in IMG/M |
3300016422|Ga0182039_12277982 | Not Available | 500 | Open in IMG/M |
3300016445|Ga0182038_11421864 | Not Available | 622 | Open in IMG/M |
3300016445|Ga0182038_11585541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300021560|Ga0126371_10374346 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1563 | Open in IMG/M |
3300021560|Ga0126371_11368315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 840 | Open in IMG/M |
3300027654|Ga0209799_1073197 | Not Available | 771 | Open in IMG/M |
3300027874|Ga0209465_10102402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1405 | Open in IMG/M |
3300027874|Ga0209465_10125917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
3300027874|Ga0209465_10226913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 933 | Open in IMG/M |
3300027874|Ga0209465_10347782 | Not Available | 742 | Open in IMG/M |
3300031543|Ga0318516_10002803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7342 | Open in IMG/M |
3300031543|Ga0318516_10324652 | Not Available | 889 | Open in IMG/M |
3300031543|Ga0318516_10423518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
3300031545|Ga0318541_10333748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
3300031545|Ga0318541_10414139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
3300031545|Ga0318541_10467387 | Not Available | 705 | Open in IMG/M |
3300031545|Ga0318541_10660315 | Not Available | 584 | Open in IMG/M |
3300031545|Ga0318541_10839938 | Not Available | 512 | Open in IMG/M |
3300031546|Ga0318538_10117750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1385 | Open in IMG/M |
3300031561|Ga0318528_10494438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 657 | Open in IMG/M |
3300031572|Ga0318515_10686051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 542 | Open in IMG/M |
3300031573|Ga0310915_10024934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium rifense | 3675 | Open in IMG/M |
3300031573|Ga0310915_11081713 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300031640|Ga0318555_10650561 | Not Available | 570 | Open in IMG/M |
3300031679|Ga0318561_10805083 | Not Available | 516 | Open in IMG/M |
3300031680|Ga0318574_10013543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3794 | Open in IMG/M |
3300031713|Ga0318496_10379710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
3300031713|Ga0318496_10566425 | Not Available | 628 | Open in IMG/M |
3300031719|Ga0306917_10756952 | Not Available | 762 | Open in IMG/M |
3300031719|Ga0306917_11235052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
3300031719|Ga0306917_11339034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
3300031723|Ga0318493_10336628 | Not Available | 819 | Open in IMG/M |
3300031724|Ga0318500_10651588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
3300031736|Ga0318501_10313259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 839 | Open in IMG/M |
3300031740|Ga0307468_101363030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
3300031744|Ga0306918_10196820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1517 | Open in IMG/M |
3300031744|Ga0306918_11091306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 618 | Open in IMG/M |
3300031747|Ga0318502_10414564 | Not Available | 802 | Open in IMG/M |
3300031747|Ga0318502_10490009 | Not Available | 736 | Open in IMG/M |
3300031747|Ga0318502_11039295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
3300031768|Ga0318509_10454146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 716 | Open in IMG/M |
3300031770|Ga0318521_10204130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1142 | Open in IMG/M |
3300031771|Ga0318546_10700737 | Not Available | 712 | Open in IMG/M |
3300031777|Ga0318543_10370791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
3300031777|Ga0318543_10565402 | Not Available | 510 | Open in IMG/M |
3300031780|Ga0318508_1219477 | Not Available | 545 | Open in IMG/M |
3300031781|Ga0318547_10013300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3862 | Open in IMG/M |
3300031781|Ga0318547_10695950 | Not Available | 632 | Open in IMG/M |
3300031792|Ga0318529_10480427 | Not Available | 578 | Open in IMG/M |
3300031795|Ga0318557_10146251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1067 | Open in IMG/M |
3300031796|Ga0318576_10412159 | Not Available | 638 | Open in IMG/M |
3300031796|Ga0318576_10509911 | Not Available | 567 | Open in IMG/M |
3300031797|Ga0318550_10646195 | Not Available | 507 | Open in IMG/M |
3300031797|Ga0318550_10652845 | Not Available | 505 | Open in IMG/M |
3300031798|Ga0318523_10310076 | Not Available | 787 | Open in IMG/M |
3300031798|Ga0318523_10421818 | Not Available | 662 | Open in IMG/M |
3300031819|Ga0318568_10456554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 796 | Open in IMG/M |
3300031833|Ga0310917_10930830 | Not Available | 584 | Open in IMG/M |
3300031879|Ga0306919_10295988 | Not Available | 1227 | Open in IMG/M |
3300031879|Ga0306919_10421608 | Not Available | 1025 | Open in IMG/M |
3300031879|Ga0306919_10619712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 834 | Open in IMG/M |
3300031879|Ga0306919_10673168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 797 | Open in IMG/M |
3300031890|Ga0306925_10429046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1414 | Open in IMG/M |
3300031890|Ga0306925_10555633 | Not Available | 1217 | Open in IMG/M |
3300031890|Ga0306925_10954900 | Not Available | 877 | Open in IMG/M |
3300031890|Ga0306925_11531681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
3300031890|Ga0306925_12075402 | Not Available | 533 | Open in IMG/M |
3300031894|Ga0318522_10371760 | Not Available | 541 | Open in IMG/M |
3300031897|Ga0318520_10565696 | Not Available | 705 | Open in IMG/M |
3300031910|Ga0306923_10593338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1244 | Open in IMG/M |
3300031910|Ga0306923_11150829 | Not Available | 832 | Open in IMG/M |
3300031910|Ga0306923_11745040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
3300031910|Ga0306923_11941569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
3300031910|Ga0306923_12151028 | Not Available | 561 | Open in IMG/M |
3300031912|Ga0306921_10375002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1662 | Open in IMG/M |
3300031912|Ga0306921_10558647 | Not Available | 1327 | Open in IMG/M |
3300031912|Ga0306921_11632855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
3300031912|Ga0306921_11814399 | Not Available | 655 | Open in IMG/M |
3300031912|Ga0306921_11905407 | Not Available | 636 | Open in IMG/M |
3300031941|Ga0310912_10280755 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300031941|Ga0310912_10631474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
3300031941|Ga0310912_10784708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 736 | Open in IMG/M |
3300031942|Ga0310916_10809692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 788 | Open in IMG/M |
3300031945|Ga0310913_10703101 | Not Available | 715 | Open in IMG/M |
3300031945|Ga0310913_11026288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300031946|Ga0310910_10616050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
3300031946|Ga0310910_11006842 | Not Available | 651 | Open in IMG/M |
3300031947|Ga0310909_10875852 | Not Available | 738 | Open in IMG/M |
3300031947|Ga0310909_11206906 | Not Available | 611 | Open in IMG/M |
3300031947|Ga0310909_11355453 | Not Available | 570 | Open in IMG/M |
3300031954|Ga0306926_10709306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → Defluviicoccus vanus | 1219 | Open in IMG/M |
3300031954|Ga0306926_11412579 | Not Available | 807 | Open in IMG/M |
3300031954|Ga0306926_11745984 | Not Available | 708 | Open in IMG/M |
3300031959|Ga0318530_10091292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1202 | Open in IMG/M |
3300031959|Ga0318530_10143006 | Not Available | 969 | Open in IMG/M |
3300031959|Ga0318530_10291222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 674 | Open in IMG/M |
3300031981|Ga0318531_10565343 | Not Available | 515 | Open in IMG/M |
3300032001|Ga0306922_12018317 | Not Available | 561 | Open in IMG/M |
3300032035|Ga0310911_10165923 | Not Available | 1247 | Open in IMG/M |
3300032035|Ga0310911_10590384 | Not Available | 644 | Open in IMG/M |
3300032035|Ga0310911_10739148 | Not Available | 569 | Open in IMG/M |
3300032039|Ga0318559_10394330 | Not Available | 645 | Open in IMG/M |
3300032039|Ga0318559_10510531 | Not Available | 561 | Open in IMG/M |
3300032041|Ga0318549_10174667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 961 | Open in IMG/M |
3300032043|Ga0318556_10423852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
3300032051|Ga0318532_10211937 | Not Available | 687 | Open in IMG/M |
3300032052|Ga0318506_10392241 | Not Available | 616 | Open in IMG/M |
3300032055|Ga0318575_10313655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
3300032059|Ga0318533_10018333 | All Organisms → cellular organisms → Bacteria | 4371 | Open in IMG/M |
3300032059|Ga0318533_10276370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1215 | Open in IMG/M |
3300032059|Ga0318533_10584259 | Not Available | 820 | Open in IMG/M |
3300032060|Ga0318505_10084735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1416 | Open in IMG/M |
3300032064|Ga0318510_10045088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1541 | Open in IMG/M |
3300032065|Ga0318513_10512529 | Not Available | 587 | Open in IMG/M |
3300032076|Ga0306924_10242401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2070 | Open in IMG/M |
3300032076|Ga0306924_10408286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1554 | Open in IMG/M |
3300032089|Ga0318525_10422259 | Not Available | 683 | Open in IMG/M |
3300032261|Ga0306920_100666263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1535 | Open in IMG/M |
3300032261|Ga0306920_100674848 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300032261|Ga0306920_101226246 | Not Available | 1082 | Open in IMG/M |
3300032261|Ga0306920_101469142 | Not Available | 974 | Open in IMG/M |
3300032261|Ga0306920_103143540 | Not Available | 619 | Open in IMG/M |
3300032261|Ga0306920_103611982 | Not Available | 569 | Open in IMG/M |
3300033289|Ga0310914_10333018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Defluviicoccus → Defluviicoccus vanus | 1371 | Open in IMG/M |
3300033289|Ga0310914_10369558 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300033290|Ga0318519_10223126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
3300033290|Ga0318519_10265736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 23.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 20.22% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.36% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.36% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_06465080 | 2124908045 | Soil | HEEARTIMRRIAMDYDRLAKLAEEQLADQERGAIGDKT |
AF_2010_repII_A01DRAFT_10202732 | 3300000580 | Forest Soil | MTHEESRMIMRRIANDYDRLAKLAEEQLADQEKRATGD* |
AF_2010_repII_A1DRAFT_100211302 | 3300000597 | Forest Soil | MTDEAARTIMRRIANDYDRLAKVAEVQLIDQERGTPGPKT* |
AF_2010_repII_A1DRAFT_100258574 | 3300000597 | Forest Soil | RCTMADRAPAIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
AF_2010_repII_A1DRAFT_101042072 | 3300000597 | Forest Soil | ETRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQEKRATGD* |
AF_2010_repII_A1DRAFT_101672571 | 3300000597 | Forest Soil | TVADQMTHEESRTIMRRIAMDYDRLAKLAEEQLADQEKGAIRPKT* |
AF_2010_repII_A100DRAFT_10190991 | 3300000655 | Forest Soil | TRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
AF_2010_repII_A100DRAFT_10212552 | 3300000655 | Forest Soil | LXXCAEETRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQERGAIGD* |
AF_2010_repII_A100DRAFT_10443712 | 3300000655 | Forest Soil | MTDEEARTIMRRIENDYDRLAKVAEEQLAAQEKRATGD* |
AF_2010_repII_A100DRAFT_10901271 | 3300000655 | Forest Soil | EEARTIMRRIALDYDRLAKLAEEQLADQERGDKT* |
AP72_2010_repI_A100DRAFT_10362552 | 3300000837 | Forest Soil | MTHEESRAIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
AP72_2010_repI_A001DRAFT_10073696 | 3300000893 | Forest Soil | MTHEEARTIMRHIANDYDRLAKLAEALLAAQERGATDD* |
Ga0066678_104330771 | 3300005181 | Soil | ADQMTHEEARTIMRRIANDYDRLAKLAEAQLADQERGANGD* |
Ga0066388_1000809057 | 3300005332 | Tropical Forest Soil | MTHGEARTIIRRIAMDYDRLAKLAEQQLVDQERGIGRET* |
Ga0066388_1020322582 | 3300005332 | Tropical Forest Soil | EEARTVADQMTHEEARTIMRRIANDYDRLAKVAEAQLADQERGRNGD* |
Ga0066388_1036136892 | 3300005332 | Tropical Forest Soil | MTHEESRTIMRRIALDYDRLAKLAEEQLADQERGAIGEPKT* |
Ga0066388_1042939174 | 3300005332 | Tropical Forest Soil | MTHEGARAIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0066388_1051084591 | 3300005332 | Tropical Forest Soil | ETRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGPIGPKT* |
Ga0066388_1051389242 | 3300005332 | Tropical Forest Soil | MNHEEARAIMRRIALDSDRLAKIAEEQLADQERGAIGPKT* |
Ga0066388_1059299431 | 3300005332 | Tropical Forest Soil | IADQMNHEEARATIRRIANDYDRLAKLAEQQLIDQARGTGV* |
Ga0066388_1061625903 | 3300005332 | Tropical Forest Soil | MSPMQSCTVADQMTHEEARTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
Ga0066388_1062221702 | 3300005332 | Tropical Forest Soil | THEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT* |
Ga0066388_1066062381 | 3300005332 | Tropical Forest Soil | AEETRTVADQMTHEESRTIMRRIAMDYDRLAKLADEQLIDQERGATGDKT* |
Ga0066388_1069986351 | 3300005332 | Tropical Forest Soil | MTHEEARTIMRRIADDYDRLAKVAEEQLANRERGAIGDKTERPGPK* |
Ga0066388_1072421981 | 3300005332 | Tropical Forest Soil | ADQMNHEEARATIRRIANDYDRLAKLAEQQLIDQARGTGRR* |
Ga0066388_1072432341 | 3300005332 | Tropical Forest Soil | MADRAPAIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
Ga0066388_1074205322 | 3300005332 | Tropical Forest Soil | LRWAVTQEAARTIMRRIANDYDRLAKVAEEQLADQERGANGD* |
Ga0066388_1079217161 | 3300005332 | Tropical Forest Soil | RAEEARTIADQMTHEESRTIMRRIAMDYDRLAKLAEVQLADQERGAIGPKT* |
Ga0066388_1081184271 | 3300005332 | Tropical Forest Soil | MTHEEARTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
Ga0008090_158958552 | 3300005363 | Tropical Rainforest Soil | RTVADQMTHEEARTIMRRIANDYDHLAKVAEEQLAAQERRAIGDKT* |
Ga0066905_1002273801 | 3300005713 | Tropical Forest Soil | VADQMTHEESRTIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0066905_1002360562 | 3300005713 | Tropical Forest Soil | VQRKLVTHEEAPAIIRRIANDYDRLTKLAEVQLIAQERRGNGD* |
Ga0066905_1011611743 | 3300005713 | Tropical Forest Soil | RTVADQMTHEESRTIMRRIALDYDRLAKLAEEQLADQERGDKT* |
Ga0066905_1012313931 | 3300005713 | Tropical Forest Soil | MTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGPIGPKT* |
Ga0066905_1012645602 | 3300005713 | Tropical Forest Soil | VADQMTHEESRTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
Ga0066905_1014485641 | 3300005713 | Tropical Forest Soil | MTHEGARAIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
Ga0066905_1018510591 | 3300005713 | Tropical Forest Soil | TRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGATGEKT* |
Ga0066905_1019248611 | 3300005713 | Tropical Forest Soil | MTHEEARTIMRRIAMDYDRLAKIAEEQLADQEKGAIGPKT* |
Ga0066903_1013417693 | 3300005764 | Tropical Forest Soil | MTTLTADPNPITAGDQTFHEGARAIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0066903_1021002884 | 3300005764 | Tropical Forest Soil | MTHEQARAIMRRIANDYDRLAKVVEEQLADQEKRATGDKT* |
Ga0066903_1029945603 | 3300005764 | Tropical Forest Soil | MTHEDARTIMQRIANDYDRLAKLAEEQLADPERGATGD* |
Ga0066903_1033345073 | 3300005764 | Tropical Forest Soil | DQMTHEESRTIMRRIALDYDRLAKLAEEQRADQERGDKT* |
Ga0066903_1035062532 | 3300005764 | Tropical Forest Soil | VDGTCGATTVADQMTHEDGRTIMRRIALDYDRLAKLADKQLAAQERGTIGPKT* |
Ga0066903_1035903612 | 3300005764 | Tropical Forest Soil | MTHEEARAIVRRIANDYDRLAKLAEEQLLAQEKGATGD* |
Ga0066903_1037824453 | 3300005764 | Tropical Forest Soil | AEEARTVADQMTHEEARMVMRRIANDYDRLVKLAEKQLADEERRATGD* |
Ga0066903_1039325172 | 3300005764 | Tropical Forest Soil | MTHEAVRTIMRRIALDYDRLAKVAEEQLADQEKRATGD* |
Ga0066903_1042999742 | 3300005764 | Tropical Forest Soil | MTHEEARTIVRRIANDDDRLAKLAELADQERGATGDKT* |
Ga0066903_1045845621 | 3300005764 | Tropical Forest Soil | AEETRTVADQMTHEDSRTILRRIANDYDRLAKLAEEQRAAQEKQND* |
Ga0066903_1047431284 | 3300005764 | Tropical Forest Soil | TVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQERGTIGPKT* |
Ga0066903_1049083232 | 3300005764 | Tropical Forest Soil | MTHEQARTIMRRIANDYDRLAKVAEEQLAAQEKRATGD* |
Ga0066903_1049992883 | 3300005764 | Tropical Forest Soil | TVADQMTHEEARTIMRRIANDYDRLAKVAEEQLADQEKRETGA* |
Ga0066903_1052310631 | 3300005764 | Tropical Forest Soil | RTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGPIGPKT* |
Ga0066903_1052457091 | 3300005764 | Tropical Forest Soil | MTYEAARTIMRRIALDYDRLAKVAEEQLAGQEKRAIGDKT* |
Ga0066903_1062471692 | 3300005764 | Tropical Forest Soil | MTNEDARASMRRIANDYDRLAKLAEEQLAAQESGANDN* |
Ga0066903_1063411132 | 3300005764 | Tropical Forest Soil | EEARTVADQMTHEEARTIIRRIANDYDRLAKLAEEQLIAQERGETGD* |
Ga0066903_1065338911 | 3300005764 | Tropical Forest Soil | RAEETRTVADQMTHEESRTIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0066903_1065545911 | 3300005764 | Tropical Forest Soil | VADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGAIGPKT* |
Ga0066903_1066920241 | 3300005764 | Tropical Forest Soil | DQMTHEETRTIMRRIANDYDRLAKLAEEQLADQERGAIGPKT* |
Ga0066903_1067146401 | 3300005764 | Tropical Forest Soil | MTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGA |
Ga0066903_1067346211 | 3300005764 | Tropical Forest Soil | EEARTVADQMTHEAARTIMRRIAMDYDRLAKVAEEQLAAQERGATDD* |
Ga0066903_1067559192 | 3300005764 | Tropical Forest Soil | MTHEAARTIMRRIAMDYDRLAKVAEEQLIDQERGIGRKT* |
Ga0066903_1076512622 | 3300005764 | Tropical Forest Soil | MIHEEARTIMRRIANDYDRLAKVAEEQLAAQEKRATGD* |
Ga0066903_1078740341 | 3300005764 | Tropical Forest Soil | ADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQERGAIGPKT* |
Ga0066903_1081789161 | 3300005764 | Tropical Forest Soil | EESRTIMRRIANDYDRLAKLAEEQLADQERGATGDKT* |
Ga0066903_1086376561 | 3300005764 | Tropical Forest Soil | EAARTIMRRIAVDYDRLAKVAEEQLADQERGAIGDKT* |
Ga0126374_101415354 | 3300009792 | Tropical Forest Soil | MTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT* |
Ga0126374_114232321 | 3300009792 | Tropical Forest Soil | EARTIVRRIANDDDRLAKLAELADQERGATGDKT* |
Ga0126380_100442823 | 3300010043 | Tropical Forest Soil | MTHEEARTIMRRIAMDYDRLAKVAEEQLADQEKGAIGPKT* |
Ga0126380_107483471 | 3300010043 | Tropical Forest Soil | TRTIMRRIANDYDRLAKVAEEQLADKERGAIGDKT* |
Ga0126380_113933732 | 3300010043 | Tropical Forest Soil | MTHEESRAIMRRIALDYDRLAKLAEEQLADKEKRATGD* |
Ga0126384_101050635 | 3300010046 | Tropical Forest Soil | MTHEESRTIMRRIANDYDRLAKLAEEQLADQEKRATGDKT* |
Ga0126384_102549981 | 3300010046 | Tropical Forest Soil | MNHEESRTIMRRIALDYDRLAKLAEEQLADQKKGAIGDKT* |
Ga0126384_104481381 | 3300010046 | Tropical Forest Soil | QMTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGPIGPKT* |
Ga0126384_105537832 | 3300010046 | Tropical Forest Soil | MTHEEAWTIMRRIADDYDRLAKVAEEQLANRERGAIGDKTERPGPK* |
Ga0126384_105622911 | 3300010046 | Tropical Forest Soil | MTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGAIGPKT* |
Ga0126384_116889641 | 3300010046 | Tropical Forest Soil | SRTIMRRIAMDYDRLAKLAEVQLADQERGAIGGKT* |
Ga0126384_117158951 | 3300010046 | Tropical Forest Soil | EEARTIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0126384_123881582 | 3300010046 | Tropical Forest Soil | SDQMTHEESRTIMRRIAMDYDRLAKLAEAQLADQERRAIGDKT* |
Ga0126384_124060931 | 3300010046 | Tropical Forest Soil | QMNHEESRTIMRRIALDYDRLAKLAEEQLADQERRATGDKT* |
Ga0126382_102759633 | 3300010047 | Tropical Forest Soil | MTHEEARTIVRRIANDYDRLAKFAEEQLAAQEKRND* |
Ga0126382_109479633 | 3300010047 | Tropical Forest Soil | EAARTIMRRIALDYDRLAKLAEEQLADQERGIGRKT* |
Ga0126382_118738731 | 3300010047 | Tropical Forest Soil | HEESRTIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0126382_120513361 | 3300010047 | Tropical Forest Soil | RTIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0126373_100456061 | 3300010048 | Tropical Forest Soil | LAGKEARTVADQMTHEDARTIMRRIAMDYDRLAKVAKEQLADQEKRATGD* |
Ga0126373_116301161 | 3300010048 | Tropical Forest Soil | HEAARTIMRRIAMDYDRLAKVAEEQLADKERGAIGPKT* |
Ga0126373_122928251 | 3300010048 | Tropical Forest Soil | MTHEEARTIMRHIANDYDRLAKLAEEQLADQERGAIGD* |
Ga0134111_103591521 | 3300010329 | Grasslands Soil | EEARTIGDQMTHEVARTIMRRIALDYDRLAKLAEEQLADQERGTIDD* |
Ga0126370_112629861 | 3300010358 | Tropical Forest Soil | DQMTHEESRAIMRRIALDYDRLAKLAEEQLADKERGAIGD* |
Ga0126370_114559771 | 3300010358 | Tropical Forest Soil | THEEARTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
Ga0126376_102430345 | 3300010359 | Tropical Forest Soil | RAEEARTVADHMTHEEARTIMRRIATDYDRLAKLAEVQLIQEEIDRNT* |
Ga0126376_122827701 | 3300010359 | Tropical Forest Soil | RTVADQMTHEEARTIMRRIANDYDRLAKLAEEQLADQERGAVGDKT* |
Ga0126376_131117502 | 3300010359 | Tropical Forest Soil | MTHEEARTIMRRIANDYDRLAKLAEEQLADQERRATGD* |
Ga0126372_119986212 | 3300010360 | Tropical Forest Soil | AEEARTVADQMTHEEARTIMRRIANDYDRLAKLAEEQLIDQEKRATGV* |
Ga0126372_123043582 | 3300010360 | Tropical Forest Soil | QMTHEEARTIMRRIANDYDRLAKLAEEQLADQERGDKT* |
Ga0126372_126023061 | 3300010360 | Tropical Forest Soil | HEEARTIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0126378_102642495 | 3300010361 | Tropical Forest Soil | MTHEEARTIMRRIANDYDRLAKLAEEQLADQEREATGD* |
Ga0126378_117274981 | 3300010361 | Tropical Forest Soil | MTHEEARTIMRRIANDYDRLAKLAEEQLADQERGATGDKT* |
Ga0126378_118344981 | 3300010361 | Tropical Forest Soil | DQMTHEEARTIMRRIANDYDRLAKLAEEQLIAQERGTTGD* |
Ga0126378_124634172 | 3300010361 | Tropical Forest Soil | MTHEEARTIMRRIANDYDRLAKLAEEQLADQERGTIDD* |
Ga0126377_114062391 | 3300010362 | Tropical Forest Soil | TVADQMTHEEARTIMRRIANDYDRLAKVAEEQLAAQEKRATGD* |
Ga0126377_119695722 | 3300010362 | Tropical Forest Soil | EARTIMRRIANDYDRLAKVAEEQLAAQEKRATGD* |
Ga0126377_125741521 | 3300010362 | Tropical Forest Soil | MTHEEARTIMRRIANDYDRLAKVAEEQLADQEKRATGD* |
Ga0126379_100563765 | 3300010366 | Tropical Forest Soil | AEETRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGPIGPKT* |
Ga0126379_107870573 | 3300010366 | Tropical Forest Soil | DQMTHEESRAIMRRIALDYDRLAKLAEEQLADQERGAIGPKT* |
Ga0126379_117502461 | 3300010366 | Tropical Forest Soil | AEETRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQERGAGPKT* |
Ga0126381_1004313792 | 3300010376 | Tropical Forest Soil | LAGKEARTVADQMTHEDARTIMRRIANDYDRLAKVAKEQLADQEKRATGD* |
Ga0126381_1021192693 | 3300010376 | Tropical Forest Soil | ADQMTHEEARTIMRRIANDYDRLAKVAEEQLAGQEKRATGEKT* |
Ga0126381_1030725661 | 3300010376 | Tropical Forest Soil | THEESRAIMRRIALDYDRLAKLAEEQLADQERGAGPKT* |
Ga0126383_104099042 | 3300010398 | Tropical Forest Soil | MTHEEARTIMRRIANDYDRLAKVAEERLAAQEKRATGD* |
Ga0126383_105806901 | 3300010398 | Tropical Forest Soil | TVADQMTHEGARAIMRRIANDYDRLAKVAEEQLADQERGANGD* |
Ga0126383_106351911 | 3300010398 | Tropical Forest Soil | RFRAEETRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQEKGPIGPKT* |
Ga0126383_107011864 | 3300010398 | Tropical Forest Soil | TVADQMTHEGARAIMRRIANDYDRLAKVAEEQLADQERGATGPKT* |
Ga0126383_111712452 | 3300010398 | Tropical Forest Soil | MTHEEARAIVRRIANDYDRLAKLAEVQLAAQDGGATGH* |
Ga0126383_113139822 | 3300010398 | Tropical Forest Soil | MTHEAARTIMRRIAMDYDRLAKLAEEQLADQEKRATGD* |
Ga0126383_116252331 | 3300010398 | Tropical Forest Soil | RTVADQMNHEEARAIMRRIALDSDRLAKIAEEQLADQERGAIGPKT* |
Ga0126383_116325242 | 3300010398 | Tropical Forest Soil | ARTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
Ga0126383_123051732 | 3300010398 | Tropical Forest Soil | AEETRTVADQMTHEESRTIMRRIALDYDRLAKLAEAQLIQQAT* |
Ga0126383_131272331 | 3300010398 | Tropical Forest Soil | THEESRAIMRRIALDYDRLAKLAEEQLADQERGAIGPKT* |
Ga0126383_132190182 | 3300010398 | Tropical Forest Soil | MTHEEAWTIMRRITDDYDRLAKVAEEQLANRERGAIGDKTERPGPK* |
Ga0126383_134802482 | 3300010398 | Tropical Forest Soil | TRTVADQMTHEEARTIMRRIALDYDRLAKLAEEQLADQERGATGDKT* |
Ga0126375_106634662 | 3300012948 | Tropical Forest Soil | DARTIMRRIANDYDRLAKLAEVQLADQESGATATGDKT* |
Ga0126369_104058923 | 3300012971 | Tropical Forest Soil | EETRTVADQMTHEESRTIMRRIANDYDRLAKLAEEQLADQERGATGDKT* |
Ga0126369_107188221 | 3300012971 | Tropical Forest Soil | MTHEDARTIMRRIANDYDRLAKVAKEQLADQEKRATGD* |
Ga0126369_110685931 | 3300012971 | Tropical Forest Soil | DQMTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT* |
Ga0126369_118280271 | 3300012971 | Tropical Forest Soil | RTIMRRIANDYDRLAKLAEEQLADQERGAIDGKT* |
Ga0126369_119940192 | 3300012971 | Tropical Forest Soil | ESRTIMRRIALDYDRLAKLAEEQLADQEKRAIGDKT* |
Ga0126369_123100952 | 3300012971 | Tropical Forest Soil | MTHEEARTVMRRIANDYDRLAKLAEEQLADQERGDKT* |
Ga0126369_126970591 | 3300012971 | Tropical Forest Soil | ADQMNHEESRTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT* |
Ga0132258_121784661 | 3300015371 | Arabidopsis Rhizosphere | MTHEAARTIMRRIANDYDRLAKLAEDQLAAEEKRSD* |
Ga0132256_1017141612 | 3300015372 | Arabidopsis Rhizosphere | MTHEAARTIMRRIANDYDRLAKLAEEQLAAQEKQND* |
Ga0132257_1011307021 | 3300015373 | Arabidopsis Rhizosphere | MQPAEMTHEEARTIMRRIANDYDRLAKFAEEQLAAQEKQND* |
Ga0182036_100641701 | 3300016270 | Soil | EEARTIMRRIANDYDRLAEVAEEQLADQERRNDGG |
Ga0182041_105034053 | 3300016294 | Soil | VTVADQMTHEEARTIMRRIANDYDRLAKLAEEQLADQERGAIGDKT |
Ga0182041_112663801 | 3300016294 | Soil | DQMTHEEARTIMRRIADDYDRLAKVAEEQLAAQEKRATGDKT |
Ga0182033_116969481 | 3300016319 | Soil | TVADHMTHEEARAIIQRIANDYDRLAKLADEQLIDQERGTLGRKT |
Ga0182033_120231221 | 3300016319 | Soil | RMTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT |
Ga0182035_101835262 | 3300016341 | Soil | MLTFEHYQMTHEVARTIMRRIAMDYDRLAKLAEEQIADQERGTIDD |
Ga0182035_107487113 | 3300016341 | Soil | ETRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQERGATGPKT |
Ga0182035_114995231 | 3300016341 | Soil | ARTVADHMTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGAIGDKT |
Ga0182032_111482801 | 3300016357 | Soil | MTHEEARTIMRRIANDYDRLAEVAEEQLADQERRNDGG |
Ga0182032_114445091 | 3300016357 | Soil | ARTIMRRIANDYDRLAKLAEEQLADQERGAIGNKT |
Ga0182034_102944761 | 3300016371 | Soil | QMTHEESRTIMRRIALDYDRLAKLAEVQLADQERRTIEPKT |
Ga0182037_100443231 | 3300016404 | Soil | RHEESRTIMRRIAWDYDRLAKLAEERLADQERRAIEPKT |
Ga0182037_107431662 | 3300016404 | Soil | MTHEEARTIMRRIANDYDHLAKVAEEQLAAQERRAIGDKT |
Ga0182037_115184111 | 3300016404 | Soil | VADHMTHEEARAIIQRIANDYDRLAKLADEQLIDQERGTLGRKT |
Ga0182037_119756332 | 3300016404 | Soil | ADQMTHEEARTIVRRIANDYDRLAKLAEKQLADQERGAIGDKT |
Ga0182037_121608841 | 3300016404 | Soil | QMTHEEARTITRRIANDYDRLAKVAEEQLAAQEKRATGD |
Ga0182039_105784761 | 3300016422 | Soil | ESRTIMWRIANDYDRLAKLAEEQLAAQDGGATGDKT |
Ga0182039_115908392 | 3300016422 | Soil | EEARTVADQMTHEEARTIMRRIANDYDHLAKVAEEQLAAQERRAIGDKT |
Ga0182039_122302751 | 3300016422 | Soil | TVADQMTHEQSRTSMRRIAMDYDRLAKLADVQLADQERGAIRPKT |
Ga0182039_122779822 | 3300016422 | Soil | LALPSEETRTVADQMTHEEARTIMRRIALDYDRLAKLAEEQLADQERGIGRKT |
Ga0182038_114218643 | 3300016445 | Soil | SDEEARTIMRRIANDYDRLAKLAEEQLADQERGATGDKT |
Ga0182038_115855412 | 3300016445 | Soil | RTVADQMTHEGARAIMRRIANDYDRLAKFAEEQLADQERGTIDD |
Ga0126371_103743461 | 3300021560 | Tropical Forest Soil | ETRTVADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQEAIDRKT |
Ga0126371_113683152 | 3300021560 | Tropical Forest Soil | EARTIMRRIANDYDRLAKLAEEQLADQERGATGDKA |
Ga0209799_10731972 | 3300027654 | Tropical Forest Soil | EARTVGDQMTHEDARTIMRRIANDYDRLAKLAEEQLADQEKKATGDKTWNRMAGPK |
Ga0209465_101024023 | 3300027874 | Tropical Forest Soil | RRARTIMRRIANDYDRLAKLAEEQLADQERGAIGDKT |
Ga0209465_101259173 | 3300027874 | Tropical Forest Soil | RRARTIMRRIANDYDRLAKLAEEQLADQERGATGDKT |
Ga0209465_102269131 | 3300027874 | Tropical Forest Soil | THEEARMVMRRIANDYDRLAKFADEQLADQERGVTGD |
Ga0209465_103477821 | 3300027874 | Tropical Forest Soil | THEEARTIMRRIAMDYDRLAKLAEEQLADQERGATGDKT |
Ga0318516_100028039 | 3300031543 | Soil | MTHEEARTITRRIANDYDRLAKVAEEQLAAQEKRATGD |
Ga0318516_103246521 | 3300031543 | Soil | MTHEESRTIMWRIANDYDRLAKLAEEQLAAQDGGATGDKT |
Ga0318516_104235181 | 3300031543 | Soil | MIHEEPRTIMRRIANDYDRLAKLAEEQLAAQERGAIGDKT |
Ga0318541_103337481 | 3300031545 | Soil | MTHEEARTIMRRIANDYDHLAKVAEEQLAAQERGATGDRR |
Ga0318541_104141391 | 3300031545 | Soil | SRTIMRRIANDYDRLAKFAEEQLADQERRAISDKT |
Ga0318541_104673871 | 3300031545 | Soil | MTHEEARTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT |
Ga0318541_106603151 | 3300031545 | Soil | MTHEESRTIMRRIANDYDRLAKLAEEQLADQERRAIGDKA |
Ga0318541_108399382 | 3300031545 | Soil | VADHMTHEEARTIIRRIAMDYDRLAKLADEQLIDQERGTLGRKT |
Ga0318538_101177501 | 3300031546 | Soil | RAQESRTVADQMTHEDARTIMRRIANDYDRLAKVAEEQLADQEKRATGD |
Ga0318528_104944382 | 3300031561 | Soil | THEEARTIMRRIANDYDRLGKLAEEQLADQERGAIGDKT |
Ga0318515_106860512 | 3300031572 | Soil | VTVADQMTHEEARTIMRRIANDYDRLGKLAEEQLADQERGAIGDKT |
Ga0310915_100249341 | 3300031573 | Soil | ADQMTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT |
Ga0310915_110817131 | 3300031573 | Soil | RAEETRTVADQMTHEEARTIMRRIALDYDRLAKFAEEQLADQERGAIGDKT |
Ga0318555_106505612 | 3300031640 | Soil | AEETRTIADQMTHEDARTIMRRIANDYDRLAKVAEEQLVDQGRGAIGPKT |
Ga0318561_108050831 | 3300031679 | Soil | THEAARTIMRRIANDYDRLAKVAEEQLADQEKRATGD |
Ga0318574_100135434 | 3300031680 | Soil | MTHEEARTIMRRVALDYDRLAKLAEEQLADQERGAD |
Ga0318496_103797101 | 3300031713 | Soil | VADQMTHEESRAIMRRIALDYDRLAKLAEEQLADQERGATGPKT |
Ga0318496_105664251 | 3300031713 | Soil | MTHEEARAIIRRIAMGYDRLAKLADEQLIDQERGAIGPKT |
Ga0306917_107569521 | 3300031719 | Soil | VADQMTHEESRTIMRRIANDYDRLAKLAEEQLADQESGATATGDKT |
Ga0306917_112350521 | 3300031719 | Soil | THEGSRTIMRRIANDYDRLAKFAEEQLADQERRAISDKT |
Ga0306917_113390342 | 3300031719 | Soil | RFRAEETRTVADHMTHEEARTIMRRIANDYDRPAKLVEEQLADQERGAICD |
Ga0318493_103366281 | 3300031723 | Soil | RTVADQMTHEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGD |
Ga0318500_106515881 | 3300031724 | Soil | VQARTVADHMTHEEARAIIQRIANDYDRLAKLADEQLIDQEKRATGD |
Ga0318501_103132591 | 3300031736 | Soil | MTHEEARTIMRRTANDYDRLAKVAEEQLAAQEKRATGD |
Ga0307468_1013630302 | 3300031740 | Hardwood Forest Soil | MTHEGARTIMRRIAMDYDRLAKLAEEQIADQERGTIDD |
Ga0306918_101968203 | 3300031744 | Soil | MTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT |
Ga0306918_110913062 | 3300031744 | Soil | RAEQARTIAHQMTHEEARTIMRRIANDYDRLAKVAEEQLADQERGDKT |
Ga0318502_104145641 | 3300031747 | Soil | MTHEESRAIMRRIALDYDRLAKLAEEQLADQERGATGPKT |
Ga0318502_104900091 | 3300031747 | Soil | MNHEEARTIMRRIANNYDRLAKLAEEQLADQERGAIGPKT |
Ga0318502_110392951 | 3300031747 | Soil | MTHEEARTIMRRIANDYDRLGKLAEEQLADQERGAIG |
Ga0318509_104541461 | 3300031768 | Soil | HEEARAIMRRIANDYDRLAKLAEEQLADQERGATGDKT |
Ga0318521_102041301 | 3300031770 | Soil | RFRAEETRTVADQMTHEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGD |
Ga0318546_107007371 | 3300031771 | Soil | EESRTVADQMTHEDARTIMRRIANDYDRLAKVAEEQLADQEKRATGD |
Ga0318543_103707912 | 3300031777 | Soil | QITHEEARAIMRRIANDYDRLAKLAEEQLADQERGATGDKT |
Ga0318543_105654021 | 3300031777 | Soil | HEEARTIIRRIATDYDRLAKLADEQLIAQARGTLRQKT |
Ga0318508_12194772 | 3300031780 | Soil | VADHMTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGAIGDKT |
Ga0318547_100133001 | 3300031781 | Soil | VADQMTHEAARTIMRRIAMDYDRLAKLADEQLIDQEKRATGD |
Ga0318547_106959501 | 3300031781 | Soil | EQARTVADHMAHEEARAIIRRIAMDYDRLAKLADEQLIDQERGAIGDKT |
Ga0318529_104804272 | 3300031792 | Soil | TVADHMTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGALGDKT |
Ga0318557_101462511 | 3300031795 | Soil | RTVADQMTHEEARTIMRRIANDYDRLAKLAEEQLADQERGAVGDKT |
Ga0318576_104121593 | 3300031796 | Soil | EEARAIIRRIAMDYDRLAKLADEQLIDQERGAIGDKT |
Ga0318576_105099112 | 3300031796 | Soil | RTVADHMTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGALGDKT |
Ga0318550_106461951 | 3300031797 | Soil | MTHQQAWTIMRRIANDYDRLAKVAEEQLADQERGDKT |
Ga0318550_106528451 | 3300031797 | Soil | MTHEDARTIMRRIANDYDRLAKVAEEQLADQEKRATGD |
Ga0318523_103100762 | 3300031798 | Soil | MNHEEARTIMRGIALDYDRLAKLAEEQLADQERGAD |
Ga0318523_104218181 | 3300031798 | Soil | QMTHEDARTIMRHIANDYDRLAKLAEEQLADQERGATGDKT |
Ga0318568_104565541 | 3300031819 | Soil | MTHEEARTIRRRIALDYDRLAKLAEEQLADQERGAIGDKT |
Ga0310917_109308302 | 3300031833 | Soil | MTHEESRAIMRRIALDYDRLAKLAEEQLANQERGAIGD |
Ga0306919_102959882 | 3300031879 | Soil | MTHEESRTIMRRIALDYDRLAKLAEVQLADQERRTIEPKT |
Ga0306919_104216081 | 3300031879 | Soil | MTHEESRTIMWRIANDYDRLAKLAEEQLAAQDGGA |
Ga0306919_106197122 | 3300031879 | Soil | MTHKEARAIMRRIANDYDRLAKVAEEQLAAQEKRATDD |
Ga0306919_106731681 | 3300031879 | Soil | FRAEETRTVADQMTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT |
Ga0306925_104290464 | 3300031890 | Soil | TRTVADQMTHEESRTIMRRIANDYDRLAKFAEAQLADQERRAISDKT |
Ga0306925_105556331 | 3300031890 | Soil | MTHEESRTIMRRIANDYDRLAKLAEAQLAAQEKRATGD |
Ga0306925_109549002 | 3300031890 | Soil | HMTHEEARAIIRRIAMGYDRLAKLADEQLIDQERGAIGPKT |
Ga0306925_115316811 | 3300031890 | Soil | ADQMTHEESRTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT |
Ga0306925_120754021 | 3300031890 | Soil | MIHEEARTIMRRIAMDYDRLAKFAEVQLANQERGAIGPKT |
Ga0318522_103717602 | 3300031894 | Soil | VADQMTHEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGD |
Ga0318520_105656962 | 3300031897 | Soil | VADQMTHEDARTIMRRIANDYDRLAKVAEEQLADQEKRATGD |
Ga0306923_105933383 | 3300031910 | Soil | MTHEEARTIMRRVANDYDRLAKLAEEQLADQEKRATGD |
Ga0306923_111508292 | 3300031910 | Soil | MTHEEARTIMRRIANDYDRLAKLAEEQLADQERGAVGDKT |
Ga0306923_117450401 | 3300031910 | Soil | EARTVADQMTHKEARAIMRRIANDYDRLAKVAEEQLAAQEKRATDD |
Ga0306923_119415692 | 3300031910 | Soil | TVADQMTHEESRTIMRRIANDYDRLAKFAEAQLADQERRAISDKT |
Ga0306923_121510281 | 3300031910 | Soil | MIHEEARTIMRRIANDYDRLAKLADEQLIDQERGTLGRKT |
Ga0306921_103750022 | 3300031912 | Soil | MTHEESRMIMRRIANDYDRLAKLAEEQLADQEKRATGD |
Ga0306921_105586472 | 3300031912 | Soil | MTHEEARTIMRRIAMDYDRLAMLAEVQLADQERRTIDD |
Ga0306921_116328551 | 3300031912 | Soil | RTVADQMTHEESRTIMRRIANDYDRLAKFAEAQLADQERRAISDKT |
Ga0306921_118143991 | 3300031912 | Soil | THEEARAIIRRIAMDYDRLAKLADEQLIDQERGALGDKT |
Ga0306921_119054073 | 3300031912 | Soil | HEEARTIMRRIANDYDRLAKLAEEQLAAQERGATGD |
Ga0310912_102807552 | 3300031941 | Soil | QTRTVADQMTHEEARAIMGRIALDYDRLAKVAEEQLADQERGAIGDKT |
Ga0310912_106314743 | 3300031941 | Soil | DQMTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGPKT |
Ga0310912_107847082 | 3300031941 | Soil | NHEEARTIMRRIANDYDRLAKLAEEQLADQERGAIGPKT |
Ga0310916_108096922 | 3300031942 | Soil | EETRTVADQMTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT |
Ga0310913_107031012 | 3300031945 | Soil | MTHEEARTIMRRIANDYDRLAKVAEEQLADQERGMTGDKT |
Ga0310913_110262881 | 3300031945 | Soil | MTHEESRTIMRRIANDYDRLAKLAEEQLADQERGATGPKT |
Ga0310910_106160503 | 3300031946 | Soil | VADQMTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGPKT |
Ga0310910_110068423 | 3300031946 | Soil | THEEARRIMRRIANDYDRLAKLAEEQLAAQERGATGD |
Ga0310909_108758523 | 3300031947 | Soil | RTVADQMTHEQSRTSMRRIAMDYDRLAKLADVQLADQERGAIRPKT |
Ga0310909_112069061 | 3300031947 | Soil | EQARTVADHMTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGAIGDKT |
Ga0310909_113554531 | 3300031947 | Soil | QMTHQQAWTIMRRIANDYDRLAKVAEEQLADQERGDKT |
Ga0306926_107093064 | 3300031954 | Soil | AVQARTVADHMTHEEARAIIQRIANDYDRLAKLADEQLIDQEKRATGD |
Ga0306926_114125792 | 3300031954 | Soil | EQTRTVADQMTHEEARTIMRRIALDYDRLAKLAEEQLADQERGAIGPKT |
Ga0306926_117459842 | 3300031954 | Soil | GIWLRAQEALTVADQMTHEQSRTSMRRIAMDYDRLAKLADVQLADQERGAIRPKT |
Ga0318530_100912921 | 3300031959 | Soil | MTHEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGDKA |
Ga0318530_101430061 | 3300031959 | Soil | THEESQAIMRRIALDYDRLAKLAEEQLADQERGATGDKT |
Ga0318530_102912222 | 3300031959 | Soil | MTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGAIGDKT |
Ga0318531_105653431 | 3300031981 | Soil | MTHEAARTIMRRIANDYDHLAKVAEEQLADQEKRATGDKT |
Ga0306922_120183171 | 3300032001 | Soil | QMTHEEARTIMRRIANDYDRLAKVAEEQLAAQEKRATGD |
Ga0310911_101659234 | 3300032035 | Soil | MTHEEARTIMRRIALDYDRLAKLAEEQLADQERGATGDKT |
Ga0310911_105903842 | 3300032035 | Soil | MTHEEARAIMGRIALDYDRLAKVAEEQLADQERGAIGDKT |
Ga0310911_107391481 | 3300032035 | Soil | DQMTHEEARTIMRRIALDYDRLAKLAEEQLADQERGAIGDKT |
Ga0318559_103943302 | 3300032039 | Soil | VADHMTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGALGDKT |
Ga0318559_105105312 | 3300032039 | Soil | MTHEAARTIMRRIANDYDRLAKLAEEQLAAQERGSMGDKT |
Ga0318549_101746671 | 3300032041 | Soil | RAEETRTVADQMTHEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGD |
Ga0318556_104238522 | 3300032043 | Soil | ETRTIADQMTHEDARTIMRRIANDYDRLAKVAEEQLVDQGRGAIGPKT |
Ga0318532_102119371 | 3300032051 | Soil | DHMTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGALGDKT |
Ga0318506_103922411 | 3300032052 | Soil | PRTIMRRIANDYDRLAKLAEEQLAAQERGAIGDKT |
Ga0318575_103136551 | 3300032055 | Soil | HMTHEEARAIIRRIANDYDRLAKLADEQLIDQERGAIGDKT |
Ga0318533_1001833311 | 3300032059 | Soil | EARTIMRRIALDYDRLAKFAEEQLADQERGAIGDKT |
Ga0318533_102763702 | 3300032059 | Soil | MTHEEARTIMRRIANDYDRLAKVAEEQLADQERGAIGPKT |
Ga0318533_105842592 | 3300032059 | Soil | MTHEIMRRIANDYDRLAKLAEEQLADQERGAIGDKT |
Ga0318505_100847351 | 3300032060 | Soil | TRTVADQMTHEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGD |
Ga0318510_100450881 | 3300032064 | Soil | HEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGD |
Ga0318513_105125291 | 3300032065 | Soil | ARTVADHMTHEEARAIIRRIAMDYDRLAKLADEQLIDQERGALGDKT |
Ga0306924_102424011 | 3300032076 | Soil | MTHEGTRSIMRRIAMDYDRLAKLAEEQLADQERGTIDD |
Ga0306924_104082863 | 3300032076 | Soil | ARTIMRRIANDYDRLAKVAEEQLADQERGAIGDKT |
Ga0318525_104222591 | 3300032089 | Soil | THEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGD |
Ga0306920_1006662632 | 3300032261 | Soil | MTHEESRTIIRRIAMGYDRLAKLADEQLIDQERGAIGPKT |
Ga0306920_1006748481 | 3300032261 | Soil | RTVADQMTHEEARTIMRRIANDYDRLAKVAEEQLAAQEKRATGD |
Ga0306920_1012262463 | 3300032261 | Soil | ESRTVADQMTHEDARTIMRRIANDYDRLAKVAEEQLADQEKRATGD |
Ga0306920_1014691421 | 3300032261 | Soil | KIFADCCMRRIAMDYDRLAKLAEEQIADQERGTIDD |
Ga0306920_1031435402 | 3300032261 | Soil | MTHEAARTIMRRIANDYDRLAKLAEEQLANQERRATGD |
Ga0306920_1036119822 | 3300032261 | Soil | MTHEESRTIMRRIANDYDRLAKFAEEQLADQERRAIGD |
Ga0310914_103330181 | 3300033289 | Soil | MTHEEARAIIQRIANDYDRLAKLADEQLIDQEKRATGD |
Ga0310914_103695581 | 3300033289 | Soil | TRTVADQMTHEEARAIMGRIALDYDRLAKVAEEQLADQERGAIGDKT |
Ga0318519_102231263 | 3300033290 | Soil | MTHEEARTIMRRIANDYDRLAKVAEEQLAAQEKRATGD |
Ga0318519_102657361 | 3300033290 | Soil | RAEEARTIADQMTDEEARTIMRRIANDYDRLAKLAEEQLADQERGATGDKT |
⦗Top⦘ |