Basic Information | |
---|---|
Family ID | F012899 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 276 |
Average Sequence Length | 42 residues |
Representative Sequence | EDGAYFKGSIEIDKSPEKESGGNAFARTSSAQAGAAATKTI |
Number of Associated Samples | 185 |
Number of Associated Scaffolds | 276 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.38 % |
% of genes from short scaffolds (< 2000 bps) | 86.23 % |
Associated GOLD sequencing projects | 169 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.696 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.261 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.797 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.449 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 276 Family Scaffolds |
---|---|---|
PF00248 | Aldo_ket_red | 18.48 |
PF01833 | TIG | 6.88 |
PF04519 | Bactofilin | 2.90 |
PF00106 | adh_short | 1.81 |
PF01979 | Amidohydro_1 | 1.45 |
PF13561 | adh_short_C2 | 1.09 |
PF02222 | ATP-grasp | 0.36 |
PF00891 | Methyltransf_2 | 0.36 |
PF04248 | NTP_transf_9 | 0.36 |
PF07228 | SpoIIE | 0.36 |
PF04879 | Molybdop_Fe4S4 | 0.36 |
PF11138 | DUF2911 | 0.36 |
PF09976 | TPR_21 | 0.36 |
PF14319 | Zn_Tnp_IS91 | 0.36 |
PF02371 | Transposase_20 | 0.36 |
PF13413 | HTH_25 | 0.36 |
PF04216 | FdhE | 0.36 |
PF07676 | PD40 | 0.36 |
PF14026 | DUF4242 | 0.36 |
PF02353 | CMAS | 0.36 |
PF03699 | UPF0182 | 0.36 |
COG ID | Name | Functional Category | % Frequency in 276 Family Scaffolds |
---|---|---|---|
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 2.90 |
COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.36 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.36 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.36 |
COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.36 |
COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.36 |
COG3058 | Formate dehydrogenase maturation protein FdhE | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.70 % |
Unclassified | root | N/A | 16.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459013|GO6OHWN01BI2VC | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
2228664022|INPgaii200_c1134896 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300000955|JGI1027J12803_104986600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1843 | Open in IMG/M |
3300004092|Ga0062389_100097506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2588 | Open in IMG/M |
3300004092|Ga0062389_102014735 | Not Available | 754 | Open in IMG/M |
3300004479|Ga0062595_100212585 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300005167|Ga0066672_10065744 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
3300005176|Ga0066679_10836574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300005181|Ga0066678_10171460 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300005181|Ga0066678_10277833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1090 | Open in IMG/M |
3300005187|Ga0066675_10093656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1966 | Open in IMG/M |
3300005332|Ga0066388_101162374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1315 | Open in IMG/M |
3300005341|Ga0070691_10875431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300005437|Ga0070710_10903693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 638 | Open in IMG/M |
3300005468|Ga0070707_100653553 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300005531|Ga0070738_10249052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 775 | Open in IMG/M |
3300005531|Ga0070738_10253202 | Not Available | 766 | Open in IMG/M |
3300005531|Ga0070738_10436254 | Not Available | 508 | Open in IMG/M |
3300005536|Ga0070697_101320329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300005536|Ga0070697_101339803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300005537|Ga0070730_10881986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300005538|Ga0070731_10155945 | Not Available | 1515 | Open in IMG/M |
3300005542|Ga0070732_10040004 | All Organisms → cellular organisms → Bacteria | 2692 | Open in IMG/M |
3300005542|Ga0070732_10122933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1538 | Open in IMG/M |
3300005554|Ga0066661_10237342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
3300005554|Ga0066661_10263958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
3300005558|Ga0066698_10741526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300005559|Ga0066700_10007019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5590 | Open in IMG/M |
3300005559|Ga0066700_10749463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300005560|Ga0066670_10967571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300005586|Ga0066691_10241467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
3300005586|Ga0066691_10530856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
3300005598|Ga0066706_10244056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1396 | Open in IMG/M |
3300005602|Ga0070762_10811431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
3300005921|Ga0070766_11107692 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006050|Ga0075028_100424436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300006173|Ga0070716_100304746 | Not Available | 1110 | Open in IMG/M |
3300006176|Ga0070765_100012213 | All Organisms → cellular organisms → Bacteria | 6083 | Open in IMG/M |
3300006176|Ga0070765_100649878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 995 | Open in IMG/M |
3300006797|Ga0066659_10014585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4337 | Open in IMG/M |
3300006797|Ga0066659_11504097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300006800|Ga0066660_10086440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2178 | Open in IMG/M |
3300006854|Ga0075425_101794267 | Not Available | 689 | Open in IMG/M |
3300006893|Ga0073928_10936015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 592 | Open in IMG/M |
3300006904|Ga0075424_101173464 | Not Available | 818 | Open in IMG/M |
3300006904|Ga0075424_102571842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300006954|Ga0079219_11821661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300007265|Ga0099794_10117008 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300009012|Ga0066710_102896196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300009038|Ga0099829_10073730 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
3300009038|Ga0099829_10435114 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300009038|Ga0099829_11358597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300009088|Ga0099830_10538529 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300009088|Ga0099830_10968209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300009088|Ga0099830_11675599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300009089|Ga0099828_11342430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300009090|Ga0099827_11162004 | Not Available | 671 | Open in IMG/M |
3300009090|Ga0099827_11702730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300009090|Ga0099827_11856510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300009143|Ga0099792_10590120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300009520|Ga0116214_1308734 | Not Available | 607 | Open in IMG/M |
3300010043|Ga0126380_10538355 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300010048|Ga0126373_11196217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
3300010048|Ga0126373_12134247 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300010048|Ga0126373_12347666 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300010048|Ga0126373_12361062 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300010303|Ga0134082_10003357 | All Organisms → cellular organisms → Bacteria | 5696 | Open in IMG/M |
3300010303|Ga0134082_10348423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300010320|Ga0134109_10237683 | Not Available | 683 | Open in IMG/M |
3300010320|Ga0134109_10253776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300010329|Ga0134111_10068311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
3300010343|Ga0074044_10061778 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
3300010359|Ga0126376_10099307 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2215 | Open in IMG/M |
3300010360|Ga0126372_10240031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1546 | Open in IMG/M |
3300010360|Ga0126372_10824580 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300010360|Ga0126372_12725633 | Not Available | 546 | Open in IMG/M |
3300010361|Ga0126378_10006182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9375 | Open in IMG/M |
3300010362|Ga0126377_11941744 | Not Available | 664 | Open in IMG/M |
3300010366|Ga0126379_10978987 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300010366|Ga0126379_13835925 | Not Available | 504 | Open in IMG/M |
3300010376|Ga0126381_100246260 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
3300010376|Ga0126381_101150992 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300010376|Ga0126381_101549983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 957 | Open in IMG/M |
3300010376|Ga0126381_103296769 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300010376|Ga0126381_103491588 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300010376|Ga0126381_103607099 | Not Available | 607 | Open in IMG/M |
3300010379|Ga0136449_101674554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
3300010397|Ga0134124_11708508 | Not Available | 662 | Open in IMG/M |
3300010398|Ga0126383_11919618 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300010880|Ga0126350_10396478 | Not Available | 760 | Open in IMG/M |
3300011120|Ga0150983_11872119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300011269|Ga0137392_10116370 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
3300011269|Ga0137392_11122904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300011269|Ga0137392_11123670 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300011269|Ga0137392_11240535 | Not Available | 604 | Open in IMG/M |
3300011270|Ga0137391_10041655 | All Organisms → cellular organisms → Bacteria | 3893 | Open in IMG/M |
3300011270|Ga0137391_10320211 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300011270|Ga0137391_11460751 | Not Available | 529 | Open in IMG/M |
3300011271|Ga0137393_10083452 | All Organisms → cellular organisms → Bacteria | 2574 | Open in IMG/M |
3300011271|Ga0137393_10999975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300011271|Ga0137393_11134764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300011271|Ga0137393_11422582 | Not Available | 583 | Open in IMG/M |
3300012096|Ga0137389_10421345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
3300012096|Ga0137389_11338726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300012189|Ga0137388_10409107 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300012189|Ga0137388_11227231 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300012189|Ga0137388_11541633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300012200|Ga0137382_10773010 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012202|Ga0137363_10351601 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300012202|Ga0137363_11250310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300012203|Ga0137399_10665366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
3300012203|Ga0137399_10983882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
3300012203|Ga0137399_11046194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
3300012203|Ga0137399_11228095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300012205|Ga0137362_10929744 | Not Available | 742 | Open in IMG/M |
3300012205|Ga0137362_11784727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300012206|Ga0137380_10190131 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
3300012208|Ga0137376_11250278 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300012210|Ga0137378_10595253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
3300012211|Ga0137377_10889136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300012211|Ga0137377_11786957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300012351|Ga0137386_10106242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1989 | Open in IMG/M |
3300012359|Ga0137385_11577643 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300012361|Ga0137360_10531356 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300012361|Ga0137360_11584548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300012363|Ga0137390_11197814 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300012363|Ga0137390_11300758 | Not Available | 673 | Open in IMG/M |
3300012402|Ga0134059_1359689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300012582|Ga0137358_10578385 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300012582|Ga0137358_10603282 | Not Available | 736 | Open in IMG/M |
3300012683|Ga0137398_11040685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300012917|Ga0137395_10484140 | Not Available | 890 | Open in IMG/M |
3300012917|Ga0137395_10907439 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300012918|Ga0137396_10322558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
3300012923|Ga0137359_11285641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300012923|Ga0137359_11577472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300012924|Ga0137413_11737976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
3300012925|Ga0137419_11932722 | Not Available | 507 | Open in IMG/M |
3300012927|Ga0137416_11058414 | Not Available | 726 | Open in IMG/M |
3300012929|Ga0137404_10042625 | All Organisms → cellular organisms → Bacteria | 3433 | Open in IMG/M |
3300012929|Ga0137404_11503200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300012929|Ga0137404_11998864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300012930|Ga0137407_10417011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1245 | Open in IMG/M |
3300012948|Ga0126375_10738186 | Not Available | 771 | Open in IMG/M |
3300012948|Ga0126375_11342398 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300012971|Ga0126369_10028876 | All Organisms → cellular organisms → Bacteria | 4544 | Open in IMG/M |
3300012971|Ga0126369_10430758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1364 | Open in IMG/M |
3300012971|Ga0126369_11317084 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300012971|Ga0126369_12417940 | Not Available | 611 | Open in IMG/M |
3300012971|Ga0126369_13245024 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012975|Ga0134110_10165030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
3300012975|Ga0134110_10212649 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300012977|Ga0134087_10259037 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300012977|Ga0134087_10631596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300014164|Ga0181532_10147125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1420 | Open in IMG/M |
3300014164|Ga0181532_10470707 | Not Available | 691 | Open in IMG/M |
3300014165|Ga0181523_10066380 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
3300014166|Ga0134079_10313682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300014968|Ga0157379_11355117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
3300015053|Ga0137405_1210272 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300015054|Ga0137420_1202687 | All Organisms → cellular organisms → Bacteria | 5924 | Open in IMG/M |
3300015245|Ga0137409_10769801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
3300015264|Ga0137403_10008349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11596 | Open in IMG/M |
3300015371|Ga0132258_12888544 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1194 | Open in IMG/M |
3300016270|Ga0182036_11074885 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300016319|Ga0182033_10843632 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300016371|Ga0182034_11748692 | Not Available | 547 | Open in IMG/M |
3300016404|Ga0182037_10017588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4298 | Open in IMG/M |
3300016404|Ga0182037_11463617 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300017822|Ga0187802_10126693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
3300017822|Ga0187802_10398124 | Not Available | 545 | Open in IMG/M |
3300017823|Ga0187818_10115543 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300017930|Ga0187825_10292089 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300017934|Ga0187803_10144146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
3300017947|Ga0187785_10195362 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300017955|Ga0187817_11090533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300017972|Ga0187781_10005550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9330 | Open in IMG/M |
3300017995|Ga0187816_10528184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300018006|Ga0187804_10239036 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300018012|Ga0187810_10447605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300018077|Ga0184633_10227315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300018085|Ga0187772_10963602 | Not Available | 622 | Open in IMG/M |
3300018086|Ga0187769_10159832 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1654 | Open in IMG/M |
3300018088|Ga0187771_11137998 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300018433|Ga0066667_10365537 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1153 | Open in IMG/M |
3300018482|Ga0066669_10088509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2110 | Open in IMG/M |
3300019888|Ga0193751_1193096 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300020199|Ga0179592_10338908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300020199|Ga0179592_10479101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300020579|Ga0210407_10827522 | Not Available | 713 | Open in IMG/M |
3300020579|Ga0210407_11047679 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300020580|Ga0210403_10603787 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300020581|Ga0210399_10272390 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300020581|Ga0210399_10693620 | Not Available | 837 | Open in IMG/M |
3300021046|Ga0215015_10039744 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300021168|Ga0210406_10109783 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
3300021170|Ga0210400_10086402 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
3300021170|Ga0210400_10618857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
3300021178|Ga0210408_10001092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29712 | Open in IMG/M |
3300021178|Ga0210408_10119126 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
3300021401|Ga0210393_10347856 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1206 | Open in IMG/M |
3300021401|Ga0210393_11311063 | Not Available | 580 | Open in IMG/M |
3300021406|Ga0210386_10821969 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300021433|Ga0210391_10194226 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1597 | Open in IMG/M |
3300021474|Ga0210390_10992999 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300021478|Ga0210402_10070738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3086 | Open in IMG/M |
3300021478|Ga0210402_10655535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 971 | Open in IMG/M |
3300021478|Ga0210402_10814746 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300021559|Ga0210409_10068773 | All Organisms → cellular organisms → Bacteria | 3297 | Open in IMG/M |
3300021559|Ga0210409_10344945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1339 | Open in IMG/M |
3300021559|Ga0210409_10409542 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300021559|Ga0210409_10622866 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300021559|Ga0210409_11615758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300021560|Ga0126371_12386632 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300021560|Ga0126371_13890774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300022504|Ga0242642_1090187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300022527|Ga0242664_1126137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300024251|Ga0247679_1015419 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300025320|Ga0209171_10005396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14445 | Open in IMG/M |
3300026301|Ga0209238_1219999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300026333|Ga0209158_1121024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
3300026374|Ga0257146_1039077 | Not Available | 769 | Open in IMG/M |
3300026523|Ga0209808_1039629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2215 | Open in IMG/M |
3300026528|Ga0209378_1285021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300026557|Ga0179587_10510209 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300027643|Ga0209076_1099146 | Not Available | 827 | Open in IMG/M |
3300027663|Ga0208990_1103417 | Not Available | 789 | Open in IMG/M |
3300027748|Ga0209689_1013725 | All Organisms → cellular organisms → Bacteria | 5232 | Open in IMG/M |
3300027748|Ga0209689_1280257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300027842|Ga0209580_10223048 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300027857|Ga0209166_10315536 | Not Available | 821 | Open in IMG/M |
3300027875|Ga0209283_10510356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300027903|Ga0209488_10143887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1799 | Open in IMG/M |
3300027903|Ga0209488_10528173 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300027903|Ga0209488_11108166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300027911|Ga0209698_10029741 | All Organisms → cellular organisms → Bacteria | 5016 | Open in IMG/M |
3300027911|Ga0209698_10407998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
3300027965|Ga0209062_1186922 | Not Available | 770 | Open in IMG/M |
3300028536|Ga0137415_10704590 | Not Available | 822 | Open in IMG/M |
3300028536|Ga0137415_10934704 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300028536|Ga0137415_11048423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300029636|Ga0222749_10102175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1347 | Open in IMG/M |
3300030659|Ga0316363_10113454 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300030707|Ga0310038_10350550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300031128|Ga0170823_15563381 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1819 | Open in IMG/M |
3300031546|Ga0318538_10043690 | All Organisms → cellular organisms → Bacteria | 2161 | Open in IMG/M |
3300031546|Ga0318538_10575303 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300031590|Ga0307483_1014811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300031668|Ga0318542_10324394 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300031708|Ga0310686_118378551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300031718|Ga0307474_11356656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300031744|Ga0306918_10568664 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300031744|Ga0306918_10982252 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300031754|Ga0307475_10581680 | Not Available | 897 | Open in IMG/M |
3300031754|Ga0307475_11182449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300031820|Ga0307473_10429688 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300031910|Ga0306923_10612764 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1220 | Open in IMG/M |
3300031942|Ga0310916_10935677 | Not Available | 725 | Open in IMG/M |
3300031942|Ga0310916_11213299 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300031945|Ga0310913_10073721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2267 | Open in IMG/M |
3300031946|Ga0310910_10823970 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300031946|Ga0310910_11252641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300031947|Ga0310909_11226950 | Not Available | 605 | Open in IMG/M |
3300031959|Ga0318530_10185565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 851 | Open in IMG/M |
3300031962|Ga0307479_10519246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1174 | Open in IMG/M |
3300031962|Ga0307479_11455240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300032055|Ga0318575_10431290 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300032076|Ga0306924_10952812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 945 | Open in IMG/M |
3300032174|Ga0307470_10896881 | Not Available | 696 | Open in IMG/M |
3300032180|Ga0307471_100928949 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300032261|Ga0306920_103838027 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300032770|Ga0335085_10190851 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
3300032770|Ga0335085_10724427 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1103 | Open in IMG/M |
3300032828|Ga0335080_10853491 | Not Available | 937 | Open in IMG/M |
3300033158|Ga0335077_10392098 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300033433|Ga0326726_11780480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.13% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.70% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.99% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.62% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.26% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.17% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.81% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.45% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.45% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.09% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.09% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.72% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.36% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.36% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.36% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.36% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.36% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N57_04436840 | 2170459013 | Grass Soil | MIEDGAYFKGSIEIDKSAEKESGAASFARTASTPAGAGVGPKTI |
INPgaii200_11348961 | 2228664022 | Soil | EDGAYFKGSIEIDKSAEKESGGSAFAKSSSAPAPATAGPKSI |
JGI1027J12803_1049866003 | 3300000955 | Soil | GAYFKGSIEIDKSAEKETSSAFSKPASAAAPATTGPKSI* |
Ga0062389_1000975062 | 3300004092 | Bog Forest Soil | ARIMIEDGAYFKGSIEIDKTAEKDNAHAFGRQATPAAAATKTI* |
Ga0062389_1020147352 | 3300004092 | Bog Forest Soil | GAYFKGSIEIDRSSEKESGHNAFAKSSSASAVAPATKTI* |
Ga0062595_1002125853 | 3300004479 | Soil | MIEDGAYFKGSIEIDKSSEKDSSHNAFAKSSNASAVAPAAKTI* |
Ga0066672_100657441 | 3300005167 | Soil | IMIEDGAYFKGSIEIDKSPEKESGKNAFARTSPAGAGAPATKTI* |
Ga0066679_108365741 | 3300005176 | Soil | RIMIEDGAYFKGSIEIDKTEQKESSSSHAFTRSSTAPAAVTAAKTI* |
Ga0066678_101714602 | 3300005181 | Soil | ISIEDGAYFKGSIEIDKSAEKESHGSAFSKPSSQPAATAGPKTI* |
Ga0066678_102778332 | 3300005181 | Soil | IEDGAYFKGSIEIDRASEKESDKHAFARTASAPATGGGPKSL* |
Ga0066675_100936564 | 3300005187 | Soil | SRIMIEDGAYFKGSIEIDKSPEKESGGNAFARTSSASSGAPATKTI* |
Ga0066388_1011623741 | 3300005332 | Tropical Forest Soil | ISIEDGAYFKGSIEIDKSAEKESSSAFSRTSAAAPATAKTI* |
Ga0070691_108754312 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | IMIEDGAYFKGSIEIDKSSEKDSSHNAFAKSSNASAVAPAAKTI* |
Ga0070710_109036933 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IMIEDGAYFKGSIEIDKSAEKESGAASFARTASTPAGAGVGPKTI* |
Ga0070707_1006535533 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RIMIEDGAYFKGSIEIDKSDQKESGAGAFARASAAPAGAAKTI* |
Ga0070738_102490522 | 3300005531 | Surface Soil | RIMIEDGAYFKGSIEIDKTAEKESSGANAFARSSSPAAATAKTI* |
Ga0070738_102532022 | 3300005531 | Surface Soil | FKGSIEIDKSAEKEHGSSAFSKPAPAAATAGPKTI* |
Ga0070738_104362541 | 3300005531 | Surface Soil | AYFKGSIEIDKTAEKESSSSNAFARSSSPATATAKTI* |
Ga0070697_1013203292 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GAYFKGSIEIDKSAEKETGSAFSKSSNAAAPATTAPKSI* |
Ga0070697_1013398032 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DGAYFKGSIEIDKSSEKETSSAFSKSSNATAPATTGPKSI* |
Ga0070730_108819862 | 3300005537 | Surface Soil | EDGAYFKGSIEIDKTAEKESGRGSAFAKPATANAGAPAAKTI* |
Ga0070731_101559452 | 3300005538 | Surface Soil | FKGSIEIDKSGEKETGGGSFSRSASAPAAAGVGPKTI* |
Ga0070732_100400042 | 3300005542 | Surface Soil | IEDGAYFKGSIEIDKSEQKEAGSQAFARSSAPAAATASKTI* |
Ga0070732_101229331 | 3300005542 | Surface Soil | RIMIEDGAYFKGSIEIDKSAEKETTSSSAFSRTPAAAGAPATKTI* |
Ga0066661_102373421 | 3300005554 | Soil | IMIEDGAYFKGSIEIDKSPEKESGSNAFARSSSHAAAPAAKTI* |
Ga0066661_102639581 | 3300005554 | Soil | DLTTSRIMIEDGAYFKGSIEIDKNPEKESGSNAFARSSSHAAAPAGKTI* |
Ga0066698_107415261 | 3300005558 | Soil | IMIEDGAYFKGSIEIDKTPEKESGSNAFARTSSASAGAPATKTI* |
Ga0066700_100070191 | 3300005559 | Soil | LTTSRIMIEDGAYFKGSIEIDKSPEKESGSNAFARSSSHAAAPAAKTI* |
Ga0066700_107494632 | 3300005559 | Soil | RIMIEDGAYFKGSIEIDKNPEKESGSNAFARSSSHAAAPAGKTI* |
Ga0066670_109675713 | 3300005560 | Soil | IMIEDGAYFKGSIEIDKSPEKESGGNAFARTSSASSGAPATKTI* |
Ga0066691_102414672 | 3300005586 | Soil | YFKGSIEIDKNPEKESGSNAFARSSSHAAAPAGKTI* |
Ga0066691_105308562 | 3300005586 | Soil | GAYFKGSIEIDKGSEKESGTSAFARTSSAPAGAAASKTI* |
Ga0066706_102440563 | 3300005598 | Soil | FKGSIEIDKSAEKEPSTPAFTRNSAAPAGVPVSKTI* |
Ga0070762_108114312 | 3300005602 | Soil | TARIMIEDGAYFKGSIEIDKSSEKDSSQNAFAKSSNAPVGAPATKTI* |
Ga0070766_111076922 | 3300005921 | Soil | FKGSIEIDKSSEKDSAHNAFAKSSNAPAGASAAKTI* |
Ga0075028_1004244361 | 3300006050 | Watersheds | IEDGAYFKGSIEIDKSAEKESGGSAFTRSSAAPAAAATKTI* |
Ga0070716_1003047462 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DGAYFKGSIEIDKSAEKESHGSAFSKPSSQAAATAGPKTI* |
Ga0070765_1000122131 | 3300006176 | Soil | EDGAYFKGSIEIDKSSEKDTAHNAFAKSSGAPVGAPAAKTI* |
Ga0070765_1006498782 | 3300006176 | Soil | RIMIEDGAYFKGSIEIDRSSEKESGHNAFAKSSSAPVGAPATKTI* |
Ga0066659_100145851 | 3300006797 | Soil | IEDGAYFKGSIEIDKSAEKESSSHAFTRSSSVPAATATKTI* |
Ga0066659_115040971 | 3300006797 | Soil | FKGSIEIDKSPEKESGGNAFARTSSASSGAPATKTI* |
Ga0066660_100864401 | 3300006800 | Soil | GAYFKGSIEIDKNPEKESGSNAFARSSSHAAAPAAKTI* |
Ga0075425_1017942672 | 3300006854 | Populus Rhizosphere | DGAYFKGSIEIDKSAEKESTGSAFAKSSAPAAATAGPKSI* |
Ga0073928_109360153 | 3300006893 | Iron-Sulfur Acid Spring | IMIEDGAYFKGSIEIDKSAEKDSTNAFARSNATPAAATTKTI* |
Ga0075424_1011734641 | 3300006904 | Populus Rhizosphere | AYFKGSIEIDKSAEKDSGGSAFAKSSSAPAAATAGPKSI* |
Ga0075424_1025718421 | 3300006904 | Populus Rhizosphere | RIMIEDGAYFKGSIEIDKSAEKDSGGSAFAKSSSTPAAAAAGPKSI* |
Ga0079219_118216612 | 3300006954 | Agricultural Soil | IEDGAYFKGSIEIDKSSEKESGHNAFAKSSAAPVGAPAAKTI* |
Ga0099794_101170081 | 3300007265 | Vadose Zone Soil | AYFKGSIEIDKSAEKESRGSAFAKPATANVGAPAAKTI* |
Ga0066710_1028961961 | 3300009012 | Grasslands Soil | ARIMIEDGAYFKGSIEIDKGSEKESGTSAFARASSAPAGAAASKTI |
Ga0099829_100737301 | 3300009038 | Vadose Zone Soil | MIEDGAYFKGSIEIDKSPEKESSANAFARTSSASSGAAATKTI* |
Ga0099829_104351141 | 3300009038 | Vadose Zone Soil | GDLTTASIMIEDGSYVKGAIEIDKTSEKDSGHSAFAKSSSASGSTAAATKTI* |
Ga0099829_113585971 | 3300009038 | Vadose Zone Soil | AYFKGSIEIDKSPEKESGSNAFARTSSASTGAPASKTI* |
Ga0099830_105385291 | 3300009088 | Vadose Zone Soil | IEDGAYFKGSIEIDKSAEKESSRGSAFAKPATVNAGAPAAKTI* |
Ga0099830_109682091 | 3300009088 | Vadose Zone Soil | TSRIMIEDGAYFKGSIEIDKSPEKDSGHAFARSSSAPAGAAATKTI* |
Ga0099830_116755991 | 3300009088 | Vadose Zone Soil | EDGAYFKGSIEIDKSSEKESSSNAFARSTSATAGAATTKTI* |
Ga0099828_113424302 | 3300009089 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKSPEKESGSNAFARTSSASTGAPATKTI* |
Ga0099827_111620041 | 3300009090 | Vadose Zone Soil | DGAYFKGSIEIDKSAEKESRGSAFAKPATANVGPPAAKTI* |
Ga0099827_117027302 | 3300009090 | Vadose Zone Soil | TARIMIEDGAYFKGSIEIDKGSEKESGTSAFARASSAPAGAAASKTI* |
Ga0099827_118565101 | 3300009090 | Vadose Zone Soil | TARIMIEDGAYFKGSIEIDKGSEKESGTSAFARTSSAPAGAAASKTI* |
Ga0099792_105901201 | 3300009143 | Vadose Zone Soil | RIMIEDGAYFKGSIEIDKSSEKESRSSAFAKPATANAGAAKTI* |
Ga0116214_13087341 | 3300009520 | Peatlands Soil | GSIEIDKSGEKDSGAGSFSRTSATAAAGAGPKTI* |
Ga0126380_105383553 | 3300010043 | Tropical Forest Soil | AYFKGSIEIDKSAEKDSGGSAFAKSSNTPAAAAAGPKSI* |
Ga0126373_111962172 | 3300010048 | Tropical Forest Soil | ARIMIEDGAYFKGSIEIDKSEQKDSSSQAFARSSAPVAATATKTI* |
Ga0126373_121342472 | 3300010048 | Tropical Forest Soil | GAYFKGSIEIDKTSEKESGSSSFSRSVSAPAPAGVGPKTI* |
Ga0126373_123476661 | 3300010048 | Tropical Forest Soil | IMIEDGAYFKGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI* |
Ga0126373_123610621 | 3300010048 | Tropical Forest Soil | DGAYFKGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI* |
Ga0134082_100033571 | 3300010303 | Grasslands Soil | TSRIMIEDGAYFKGSIEIDKSPEKESGSNAFARSSSHAAAPAAKTI* |
Ga0134082_103484231 | 3300010303 | Grasslands Soil | IMIEDGAYFKGSIEIDKSPEKESGGNAFARTSSASSGTPATKTI* |
Ga0134109_102376831 | 3300010320 | Grasslands Soil | EDGAYFKGSIEIDKSAEKESHGSAFSKPSSQPAATAGPKTI* |
Ga0134109_102537761 | 3300010320 | Grasslands Soil | IEDGAYFKGSIEIDKSPEKESGGNAFARTSSAPSGAPATKTI* |
Ga0134111_100683113 | 3300010329 | Grasslands Soil | MIEDGAYFKGSIEIDKSEQKESGSHAFAKSSAAPAGAAATKTI* |
Ga0074044_100617781 | 3300010343 | Bog Forest Soil | IEDGAYFKGSVEIDKTSEKESSSGSFARSASAPATAGVGPKTI* |
Ga0126376_100993074 | 3300010359 | Tropical Forest Soil | AYFKGSIEIDKSAEKESHGSAFSKSASAPAAATAGPKTI* |
Ga0126372_102400312 | 3300010360 | Tropical Forest Soil | ARIMIEDGAYFKGSTEIDKSAEKESTGSAFAKSSAPAAATAGPKSI* |
Ga0126372_108245801 | 3300010360 | Tropical Forest Soil | DGAYFKGSIEIDKSAEKESHGSAFSKSASAPAAATAGPKTI* |
Ga0126372_127256331 | 3300010360 | Tropical Forest Soil | DGAYFKGSIEIDKSAEKESSGSAFAKSSSAPAAATAGPKSI* |
Ga0126378_100061821 | 3300010361 | Tropical Forest Soil | SIEIDKSGEKESGAGSFTRTASAPAAAGVGPKTI* |
Ga0126377_119417441 | 3300010362 | Tropical Forest Soil | TARIMIEDGAYFKGSIEIDKSAEKESTGSAFAKSSTPAAATAGPKSI* |
Ga0126379_109789871 | 3300010366 | Tropical Forest Soil | RIMIEDGAYFKGSIEIDKSEQKESGSNAFARSSAAPASAAAAKTI* |
Ga0126379_138359251 | 3300010366 | Tropical Forest Soil | SIEIDKSAEKESHGSAFAKSSNAPAAAAAGPKSI* |
Ga0126381_1002462604 | 3300010376 | Tropical Forest Soil | EDGAYFKGSIEIDKSGEKETGGSAFSKLSSAPATAAAGPKSI* |
Ga0126381_1011509921 | 3300010376 | Tropical Forest Soil | TARIMIEDGAYFKGSIEIDKSEQKDSSSQAFARSSAPVAATATKTI* |
Ga0126381_1015499831 | 3300010376 | Tropical Forest Soil | TARIMIEDGAYFKGSIEIDKAGEKESGAGSFTRAVSAPAAAGVGPKTI* |
Ga0126381_1032967691 | 3300010376 | Tropical Forest Soil | EDGAYFKGSIEIDKSGEKESGSGSFARSASVPAAAGVGPKTI* |
Ga0126381_1034915882 | 3300010376 | Tropical Forest Soil | IEDGAYFKGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI* |
Ga0126381_1036070992 | 3300010376 | Tropical Forest Soil | KGSIEIDKSGEKESGSGSFARSASAPAAAGVGPKTI* |
Ga0136449_1016745543 | 3300010379 | Peatlands Soil | ARIMIEDGAYFKGSIEIDKSAEKESGASAFARTAATPAAAGVGPKTI* |
Ga0134124_117085081 | 3300010397 | Terrestrial Soil | SIEIDKSAEKDSGGSAFAKSSSAPAAATAGPKSI* |
Ga0126383_119196183 | 3300010398 | Tropical Forest Soil | EDGAYFKGSIEIDKSEQKESGSQAFARSSAPVAATATKTI* |
Ga0126350_103964782 | 3300010880 | Boreal Forest Soil | GAYFKGSIEIDKSAEKDSGGSAFAKSSQSPATAKTI* |
Ga0150983_118721192 | 3300011120 | Forest Soil | MIEDGAYFKGSIEIDKTPEKESGGNAFARSSAPAGAAATKTI* |
Ga0137392_101163701 | 3300011269 | Vadose Zone Soil | SRIMIEDGAYFKGSIEIDKTPEKESGSNAFARTSSAPATASKTI* |
Ga0137392_111229041 | 3300011269 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKSPEKESGSNAFARTSSASTGAPASKTI* |
Ga0137392_111236701 | 3300011269 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKTPEKESGSNAFARSAAPAGATAAKTI* |
Ga0137392_112405352 | 3300011269 | Vadose Zone Soil | AYFKGSIEIDKSAEKETSSAFSKSANATAPATMGPKSI* |
Ga0137391_100416551 | 3300011270 | Vadose Zone Soil | IEDGAYFKGSIEIDKSAEKESGHSVFAKTSPAPGSTTAATKTI* |
Ga0137391_103202113 | 3300011270 | Vadose Zone Soil | DGAYFKGSIEIDKSAEKETSSAFSKSANATAPATTGPKSI* |
Ga0137391_114607511 | 3300011270 | Vadose Zone Soil | IEDGAYFKGSIEIDKSAEKETSSAFSKSANATAPATTGPKSI* |
Ga0137393_100834521 | 3300011271 | Vadose Zone Soil | YFKGSIEIDKTSEKESSRGSAFAKPATANAGAPAAKTI* |
Ga0137393_109999751 | 3300011271 | Vadose Zone Soil | TTSRIMIEDGAYFKGSIEIDKSPEKESGGNAFARTSSATSGAAAAKTI* |
Ga0137393_111347642 | 3300011271 | Vadose Zone Soil | IEDGAYFKGSIEIDKSEQKESGAGAFARASAAPAGAAKTI* |
Ga0137393_114225821 | 3300011271 | Vadose Zone Soil | IEDGAYFKGSIEIDKSAEKETSSAFSKSANATAPATMGPKSI* |
Ga0137389_104213452 | 3300012096 | Vadose Zone Soil | TTSRIMIEDGAYFKGSIEIDKSPEKESGGNAFARTSSAPAAATKTI* |
Ga0137389_113387261 | 3300012096 | Vadose Zone Soil | AYFKGSIEIDKSPEKESGSNAFARTSSASTGAPATKTI* |
Ga0137388_104091071 | 3300012189 | Vadose Zone Soil | DGAYFKGSIEIDKTPEKESGSNAFARSAAPAGAAASKTI* |
Ga0137388_112272311 | 3300012189 | Vadose Zone Soil | EDGAYFKGSIEIDKTPEKESGSNAFARTSSAPATASKTI* |
Ga0137388_115416332 | 3300012189 | Vadose Zone Soil | ARIMIEDGAYFKGSIEIDKGSEKESGTSAFARASSAPAGAAASKTI* |
Ga0137382_107730101 | 3300012200 | Vadose Zone Soil | MIEDGAYFKGSIEIDKSPEKESGGNAFARTSSAGAATTKTI* |
Ga0137363_103516011 | 3300012202 | Vadose Zone Soil | MIEDGAYFKGSIEIDKSAEKESSRSSAFAKPAIANAGAPAAKTI* |
Ga0137363_112503101 | 3300012202 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKSPEKDSGHAFARSSAAPAGAAATKTI* |
Ga0137399_106653661 | 3300012203 | Vadose Zone Soil | TSRIMIEDGAYFKGSIEIDKTPEKESGGNAFARSSAPAGAAATKTI* |
Ga0137399_109838821 | 3300012203 | Vadose Zone Soil | YFKGSIEIDKSPEKESGGNAFARTSSAQASAAATKTI* |
Ga0137399_110461941 | 3300012203 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKSAEKESSRGSAFAKPATSNAGAPAAKTI* |
Ga0137399_112280951 | 3300012203 | Vadose Zone Soil | TTARIMIEDGAYFKGSIEIDKSSEKESSSNAFARTTSATEGAATTKTI* |
Ga0137362_109297443 | 3300012205 | Vadose Zone Soil | IEDGAYFKGSIEIDKSSEKETTSAFSKSASAAPAATGPKSI* |
Ga0137362_117847271 | 3300012205 | Vadose Zone Soil | AYFKGSIEIDKSPEKESGGNAFARTSSAQAGAAATKTI* |
Ga0137380_101901311 | 3300012206 | Vadose Zone Soil | KGSIEIDKGSEKESGTSAFARASSAPAGAAASKTI* |
Ga0137376_112502782 | 3300012208 | Vadose Zone Soil | LTTSRIMIEDGAYFKGSIEIDKSPEKESGGNAFARTSSAGVSAPATKTI* |
Ga0137378_105952533 | 3300012210 | Vadose Zone Soil | EDGAYFKGSIEIDKGSEKESGTSAFARTSSAPAGAAASKTI* |
Ga0137377_108891361 | 3300012211 | Vadose Zone Soil | ITSRIMIEDGAYFKGAIEIDKTPEKESGGNAFARTSSASSGAPATKTI* |
Ga0137377_117869572 | 3300012211 | Vadose Zone Soil | EDGAYFKGSIEIDKGSEKESGTSAFARASSAPAGAAASKTI* |
Ga0137386_101062423 | 3300012351 | Vadose Zone Soil | TSRIMIEDGAYFKGSIEIDKSPEKESGGNAFARTSSASPGAPATKTI* |
Ga0137385_115776432 | 3300012359 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKSPEKESGSNAFARSSSSAAAPAAKTI* |
Ga0137360_105313561 | 3300012361 | Vadose Zone Soil | RIMIEDGAYFKGSIEIDKSAEKESSRGSAFAKPATSNAGAPAAKTI* |
Ga0137360_115845481 | 3300012361 | Vadose Zone Soil | TTSRIMIEDGAYFKGSIEIDKTPEKESGSNAFARSAAPAGVAATKTV* |
Ga0137390_111978142 | 3300012363 | Vadose Zone Soil | MIEDGAYFKGSIEIDKSAEKETSSAFSKSANATAPATMGPKSI* |
Ga0137390_113007583 | 3300012363 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKSAEKETSSAFSKSANATAPATTGPKSI* |
Ga0134059_13596892 | 3300012402 | Grasslands Soil | MIEDGAYFKGSIEIDRASEKESDKHAFARTASAPATGGGPKSL* |
Ga0137358_105783852 | 3300012582 | Vadose Zone Soil | EDGAYFKGSIEIDKSVEKESGSSAFSKSSAPAAATAGPKTI* |
Ga0137358_106032821 | 3300012582 | Vadose Zone Soil | KGSIEIDKTPEKESGGNAFARSSAPAGAAATKTI* |
Ga0137398_110406852 | 3300012683 | Vadose Zone Soil | IEDGAYFKGSIEIDKTPEKESGSNAFARTSSAPATASKTI* |
Ga0137395_104841401 | 3300012917 | Vadose Zone Soil | GSIEIDKSAEKETSSAFSKSANATAPATMGPKSI* |
Ga0137395_109074392 | 3300012917 | Vadose Zone Soil | SRIMIEDGAYFKGSIEIDKSPEKESGSNAFARSAAPAGATAAKTI* |
Ga0137396_103225583 | 3300012918 | Vadose Zone Soil | TTSRIMIEDGAYFKGSIEIDRAPEKETSAFARTSSAPSGAAAAKTI* |
Ga0137359_112856412 | 3300012923 | Vadose Zone Soil | YFKGSTEIDKGSEKESGPSAFARASSAPAGAAASKTI* |
Ga0137359_115774721 | 3300012923 | Vadose Zone Soil | TSRIMIEDGAYFKGSIEIDKSPEKESGSNAFARSSSSAAAPAAKTI* |
Ga0137413_117379761 | 3300012924 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKSPEKESGGNAFARNSSASAAATKTI* |
Ga0137419_119327221 | 3300012925 | Vadose Zone Soil | EDGAYFKGSIEIDKSAEKESRSSAFAKPATANAGAAKTI* |
Ga0137416_110584141 | 3300012927 | Vadose Zone Soil | GSIEIDKSGEKESGSSAFTRSASAPAGAGVGPKTI* |
Ga0137404_100426252 | 3300012929 | Vadose Zone Soil | SRIMIEDGAYFKGSIEIDKSPEKESGSHAFARNSSAPAGAAASKTI* |
Ga0137404_115032002 | 3300012929 | Vadose Zone Soil | MIEDGAYFKGSIEIDKSPEKESGSNAFARSSSSAAAPAAKTI* |
Ga0137404_119988642 | 3300012929 | Vadose Zone Soil | MIEDGAYFKSSIEIDKTPEKESGSNAFARTSSAPATASKTI* |
Ga0137407_104170113 | 3300012930 | Vadose Zone Soil | MIEDGAYFKGSIEIDKSAEKETGSAFSKSSNAAAPATTGPKSI* |
Ga0126375_107381862 | 3300012948 | Tropical Forest Soil | FKGSIEIDKSEQKESSSQAFARSSAPVAATATKTI* |
Ga0126375_113423982 | 3300012948 | Tropical Forest Soil | GAYFKGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI* |
Ga0126369_100288763 | 3300012971 | Tropical Forest Soil | TARIMIEDGAYFKGSIEIDKSEQKESSSQAFARSSAPVAATATKTI* |
Ga0126369_104307582 | 3300012971 | Tropical Forest Soil | YFKGSIEIDKSAEKESSSSAFSKPSAQPAATAGPKTI* |
Ga0126369_113170841 | 3300012971 | Tropical Forest Soil | KGSIEIDKAEQKESSGNHGFGRNSAVPAGVTATKSS* |
Ga0126369_124179402 | 3300012971 | Tropical Forest Soil | GAYFKGSIEIDKSSEKETGGSAFAKASSTPAAAAAGPKSI* |
Ga0126369_132450241 | 3300012971 | Tropical Forest Soil | IMIEDGAYFKGSIEIDKSAEKDSGSSAFSRSSSVPAPATAKTI* |
Ga0134110_101650302 | 3300012975 | Grasslands Soil | YFKGSIEIDKSPEKESGGNAFARTSSASSGAPATKTI* |
Ga0134110_102126492 | 3300012975 | Grasslands Soil | YFKGSIEIDKSPEKESGGNAFARTSSASSGTPATKTI* |
Ga0134087_102590372 | 3300012977 | Grasslands Soil | FKGSIEIDKTEQKESGSSHAFSRSSAVPAGVTATKTI* |
Ga0134087_106315961 | 3300012977 | Grasslands Soil | KGSIEIDKSPEKESGGNAFARTSSASSGAPATKTI* |
Ga0181532_101471252 | 3300014164 | Bog | ARIMIEDGAYFKGSIEIDKSAEKESGAGSFARTASTAGAGVGPKTI* |
Ga0181532_104707073 | 3300014164 | Bog | AYFKGSIEIDKSAEKESGAGSFARTASTAGAGVGPKTI* |
Ga0181523_100663801 | 3300014165 | Bog | DGAYFKGSIEIDKSGEKESGAGSFSRTSAPAAAAPKTI* |
Ga0134079_103136821 | 3300014166 | Grasslands Soil | MIEDGAYFKGSIEIDKSAEKESSSHAFARSSSVPAAATATKTI* |
Ga0157379_113551171 | 3300014968 | Switchgrass Rhizosphere | TARIMIEDGAYFKGSIEIDKSAEKDSGGSAFAKSSSAPAAAAAGPKSI* |
Ga0137405_12102722 | 3300015053 | Vadose Zone Soil | FKGSIEIDKSPEKESGSHAFARNSSAPAGAAATKTI* |
Ga0137420_12026875 | 3300015054 | Vadose Zone Soil | SRIMIEDGAYFKGSIEIDKSPEKESGGNAFARNSSASAAATKTI* |
Ga0137409_107698011 | 3300015245 | Vadose Zone Soil | IEDGAYFKGSIEIDKSAEKESRSSAFAKPATANAGAAKTI* |
Ga0137403_1000834913 | 3300015264 | Vadose Zone Soil | AYFKGSIEIDKSAEKETGSAFSKSSNAAAPATTGPKSI* |
Ga0132258_128885441 | 3300015371 | Arabidopsis Rhizosphere | EDGAYFKGSIEIDKSAEKDSGGSAFAKSSSAPAAATAGPKSI* |
Ga0182036_110748851 | 3300016270 | Soil | RIMIEDGAYFKGSIEIDKSGEKESGGSSFSRQSSSAAPAGVGPKTI |
Ga0182033_108436322 | 3300016319 | Soil | ARIMIEDGAYFKGSIEIDKTTEKESGSSSFGRSSQAATVGPKTI |
Ga0182034_117486921 | 3300016371 | Soil | KGSIEIDKSSEKETGGSAFAKVSSAPAAAAAGPKSI |
Ga0182037_100175881 | 3300016404 | Soil | IMIEDGAYFKGSIEIDKTSEKESGGSSFSRTVSAPAGAGVGPKTI |
Ga0182037_114636171 | 3300016404 | Soil | IMIEDGAYFKGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI |
Ga0187802_101266931 | 3300017822 | Freshwater Sediment | RIMIEDGAYFKGSIEIDKSAEKESGAGSFARTASTAGAGVGPKTI |
Ga0187802_103981241 | 3300017822 | Freshwater Sediment | DGAYFKGSIEIDKSSEKESGAGSFSRAPAAAAAGTTPKTI |
Ga0187818_101155431 | 3300017823 | Freshwater Sediment | FKGSIEIDKSAEKESGAGSFARASSAPAAAGASPKTI |
Ga0187825_102920891 | 3300017930 | Freshwater Sediment | TARIMIEDGAYFKGSIEIDKTEQKETGGNAFARASSAPAAAAKTI |
Ga0187803_101441462 | 3300017934 | Freshwater Sediment | TARISIEDGAYFKGSIEIDKSGEKESGAGSFARATAPAAAGAAPKTI |
Ga0187785_101953622 | 3300017947 | Tropical Peatland | FKGSIEIDKSGEKESGSSSFSRTSSNTATAGVGPKTI |
Ga0187817_110905331 | 3300017955 | Freshwater Sediment | GAYFKGSIEIDKAPEKESGSGAFARSSAPAGAAATKTI |
Ga0187781_1000555010 | 3300017972 | Tropical Peatland | YFKGSIEIDKTNEKESGGGSFARTSSSPATAGVGPKTI |
Ga0187816_105281841 | 3300017995 | Freshwater Sediment | TARIMIEDGAYFKGSIEIDKTAEKDSGHNAFAKGPAAPVATKTI |
Ga0187804_102390362 | 3300018006 | Freshwater Sediment | RIMIEDGAYFKGSIEIDKSAEKESGGGSFSRTASASPAGVGPKTI |
Ga0187810_104476051 | 3300018012 | Freshwater Sediment | TARIMIEDGAYFKGSIEIDKSAEKESGAGSFARAASPAGVGPKTI |
Ga0184633_102273151 | 3300018077 | Groundwater Sediment | EDGAYFKGSIEIDKTAEKSTDLERPSYVRAATATSVTPVGKTNS |
Ga0187772_109636021 | 3300018085 | Tropical Peatland | AYFKGSIEIDKTGEKDSGSGSFSRTPATAGVGPKTI |
Ga0187769_101598321 | 3300018086 | Tropical Peatland | TARIMIEDGAYFKGSIEIDKTNEKESGGGSFARTSSSPATAGVGPKTI |
Ga0187771_111379981 | 3300018088 | Tropical Peatland | MIEDGAYFKGSIEIDKSAEKETGAGSFARTAATPPAAAVGPKTI |
Ga0066667_103655371 | 3300018433 | Grasslands Soil | MIADGRYFKGSIEIDKSPEKESGGNAFARTSSAGAATTKTI |
Ga0066669_100885091 | 3300018482 | Grasslands Soil | MIEDGAYFKGSIEIDKSEQKESGSHAFARSSAAPAGAAATKTI |
Ga0193751_11930962 | 3300019888 | Soil | YFKGSIEIDKSAEKETSSAFSKSANATAPATMGPKSI |
Ga0179592_103389081 | 3300020199 | Vadose Zone Soil | GAYFKGSIEIDRTPEKETGSNAFARTSSAPSTAAAAKTI |
Ga0179592_104791011 | 3300020199 | Vadose Zone Soil | IMIEDGAYFKGSIEIDKSAEKESSRSSAFAKPAIANAGAPAAKTI |
Ga0210407_108275221 | 3300020579 | Soil | KGSIEIDKSAEKEPSGNAFARSSQASAGAAATKTI |
Ga0210407_110476791 | 3300020579 | Soil | TAQIMIEDGAYFKGSIEIDKSSEKDSAHNAFAKSSNAPVGAPAAKTI |
Ga0210403_106037871 | 3300020580 | Soil | MTARIVIEEGAYFKGSIEIDKSGEKESGARSISRTASVAAAG |
Ga0210399_102723902 | 3300020581 | Soil | MIEDGAYFKGSIEIDRSSEKEAGHNAFAKSSNAPVGAPATKTI |
Ga0210399_106936201 | 3300020581 | Soil | FKGSIEIDKSAEKESGSNAFARSSSANAGAPATKTI |
Ga0215015_100397442 | 3300021046 | Soil | GAYFKGSIEIDKSGEKESGSSSFSRSASAPAGAGVGPKTI |
Ga0210406_101097831 | 3300021168 | Soil | IEDGAYFKGSIEIDKSGEKESGSSVFSRSASAPAGAGVGPKTI |
Ga0210400_100864024 | 3300021170 | Soil | EDGAYFKGSIEIDKSPEKESGGNAFARTSSAQAGAAATKTI |
Ga0210400_106188572 | 3300021170 | Soil | TSRIMIEDGAYFKGSIEIDKSSEKESRGSAFAKPATANAGAPAAKTI |
Ga0210408_100010921 | 3300021178 | Soil | YFKGSIEIDKSAEKESGSNAFARSSSANAGAPATKTI |
Ga0210408_101191262 | 3300021178 | Soil | SIEDGAYFKGSIEIDKSAEKESSSAFAKSSSAAPATAKTI |
Ga0210393_103478561 | 3300021401 | Soil | KGSIEIDKSSEKDSAHNAFAKSSNASAGAPAAKTI |
Ga0210393_113110631 | 3300021401 | Soil | YFKGSIEIDKSSEKDTAHNAFAKSSNAPVGAPATKTI |
Ga0210386_108219692 | 3300021406 | Soil | FKGSIEIDKSGEKESGSSAFTRSASTPAGAGVGPKTI |
Ga0210391_101942264 | 3300021433 | Soil | TARIMIEDGAYFKGSIEIDKSAEKETGAGAFARTASPAGVGPKTI |
Ga0210390_109929993 | 3300021474 | Soil | AYFKGSIEIDKSSEKDSAHNAFAKSSSASVGAPAAKTI |
Ga0210402_100707381 | 3300021478 | Soil | YFKGSIEIDKSGEKESGSSAFSRSATAPAGAGVGPKTI |
Ga0210402_106555352 | 3300021478 | Soil | EDGAYFKGSIEIDKSSEKESGGNAFARSGATSNAPATKTI |
Ga0210402_108147463 | 3300021478 | Soil | MIEDGAYFKGSIEIDKSAEKESGAGSFARTAATPAGAGVGPKTI |
Ga0210409_100687731 | 3300021559 | Soil | DGAYFKGSIEIDKSSEKDSAHNAFAKSSNAPVGAPAAKTI |
Ga0210409_103449453 | 3300021559 | Soil | TTARISIEDGAYFKGSIEIDKSAEKETSSAFAKSSSAAPATAKTI |
Ga0210409_104095421 | 3300021559 | Soil | EDGAYFKGSIEIDKTAEKESRGSAFAKPATANAGAPAAKTI |
Ga0210409_106228662 | 3300021559 | Soil | TTARIMIEDGAYFKGSIEIDKSAEKESGGNAFARTSSASAGTPATKTI |
Ga0210409_116157582 | 3300021559 | Soil | IMIEDGAYFKGSIEIDKTAEKESRGSAFAKPATANAGAPAAKTI |
Ga0126371_123866322 | 3300021560 | Tropical Forest Soil | GAYFKGSIEIDKSEQKESSSSQAFARSSSAPVPAGATKAI |
Ga0126371_138907742 | 3300021560 | Tropical Forest Soil | RIMIEDGAYFKGSIEIDKSAEKESSSGNAFSRTPATAGAPATKTI |
Ga0242642_10901872 | 3300022504 | Soil | MIEDGAYFKGSIEIDKSGEKESSSSAFSRSASAPAAAGVGPKTI |
Ga0242664_11261372 | 3300022527 | Soil | LIEDGAYFKGSIEIDRTPEKETGSNAFARTSSTPSTAAAAKTI |
Ga0247679_10154192 | 3300024251 | Soil | TTARISIEDGAYFKGSIEIDKSAEKESHGSAFSKPSSQAAATAGPKTI |
Ga0209171_100053961 | 3300025320 | Iron-Sulfur Acid Spring | CAYFKGSIEIDKTAEKESRSSAFAKPATANAGAPAAKTI |
Ga0209238_12199991 | 3300026301 | Grasslands Soil | RIMIEDGAYFKGSIEIDKNPEKESGSNAFARSSSHAAAPAAKTI |
Ga0209158_11210242 | 3300026333 | Soil | DGAYFKGSIEIDKNPEKESGSNAFARSSSHAAAPAGKTI |
Ga0257146_10390771 | 3300026374 | Soil | EDGAYFKGSIEIDKSDETESGAGSFARSASALAAAGVGLKKI |
Ga0209808_10396291 | 3300026523 | Soil | MIEDGAYFKGSIEIDKSAEKESSSHAFTRSSSVPAATATKTI |
Ga0209378_12850211 | 3300026528 | Soil | FKGSIEIDKNPEKESGSNAFARSSSHAAAPAGKTI |
Ga0179587_105102091 | 3300026557 | Vadose Zone Soil | GAYFKGSIEIDKTPEKESGSNAFARSAAPAGVAATKTI |
Ga0209076_10991462 | 3300027643 | Vadose Zone Soil | YFKGSIEIDKSGEKESGSNSSSVFSRSASAPAGVGPKTI |
Ga0208990_11034171 | 3300027663 | Forest Soil | SEDGAYFKGSIEIDKSAEKESRSSAFAKPATANAGAAKTI |
Ga0209689_10137257 | 3300027748 | Soil | LTTSRIMIEDGAYFKGSIEIDKSPEKESGSNAFARSSSHAAAPAAKTI |
Ga0209689_12802572 | 3300027748 | Soil | RIMIEDGAYFKGSIEIDKNPEKESGSNAFARSSSHAAAPAGKTI |
Ga0209580_102230482 | 3300027842 | Surface Soil | IMIEDGAYFKGSIEIDKSEQKEAGSQAFARSSAPAAATASKTI |
Ga0209166_103155362 | 3300027857 | Surface Soil | DGAYFKGSIEIDKSAEKESGGSAFSKPSAQAAATAGPKTI |
Ga0209283_105103561 | 3300027875 | Vadose Zone Soil | RIMIEDGAYFKGSIEIDKSPEKESGSNAFARTSSASTGAPASKTI |
Ga0209488_101438871 | 3300027903 | Vadose Zone Soil | YFKGSIEIDKTPEKESGSNAFARSAAPAGAAATKTI |
Ga0209488_105281732 | 3300027903 | Vadose Zone Soil | GAYFKGSIEIDKTAEKESSRNAFAKPAIANAGAPAAKTI |
Ga0209488_111081661 | 3300027903 | Vadose Zone Soil | IEDGAYFKGSIEIDKSAEKESRSSAFAKPATANAGAAKTI |
Ga0209698_100297411 | 3300027911 | Watersheds | GSIEIDKSGEKESGGGSFSRTASTPAAAGVGPKTI |
Ga0209698_104079981 | 3300027911 | Watersheds | YFKGSIEIDKTPEKESGSSAFARSASSANVAATKTI |
Ga0209062_11869221 | 3300027965 | Surface Soil | FKGSIEIDKSAEKEHGSSAFSKPAPAAATAGPKTI |
Ga0137415_107045902 | 3300028536 | Vadose Zone Soil | GSIEIDKSGEKESGSSAFTRSASAPAGAGVGPKTI |
Ga0137415_109347041 | 3300028536 | Vadose Zone Soil | YFKGSIEIDKSPEKESGSNAFARSSSSAAAPAAKTI |
Ga0137415_110484232 | 3300028536 | Vadose Zone Soil | GAYFKGSIEIDKNPEKESGSNAFARTSSASAGAPAAKTI |
Ga0222749_101021751 | 3300029636 | Soil | AYFKGSIEIDKTPEKESGGNAFARSSAPAGAAATKTI |
Ga0316363_101134541 | 3300030659 | Peatlands Soil | AYFKGSIEIDKSGEKESGAGSFSRTSATAAAGTAPKTI |
Ga0310038_103505502 | 3300030707 | Peatlands Soil | RIMIEDGAYFKGSIEIDKSGEKESGAGSFARAAAPAAAGTAPKTI |
Ga0170823_155633814 | 3300031128 | Forest Soil | KGSIEIDKSAEKESGAASFARTASTPAAAGVGPKTI |
Ga0318538_100436904 | 3300031546 | Soil | IMIEDGAYFKGSIEIDKTEQKESGSNAFSRSSAVPAGVTATKTI |
Ga0318538_105753031 | 3300031546 | Soil | FKGSIEIDKSSEKETGGSAFAKVSSAPAAAAAGPKSI |
Ga0307483_10148112 | 3300031590 | Hardwood Forest Soil | MFEDGAYFKGSIEIDKSPEKESGSNAFARSAAPAGAAASKTI |
Ga0318542_103243941 | 3300031668 | Soil | EDGAYFKGSIEIDKTSEKESGGSSFSRTVSAPAGAGVGPKTI |
Ga0310686_1183785512 | 3300031708 | Soil | EDGAYFKGSIEIDKSSEKESSSNAFARSSSAAAGAPATKTI |
Ga0307474_113566561 | 3300031718 | Hardwood Forest Soil | TARIMIEDGAYFKGSIEIDKSAEKESGAGSFARTASTPAGAGVGPKTI |
Ga0306918_105686641 | 3300031744 | Soil | TARIMIEDGAYFKGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI |
Ga0306918_109822521 | 3300031744 | Soil | IEDGAYFKGSIEIDKSGEKETSGSAFAKLSSAPAAATAGPKSI |
Ga0307475_105816801 | 3300031754 | Hardwood Forest Soil | EDGAYFKGSIEIDKSAEKETSSAFAKSANATAPAATGPKSI |
Ga0307475_111824491 | 3300031754 | Hardwood Forest Soil | IMIEDGAYFKGSIEIDKSAEKESSRGSAFAKPATANAGAPAAKTI |
Ga0307473_104296882 | 3300031820 | Hardwood Forest Soil | YFKGSIEIDKTGEKESGAGAFSRTASAQAAAGVGPKTI |
Ga0306923_106127642 | 3300031910 | Soil | KGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI |
Ga0310916_109356771 | 3300031942 | Soil | YFKGSIEIDKTSEKESGSSSFSRSVSAPAGAGVGPKTI |
Ga0310916_112132992 | 3300031942 | Soil | EDGAYFKGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI |
Ga0310913_100737211 | 3300031945 | Soil | FKGSIEIDKSSEKETSGSAFAKASAPATATASPKSI |
Ga0310910_108239702 | 3300031946 | Soil | GAYFKGSIEIDKTSEKESGGSSFSRSAAAPATAGVGPKTI |
Ga0310910_112526412 | 3300031946 | Soil | IMIEDGAYFKGSIEIDKTSEKESGGSSFSRSAMAPAGAGVGPKTI |
Ga0310909_112269502 | 3300031947 | Soil | KGSIEIDKTSEKESGGSSFSRSAAAPATAGVGPKTI |
Ga0318530_101855652 | 3300031959 | Soil | MIEDGAYFKGSIEIDKSAEKESTGSAFAKSSAPAAATAGPKSI |
Ga0307479_105192461 | 3300031962 | Hardwood Forest Soil | IEDGAYFKGSIEIDKTPEKEAGSHAFARSSAAPAGASATKTI |
Ga0307479_114552401 | 3300031962 | Hardwood Forest Soil | GAYFKGSIEIDKTPEKESGGNAFSRSSAPAGAAATKTI |
Ga0318575_104312902 | 3300032055 | Soil | FKGSIEIDKTEQKESGSNAFSRSSAVPAGVTATKTI |
Ga0306924_109528122 | 3300032076 | Soil | RIMIEDGAYFKGSIEIDKTSEKESGGSSFSRSAVAPAGAGVGPKTI |
Ga0307470_108968811 | 3300032174 | Hardwood Forest Soil | AYFKGSIEIDKTAEKESRGSAFAKPATANAGAPAAKTI |
Ga0307471_1009289491 | 3300032180 | Hardwood Forest Soil | IMIEDGAYFKGSIEIDKSSEKDSGHNAFAKSSTASVGAPAAKTI |
Ga0306920_1038380271 | 3300032261 | Soil | GAYFKGSIEIDKSAEKEPSGNQAFARNSSAPATATATKTI |
Ga0335085_101908511 | 3300032770 | Soil | EDGAYFKGSIEIDKSGEKESGSSSFARSASAPAAAGVGPKTI |
Ga0335085_107244271 | 3300032770 | Soil | TARISIEDGAYFKGSIEIDKSAEKESGSSAFSKSSSTAAATAGPKTI |
Ga0335080_108534911 | 3300032828 | Soil | DGAYFKGSIEIDKSGEKESGGGSFAKTSSSTATAGVGPKTI |
Ga0335077_103920982 | 3300033158 | Soil | RIMIEDGAYFKGSIEIDKSAEKESGAGSFARTASAPAGAGVGPKTI |
Ga0326726_117804802 | 3300033433 | Peat Soil | RIMIEDGAYFKGSIEIDKSGEKESGAGSFSRTSATAAAGAGPKTI |
⦗Top⦘ |