Basic Information | |
---|---|
Family ID | F012956 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 275 |
Average Sequence Length | 44 residues |
Representative Sequence | MSRRIRFALALVLVSFALTASACADASGPSGVCDNNNPVTCH |
Number of Associated Samples | 181 |
Number of Associated Scaffolds | 275 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 70.55 % |
% of genes near scaffold ends (potentially truncated) | 36.00 % |
% of genes from short scaffolds (< 2000 bps) | 60.36 % |
Associated GOLD sequencing projects | 163 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.091 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (30.182 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.909 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 275 Family Scaffolds |
---|---|---|
PF12833 | HTH_18 | 11.64 |
PF00072 | Response_reg | 6.91 |
PF13424 | TPR_12 | 6.55 |
PF07963 | N_methyl | 5.82 |
PF02621 | VitK2_biosynth | 3.27 |
PF01966 | HD | 3.27 |
PF04011 | LemA | 2.91 |
PF13411 | MerR_1 | 2.55 |
PF07721 | TPR_4 | 1.45 |
PF01553 | Acyltransferase | 1.09 |
PF10688 | Imp-YgjV | 0.73 |
PF00440 | TetR_N | 0.73 |
PF01435 | Peptidase_M48 | 0.73 |
PF13860 | FlgD_ig | 0.73 |
PF13374 | TPR_10 | 0.73 |
PF00903 | Glyoxalase | 0.36 |
PF13633 | Obsolete Pfam Family | 0.36 |
PF07719 | TPR_2 | 0.36 |
PF13487 | HD_5 | 0.36 |
PF13544 | Obsolete Pfam Family | 0.36 |
PF12019 | GspH | 0.36 |
COG ID | Name | Functional Category | % Frequency in 275 Family Scaffolds |
---|---|---|---|
COG1427 | Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway) | Coenzyme transport and metabolism [H] | 3.27 |
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 2.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.09 % |
Unclassified | root | N/A | 2.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000881|JGI10215J12807_1024101 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
3300001661|JGI12053J15887_10581621 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300002558|JGI25385J37094_10001665 | All Organisms → cellular organisms → Bacteria | 7164 | Open in IMG/M |
3300002560|JGI25383J37093_10020654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2206 | Open in IMG/M |
3300002561|JGI25384J37096_10076475 | Not Available | 1218 | Open in IMG/M |
3300002568|C688J35102_118424255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
3300002907|JGI25613J43889_10058575 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300002907|JGI25613J43889_10060917 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300003319|soilL2_10087967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6381 | Open in IMG/M |
3300003999|Ga0055469_10232442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
3300004062|Ga0055500_10000558 | All Organisms → cellular organisms → Bacteria | 3959 | Open in IMG/M |
3300004114|Ga0062593_100025248 | All Organisms → cellular organisms → Bacteria | 3255 | Open in IMG/M |
3300004463|Ga0063356_100020307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6200 | Open in IMG/M |
3300004801|Ga0058860_12045962 | Not Available | 899 | Open in IMG/M |
3300005166|Ga0066674_10001203 | All Organisms → cellular organisms → Bacteria | 8952 | Open in IMG/M |
3300005166|Ga0066674_10047724 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
3300005171|Ga0066677_10429111 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 756 | Open in IMG/M |
3300005172|Ga0066683_10005313 | All Organisms → cellular organisms → Bacteria | 6218 | Open in IMG/M |
3300005180|Ga0066685_10299098 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300005186|Ga0066676_10051906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2335 | Open in IMG/M |
3300005186|Ga0066676_10212007 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300005336|Ga0070680_100008338 | All Organisms → cellular organisms → Bacteria | 7930 | Open in IMG/M |
3300005341|Ga0070691_10045990 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
3300005406|Ga0070703_10000573 | All Organisms → cellular organisms → Bacteria | 13326 | Open in IMG/M |
3300005438|Ga0070701_10172241 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300005440|Ga0070705_100003362 | All Organisms → cellular organisms → Bacteria | 7855 | Open in IMG/M |
3300005440|Ga0070705_101226179 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300005441|Ga0070700_100453522 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300005445|Ga0070708_100017743 | All Organisms → cellular organisms → Bacteria | 5943 | Open in IMG/M |
3300005445|Ga0070708_100538243 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300005445|Ga0070708_101690124 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005446|Ga0066686_10023218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3516 | Open in IMG/M |
3300005446|Ga0066686_11045920 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005447|Ga0066689_10762190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 603 | Open in IMG/M |
3300005450|Ga0066682_10004840 | All Organisms → cellular organisms → Bacteria | 6406 | Open in IMG/M |
3300005468|Ga0070707_100758503 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300005471|Ga0070698_100065492 | All Organisms → cellular organisms → Bacteria | 3659 | Open in IMG/M |
3300005526|Ga0073909_10409218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 640 | Open in IMG/M |
3300005536|Ga0070697_100192277 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
3300005536|Ga0070697_100347051 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300005536|Ga0070697_100808894 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300005545|Ga0070695_100018953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4184 | Open in IMG/M |
3300005547|Ga0070693_101230203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
3300005555|Ga0066692_10043683 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
3300005556|Ga0066707_10006744 | All Organisms → cellular organisms → Bacteria | 5318 | Open in IMG/M |
3300005556|Ga0066707_10014608 | All Organisms → cellular organisms → Bacteria | 4000 | Open in IMG/M |
3300005556|Ga0066707_10207497 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
3300005557|Ga0066704_10435281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 868 | Open in IMG/M |
3300005558|Ga0066698_10282527 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300005558|Ga0066698_10488888 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300005561|Ga0066699_10899627 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005569|Ga0066705_10027480 | All Organisms → cellular organisms → Bacteria | 3022 | Open in IMG/M |
3300005574|Ga0066694_10584593 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005576|Ga0066708_10004995 | All Organisms → cellular organisms → Bacteria | 5643 | Open in IMG/M |
3300005598|Ga0066706_10036902 | All Organisms → cellular organisms → Bacteria | 3186 | Open in IMG/M |
3300005598|Ga0066706_10364662 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300005615|Ga0070702_101103722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
3300006046|Ga0066652_100687636 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300006046|Ga0066652_100940816 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 823 | Open in IMG/M |
3300006046|Ga0066652_100961364 | Not Available | 812 | Open in IMG/M |
3300006046|Ga0066652_101035121 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300006797|Ga0066659_10192246 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
3300006797|Ga0066659_10647946 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300006806|Ga0079220_10295344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 998 | Open in IMG/M |
3300006844|Ga0075428_100015014 | All Organisms → cellular organisms → Bacteria | 8604 | Open in IMG/M |
3300006844|Ga0075428_100789253 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1010 | Open in IMG/M |
3300006844|Ga0075428_102585385 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300006845|Ga0075421_100081688 | All Organisms → cellular organisms → Bacteria | 4076 | Open in IMG/M |
3300006845|Ga0075421_100784545 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300006845|Ga0075421_101336498 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300006847|Ga0075431_101107310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 756 | Open in IMG/M |
3300006847|Ga0075431_101973597 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300006852|Ga0075433_10012382 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6888 | Open in IMG/M |
3300006852|Ga0075433_10613849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 954 | Open in IMG/M |
3300006854|Ga0075425_100112363 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
3300006854|Ga0075425_103003304 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
3300006903|Ga0075426_10047949 | All Organisms → cellular organisms → Bacteria | 3054 | Open in IMG/M |
3300006903|Ga0075426_11172265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
3300006904|Ga0075424_100540349 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300006914|Ga0075436_100049552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2898 | Open in IMG/M |
3300006914|Ga0075436_100886454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
3300007004|Ga0079218_10476989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1094 | Open in IMG/M |
3300007255|Ga0099791_10185925 | Not Available | 977 | Open in IMG/M |
3300007255|Ga0099791_10203011 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300007258|Ga0099793_10020142 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
3300007258|Ga0099793_10064340 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
3300007258|Ga0099793_10273566 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300007258|Ga0099793_10565367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 568 | Open in IMG/M |
3300007788|Ga0099795_10355194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 656 | Open in IMG/M |
3300009012|Ga0066710_100221692 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
3300009012|Ga0066710_100319516 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
3300009012|Ga0066710_100480920 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
3300009012|Ga0066710_101348987 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300009012|Ga0066710_101349794 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300009012|Ga0066710_102238994 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 797 | Open in IMG/M |
3300009094|Ga0111539_10812018 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300009137|Ga0066709_100160759 | All Organisms → cellular organisms → Bacteria | 2890 | Open in IMG/M |
3300009137|Ga0066709_100395089 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1916 | Open in IMG/M |
3300009162|Ga0075423_10031711 | All Organisms → cellular organisms → Bacteria | 5355 | Open in IMG/M |
3300009609|Ga0105347_1064581 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300009678|Ga0105252_10008654 | All Organisms → cellular organisms → Bacteria | 3645 | Open in IMG/M |
3300009813|Ga0105057_1062923 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300010142|Ga0127483_1204341 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 524 | Open in IMG/M |
3300010320|Ga0134109_10166195 | Not Available | 801 | Open in IMG/M |
3300010329|Ga0134111_10276919 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 694 | Open in IMG/M |
3300010333|Ga0134080_10012878 | All Organisms → cellular organisms → Bacteria | 3006 | Open in IMG/M |
3300010333|Ga0134080_10349979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 673 | Open in IMG/M |
3300010333|Ga0134080_10589269 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300011269|Ga0137392_10356969 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300011270|Ga0137391_10196981 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
3300011412|Ga0137424_1121001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
3300011429|Ga0137455_1023133 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
3300011437|Ga0137429_1088722 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300011441|Ga0137452_1011654 | All Organisms → cellular organisms → Bacteria | 2678 | Open in IMG/M |
3300012172|Ga0137320_1087221 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300012198|Ga0137364_10013347 | All Organisms → cellular organisms → Bacteria | 4799 | Open in IMG/M |
3300012198|Ga0137364_10188207 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300012199|Ga0137383_10001328 | All Organisms → cellular organisms → Bacteria | 14558 | Open in IMG/M |
3300012199|Ga0137383_10239016 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300012200|Ga0137382_10032004 | All Organisms → cellular organisms → Bacteria | 3152 | Open in IMG/M |
3300012200|Ga0137382_10052745 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
3300012200|Ga0137382_10160907 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300012201|Ga0137365_10070900 | All Organisms → cellular organisms → Bacteria | 2629 | Open in IMG/M |
3300012201|Ga0137365_10245592 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300012202|Ga0137363_10522592 | Not Available | 998 | Open in IMG/M |
3300012203|Ga0137399_10057344 | All Organisms → cellular organisms → Bacteria | 2860 | Open in IMG/M |
3300012203|Ga0137399_10227833 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
3300012203|Ga0137399_10239799 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1484 | Open in IMG/M |
3300012203|Ga0137399_10247839 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300012204|Ga0137374_10024608 | All Organisms → cellular organisms → Bacteria | 6730 | Open in IMG/M |
3300012206|Ga0137380_10019399 | All Organisms → cellular organisms → Bacteria | 6243 | Open in IMG/M |
3300012206|Ga0137380_10315140 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300012207|Ga0137381_10074575 | All Organisms → cellular organisms → Bacteria | 2841 | Open in IMG/M |
3300012208|Ga0137376_10034653 | All Organisms → cellular organisms → Bacteria | 4038 | Open in IMG/M |
3300012208|Ga0137376_10187937 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
3300012208|Ga0137376_10435707 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300012208|Ga0137376_10464569 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300012208|Ga0137376_10854375 | Not Available | 782 | Open in IMG/M |
3300012209|Ga0137379_10113954 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
3300012209|Ga0137379_10121499 | All Organisms → cellular organisms → Bacteria | 2512 | Open in IMG/M |
3300012211|Ga0137377_10160044 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
3300012212|Ga0150985_104812175 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
3300012231|Ga0137465_1000223 | All Organisms → cellular organisms → Bacteria | 37116 | Open in IMG/M |
3300012349|Ga0137387_10158068 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
3300012349|Ga0137387_11138781 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300012353|Ga0137367_10013816 | All Organisms → cellular organisms → Bacteria | 6416 | Open in IMG/M |
3300012357|Ga0137384_10298835 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300012359|Ga0137385_11019888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 682 | Open in IMG/M |
3300012360|Ga0137375_10094778 | All Organisms → cellular organisms → Bacteria | 3062 | Open in IMG/M |
3300012360|Ga0137375_10146466 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2315 | Open in IMG/M |
3300012360|Ga0137375_10473701 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1073 | Open in IMG/M |
3300012361|Ga0137360_10854635 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300012362|Ga0137361_10070967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2950 | Open in IMG/M |
3300012362|Ga0137361_10728391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 905 | Open in IMG/M |
3300012379|Ga0134058_1235230 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300012386|Ga0134046_1058842 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300012395|Ga0134044_1197078 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300012399|Ga0134061_1278781 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
3300012683|Ga0137398_10824422 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012685|Ga0137397_10075449 | All Organisms → cellular organisms → Bacteria | 2445 | Open in IMG/M |
3300012918|Ga0137396_10010608 | All Organisms → cellular organisms → Bacteria | 5626 | Open in IMG/M |
3300012918|Ga0137396_10088656 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
3300012918|Ga0137396_10181306 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
3300012922|Ga0137394_10022572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5058 | Open in IMG/M |
3300012922|Ga0137394_10031124 | All Organisms → cellular organisms → Bacteria | 4333 | Open in IMG/M |
3300012922|Ga0137394_10129168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2143 | Open in IMG/M |
3300012925|Ga0137419_10311594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1207 | Open in IMG/M |
3300012925|Ga0137419_10591785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
3300012925|Ga0137419_11502092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
3300012927|Ga0137416_10028943 | All Organisms → cellular organisms → Bacteria | 3665 | Open in IMG/M |
3300012929|Ga0137404_11456534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
3300012929|Ga0137404_11508136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
3300012930|Ga0137407_10435369 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300012944|Ga0137410_10079883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2389 | Open in IMG/M |
3300012944|Ga0137410_10334864 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1206 | Open in IMG/M |
3300014154|Ga0134075_10283580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 719 | Open in IMG/M |
3300014166|Ga0134079_10000187 | All Organisms → cellular organisms → Bacteria | 15588 | Open in IMG/M |
3300014872|Ga0180087_1002184 | All Organisms → cellular organisms → Bacteria | 3080 | Open in IMG/M |
3300014880|Ga0180082_1164332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
3300015241|Ga0137418_10040686 | All Organisms → cellular organisms → Bacteria | 4287 | Open in IMG/M |
3300015241|Ga0137418_10110940 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
3300015241|Ga0137418_10324152 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
3300015241|Ga0137418_10327521 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300015241|Ga0137418_10363926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1190 | Open in IMG/M |
3300015245|Ga0137409_10080740 | All Organisms → cellular organisms → Bacteria | 3037 | Open in IMG/M |
3300015245|Ga0137409_10396505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1195 | Open in IMG/M |
3300015245|Ga0137409_10410595 | Not Available | 1170 | Open in IMG/M |
3300015256|Ga0180073_1085810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 672 | Open in IMG/M |
3300015264|Ga0137403_11114523 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
3300015359|Ga0134085_10078193 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300017654|Ga0134069_1059938 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300017997|Ga0184610_1002959 | All Organisms → cellular organisms → Bacteria | 3871 | Open in IMG/M |
3300018027|Ga0184605_10341067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 677 | Open in IMG/M |
3300018028|Ga0184608_10001436 | All Organisms → cellular organisms → Bacteria | 6949 | Open in IMG/M |
3300018031|Ga0184634_10087071 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300018052|Ga0184638_1010813 | All Organisms → cellular organisms → Bacteria | 3084 | Open in IMG/M |
3300018433|Ga0066667_10021333 | All Organisms → cellular organisms → Bacteria | 3453 | Open in IMG/M |
3300018433|Ga0066667_10096302 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
3300018433|Ga0066667_10174281 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300018468|Ga0066662_10140598 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1805 | Open in IMG/M |
3300018468|Ga0066662_10568556 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300019228|Ga0180119_1057152 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300019238|Ga0180112_1119494 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300019255|Ga0184643_1189247 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
3300019259|Ga0184646_1245441 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300019259|Ga0184646_1247808 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
3300019259|Ga0184646_1495735 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300019879|Ga0193723_1003542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5532 | Open in IMG/M |
3300019879|Ga0193723_1009353 | All Organisms → cellular organisms → Bacteria | 3173 | Open in IMG/M |
3300019879|Ga0193723_1034022 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300019879|Ga0193723_1034895 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1507 | Open in IMG/M |
3300019880|Ga0193712_1133439 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300019882|Ga0193713_1003222 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5284 | Open in IMG/M |
3300019883|Ga0193725_1000222 | All Organisms → cellular organisms → Bacteria | 18169 | Open in IMG/M |
3300019883|Ga0193725_1052036 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1044 | Open in IMG/M |
3300019997|Ga0193711_1009424 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300020003|Ga0193739_1000787 | All Organisms → cellular organisms → Bacteria | 8883 | Open in IMG/M |
3300020004|Ga0193755_1001663 | All Organisms → cellular organisms → Bacteria | 6853 | Open in IMG/M |
3300021073|Ga0210378_10018328 | All Organisms → cellular organisms → Bacteria | 2846 | Open in IMG/M |
3300021073|Ga0210378_10043376 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1778 | Open in IMG/M |
3300021080|Ga0210382_10065300 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
3300021086|Ga0179596_10723328 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300021307|Ga0179585_1032083 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 597 | Open in IMG/M |
3300022195|Ga0222625_1664984 | All Organisms → cellular organisms → Bacteria | 2999 | Open in IMG/M |
3300024330|Ga0137417_1263166 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300025885|Ga0207653_10000040 | All Organisms → cellular organisms → Bacteria | 97615 | Open in IMG/M |
3300025917|Ga0207660_10008416 | All Organisms → cellular organisms → Bacteria | 6674 | Open in IMG/M |
3300025917|Ga0207660_10082511 | All Organisms → cellular organisms → Bacteria | 2365 | Open in IMG/M |
3300025922|Ga0207646_10221419 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
3300026075|Ga0207708_10055385 | All Organisms → cellular organisms → Bacteria | 3023 | Open in IMG/M |
3300026285|Ga0209438_1023440 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
3300026296|Ga0209235_1023995 | All Organisms → cellular organisms → Bacteria | 3227 | Open in IMG/M |
3300026296|Ga0209235_1058740 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
3300026297|Ga0209237_1027276 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
3300026297|Ga0209237_1145491 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 934 | Open in IMG/M |
3300026297|Ga0209237_1257527 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300026306|Ga0209468_1001422 | All Organisms → cellular organisms → Bacteria | 10590 | Open in IMG/M |
3300026306|Ga0209468_1012888 | All Organisms → cellular organisms → Bacteria | 3083 | Open in IMG/M |
3300026320|Ga0209131_1002812 | All Organisms → cellular organisms → Bacteria | 11693 | Open in IMG/M |
3300026323|Ga0209472_1027990 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
3300026324|Ga0209470_1023145 | All Organisms → cellular organisms → Bacteria | 3312 | Open in IMG/M |
3300026325|Ga0209152_10015314 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
3300026327|Ga0209266_1006091 | All Organisms → cellular organisms → Bacteria | 7212 | Open in IMG/M |
3300026528|Ga0209378_1107749 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300026536|Ga0209058_1148749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1104 | Open in IMG/M |
3300027573|Ga0208454_1002121 | All Organisms → cellular organisms → Bacteria | 7010 | Open in IMG/M |
3300027573|Ga0208454_1003103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5321 | Open in IMG/M |
3300027671|Ga0209588_1000569 | All Organisms → cellular organisms → Bacteria | 9478 | Open in IMG/M |
3300027765|Ga0209073_10006445 | All Organisms → cellular organisms → Bacteria | 2962 | Open in IMG/M |
3300027903|Ga0209488_10044154 | All Organisms → cellular organisms → Bacteria | 3273 | Open in IMG/M |
3300027903|Ga0209488_10049313 | All Organisms → cellular organisms → Bacteria | 3095 | Open in IMG/M |
3300027909|Ga0209382_10441299 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300028138|Ga0247684_1057111 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300028536|Ga0137415_10003842 | All Organisms → cellular organisms → Bacteria | 14898 | Open in IMG/M |
3300028536|Ga0137415_10006745 | All Organisms → cellular organisms → Bacteria | 11390 | Open in IMG/M |
3300028536|Ga0137415_10090175 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
3300028536|Ga0137415_10202304 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
3300028536|Ga0137415_10410538 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300028828|Ga0307312_10043430 | All Organisms → cellular organisms → Bacteria | 2663 | Open in IMG/M |
3300030939|Ga0138303_1254353 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300030993|Ga0308190_1138225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 569 | Open in IMG/M |
3300031015|Ga0138298_1026460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1244 | Open in IMG/M |
3300031094|Ga0308199_1169633 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
3300031199|Ga0307495_10061102 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300031199|Ga0307495_10110450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
3300031226|Ga0307497_10011836 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
3300031231|Ga0170824_116319017 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 882 | Open in IMG/M |
3300031421|Ga0308194_10006051 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
3300031421|Ga0308194_10020210 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300031421|Ga0308194_10073748 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 928 | Open in IMG/M |
3300031424|Ga0308179_1060697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
3300031720|Ga0307469_10010204 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4548 | Open in IMG/M |
3300031820|Ga0307473_10063401 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300033412|Ga0310810_10523564 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300034661|Ga0314782_082238 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 30.18% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.27% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.27% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.09% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.73% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.64% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.09% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.09% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.73% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.73% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.73% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.36% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.36% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.36% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.36% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.36% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.36% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.36% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10215J12807_10241012 | 3300000881 | Soil | MSRKIRSLLALFVVAFALTAAACADASGPSETTCDNNNPVTCK* |
JGI12053J15887_105816212 | 3300001661 | Forest Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDQNNPVTC |
JGI25385J37094_100016654 | 3300002558 | Grasslands Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGTCDQNNPNVCH* |
JGI25383J37093_100206541 | 3300002560 | Grasslands Soil | MSRQIRTLLALFLVSFALTAAACADASGPVSGTCDQSNPNVCH* |
JGI25384J37096_100764751 | 3300002561 | Grasslands Soil | MSRRIRFALALVLVSFALTASACADTTAPTRGVCDQSNPNTCH* |
C688J35102_1184242551 | 3300002568 | Soil | MTRRIRCALALLLVSFALSAAACADASGPSSATCDQNIL* |
JGI25613J43889_100585752 | 3300002907 | Grasslands Soil | MSRQIRTLVALLLVSFALSAAACADASGPTSNACDVNNPVTCH* |
JGI25613J43889_100609172 | 3300002907 | Grasslands Soil | MSRRIRTLVALVLVSFALSAAACADASGPSSNVCDNSNPV |
soilL2_100879676 | 3300003319 | Sugarcane Root And Bulk Soil | GVTKSPSNPTVEAIMSRKIRSVFALLLVSFALSAAACADASGPNETTCDNNNPATCK* |
Ga0055469_102324421 | 3300003999 | Natural And Restored Wetlands | MTRRIRFLLSLVLVSFALTAAACADASGPSAETTCDNNNPITCK* |
Ga0055500_100005583 | 3300004062 | Natural And Restored Wetlands | MARRIRFALVLFLVSVALSAAACADASGPSEAACDQSNPVTCK* |
Ga0062593_1000252484 | 3300004114 | Soil | MSRQIRSLLALFLVSFALTAAACADASGPNDTTCDSSNPATCH* |
Ga0063356_1000203075 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSRKIRSLLALLLVSFALTAAACADASGPNDTTCDTSNPATCK* |
Ga0058860_120459622 | 3300004801 | Host-Associated | MSRQIRSLLALLLVSFALTAAACADASGPNDTTCDTNNPATCK* |
Ga0066674_100012032 | 3300005166 | Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDNSNPVTCH* |
Ga0066674_100477241 | 3300005166 | Soil | MSRRIRTLVALFLVSFALTAGACADASGPTNNVCDQSNPNTCH* |
Ga0066677_104291112 | 3300005171 | Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDHNNPVTCH* |
Ga0066683_100053135 | 3300005172 | Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGVCDQNNPNTCH* |
Ga0066685_102990981 | 3300005180 | Soil | MSRRIRTLVALFLVSFALTAAACADASGPTNNICDNNNPAT |
Ga0066676_100519064 | 3300005186 | Soil | MSRRIRILIALFLVSFALTASACADASGPTSNACDNNNPNTCR* |
Ga0066676_102120072 | 3300005186 | Soil | MTRRLRCAVALLLVSFALTAAACADASGPSGVTCDNNNPVTCR* |
Ga0070680_1000083386 | 3300005336 | Corn Rhizosphere | MTRRIRCALALLLVSFALTAAACADASGPSRETTCDTNNPNTCR* |
Ga0070691_100459902 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRQIRSLLALFLVSFALTAAACADASGPNDTTCDSNNPATCK* |
Ga0070703_100005735 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRFALALVLVSFALSAAACADASGPSSNVCDNNNPVTCH* |
Ga0070701_101722411 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRKIRSLLALFVVAFALTAAACADASGPSETTCDQSNPATCK* |
Ga0070705_1000033626 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRFALALVLVSFALTASACADTSGPSGVCDNNNPVTCH* |
Ga0070705_1012261791 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRTLVALLLVSFALTASACADVSGPTSNACDNNNPNTCH* |
Ga0070700_1004535221 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TIQPDRGGIMSRQIRSLLALLLVSFALTAAACADASGPNDTTCDTNNPATCK* |
Ga0070708_1000177437 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRTLLALFLVSFALTAAACADASGPTSGTCDTSNPNVCH* |
Ga0070708_1005382432 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRFALSLVLVSFALTAAACADATGPAHGTCDQNNPVTCH* |
Ga0070708_1016901242 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GGPMSRRIRTLLALFLVSFALTAAACADASGPTSGTCDQNNPNVCH* |
Ga0066686_100232183 | 3300005446 | Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDNNNPVTCR* |
Ga0066686_110459202 | 3300005446 | Soil | AVTIQPDNGGIMSRRIRTLLALFLVSFALTAAACADASGPTSGACDTSNPNVCH* |
Ga0066689_107621902 | 3300005447 | Soil | RRIRFALALVLVSLALTASACADASGPSGVCDHSNPVTCH* |
Ga0066682_100048408 | 3300005450 | Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGVCDNSNPNTCH* |
Ga0070707_1007585032 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRFALALVLVSFALTASACADASGPSGVCDTNNPVTCR* |
Ga0070698_1000654924 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRFALALVLVSFALSAAACADASGPTSNACDVNNPVTCH* |
Ga0073909_104092182 | 3300005526 | Surface Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDQNNPVTCR* |
Ga0070697_1001922771 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | QPDNGGPMSRRIRTLLALFLVSFALTAAACADASGPTSGTCDQNNPNVCH* |
Ga0070697_1003470511 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RIRTLLALFLVSFALTAAACADASGPTSGTCDTSNPNVCH* |
Ga0070697_1008088942 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | QPDNGGPMSRRIRTLLALFLVSFALTAAACADASGPTSGTCDTNNPNVCH* |
Ga0070695_1000189531 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RRIRFALALVLVSFALTASACADASGPSGVCDQNNPVTCH* |
Ga0070693_1012302031 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | IRSLLALFLVSFALTAAACADASGPNDTTCDSSNPATCK* |
Ga0066692_100436832 | 3300005555 | Soil | MTRRLRCAVVLLLVSFALTAAACADASGPSGVTCDNNNPVTCR* |
Ga0066707_100067442 | 3300005556 | Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDNNNPVTCH* |
Ga0066707_100146085 | 3300005556 | Soil | MSRRIRTLVALFLVSFALTAAACADASGPTNNICDNNNPATCH* |
Ga0066707_102074972 | 3300005556 | Soil | DHGGIMSRRIRFALALVLVSLALTASACADASGPSGVCDNSNPVTCH* |
Ga0066704_104352812 | 3300005557 | Soil | MSRRIRFALALVLVSFALTAAACADASGPSGVCDHNNPVTCH* |
Ga0066698_102825272 | 3300005558 | Soil | DHGGIMSRRIRFALALVLVSLALTASACADASGPSGVCDHSNPVTCH* |
Ga0066698_104888882 | 3300005558 | Soil | MSRRIRFALALVLVSFALTAAACADASGPSGVCDQSNPVTCR* |
Ga0066699_108996271 | 3300005561 | Soil | MSRRIRFALALVLVSFALTASACADTSGPSGVCDQNNPNTCH* |
Ga0066705_100274804 | 3300005569 | Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGTCDTNNPNVCH* |
Ga0066694_105845931 | 3300005574 | Soil | DNGGPMSRQIRTLLALFLVSFALTAAACADASGPTNGVCDQNNPNTCH* |
Ga0066708_100049952 | 3300005576 | Soil | MSRRIRCALALVLVSFALTAAACADATGPRADTTCDTNNPATCHH* |
Ga0066706_100369021 | 3300005598 | Soil | DNGGPMSRRIRTLLALFLVSFALTAAACADASGPTSGTCDQNNPNVCH* |
Ga0066706_103646622 | 3300005598 | Soil | DNGGPMSRRIRTLLALFLVSFALTAAACADASGPTSGTCDTNNPNVCH* |
Ga0070702_1011037221 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRKIRSLLALFVVALALTAAACADASGPSETTCDQSNPATCK* |
Ga0066652_1006876362 | 3300006046 | Soil | GGHMSRRIRILIALFLVSFALTASACADASGPTSNACDNSNPNTCR* |
Ga0066652_1009408162 | 3300006046 | Soil | MSRQIRTLVALLLVSFALSAAACADASGPSSNACDQNNPVTCR* |
Ga0066652_1009613642 | 3300006046 | Soil | GGHMSRRIRILIALFLVSFALTASACADASGPTSNACDNNNPNTCR* |
Ga0066652_1010351212 | 3300006046 | Soil | MSRRIRILIALFLVSFALTASACADASGPTSNACDN |
Ga0066659_101922462 | 3300006797 | Soil | MSRRIRTLLALFLVSFALTAAACADASGPTNGVCDQNNPNTCH* |
Ga0066659_106479462 | 3300006797 | Soil | MSRRIRFALALVLVSLALTASACADASGPSGVCDHSNPVTCH* |
Ga0079220_102953442 | 3300006806 | Agricultural Soil | MSRRIRTLVVLFLVSFALGAAACADASGPTSSVCDVNIP* |
Ga0075428_1000150149 | 3300006844 | Populus Rhizosphere | MARRIRFALVLFLVSFALSAAACADASGPSETVCDQNNPLCK* |
Ga0075428_1007892532 | 3300006844 | Populus Rhizosphere | MARRIRFVLVLFFVSLALSAAACADASGPSSEACDHNNPIGCR* |
Ga0075428_1025853851 | 3300006844 | Populus Rhizosphere | MSRRIRFALALFLVSFALTAAACADASGPSETTCDNSNPVTCK* |
Ga0075421_1000816882 | 3300006845 | Populus Rhizosphere | MTRRIRYALALVLVSFALTAAACADASGPSHEAACDTSNPNTCL* |
Ga0075421_1007845452 | 3300006845 | Populus Rhizosphere | MTRRIRYALALLLVSFALTAAACADASGPSHEAACDTSNPNTC |
Ga0075421_1013364981 | 3300006845 | Populus Rhizosphere | VQLDRGGFMTRRIRSALALLLVSFALTAAACADASGPSRETACDQENPSTCR* |
Ga0075431_1011073102 | 3300006847 | Populus Rhizosphere | GAMARRIRFVLVLFFVSLALSAAACADASGPSSEACDHNNPIGCR* |
Ga0075431_1019735971 | 3300006847 | Populus Rhizosphere | VQPDRGGPMTRRIRYALALLLVSFALTAAACADASGPSHEAACDTSNPNTCL* |
Ga0075433_100123828 | 3300006852 | Populus Rhizosphere | MTRRLRCALALLLVSFALTASACADASGPSGVTCDNNNPVTCR* |
Ga0075433_106138492 | 3300006852 | Populus Rhizosphere | MSRRIRTLVALFLVSFALTASACADVSGPTSNACDNNNPNTCH* |
Ga0075425_1001123634 | 3300006854 | Populus Rhizosphere | IRFALALVLVSFALSAAACADASGPSSNVCDNNNPVTCH* |
Ga0075425_1030033042 | 3300006854 | Populus Rhizosphere | MSRRIRTLVALFLVSFALTAAACADASGPTSGACDTSNPNTCH* |
Ga0075426_100479492 | 3300006903 | Populus Rhizosphere | MSRRIRLLVALFLVSFALTASACADASGPTSNTCPDNNNPATCL* |
Ga0075426_111722652 | 3300006903 | Populus Rhizosphere | MSRRIRTLLALLLVSFALSSAACADASGPTSNLCDQSNPNTCH* |
Ga0075424_1005403492 | 3300006904 | Populus Rhizosphere | GPMSRRIRTLVALFLVSFALTAAACADASGPTSGACDTNNPNTCH* |
Ga0075436_1000495522 | 3300006914 | Populus Rhizosphere | MSRRIRTLVALLLVSFALSAAACADASGPSSNVCDNNNPVTCH* |
Ga0075436_1008864542 | 3300006914 | Populus Rhizosphere | MSRRIRTLVALFLVSFALTAAACADVSGPTSGACDTNNPNTCH* |
Ga0079218_104769892 | 3300007004 | Agricultural Soil | MARRIRFALTLLLVSFALTSAACADASGPSETVCDQNNPVTCK* |
Ga0099791_101859252 | 3300007255 | Vadose Zone Soil | MPRRIRILIALFLVSFALTASACADASGPTSNACDNSNPNTCL* |
Ga0099791_102030112 | 3300007255 | Vadose Zone Soil | MSRRIRCALALLLVSFALTAAACADASGPSSGTTCDTENPN |
Ga0099793_100201422 | 3300007258 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADTSGPSGVCDHSNPVTCH* |
Ga0099793_100643402 | 3300007258 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADASGPSSVTCDQNNPAVCH* |
Ga0099793_102735662 | 3300007258 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADTSGPSGVCDTSNPNTCR* |
Ga0099793_105653671 | 3300007258 | Vadose Zone Soil | DHGGIMSRRIRFALALVLVSFALTASACADTSGPSGVCDTNNPVTCH* |
Ga0099795_103551942 | 3300007788 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSNACDTNNPVTCR* |
Ga0066710_1002216925 | 3300009012 | Grasslands Soil | MSRRIRTLVALFLVSFALTAAACADASGPTSNVCDNSNPATCH |
Ga0066710_1003195162 | 3300009012 | Grasslands Soil | MSRRIRFALALVLVSFALSAAACADASGPSGVCDNNNPVTCH |
Ga0066710_1004809202 | 3300009012 | Grasslands Soil | MSRRIRFALALVLVSFALTASACADASGPNGVCDNSNPVTCH |
Ga0066710_1013489871 | 3300009012 | Grasslands Soil | SNPTVEAFMSRRIRFALALVLVSFALTAAACADASGPSSVTCDQNNPVTCH |
Ga0066710_1013497941 | 3300009012 | Grasslands Soil | SNPTVEAFMSRRIRFALALVLVSFALTAAACADASGPSSVTCDNNNPVTCH |
Ga0066710_1022389942 | 3300009012 | Grasslands Soil | GPMSRRIRFALALVLVSFALTASACADASGPNGVCDNNNPVTCH |
Ga0111539_108120182 | 3300009094 | Populus Rhizosphere | MARRIRFALVLFLVSFALSAAACADASGPSETTCDQNNPLCK* |
Ga0066709_1001607592 | 3300009137 | Grasslands Soil | MSRRIRFALALVLVSFALTASACADSSGPSGVCDQSNPNTCH* |
Ga0066709_1003950891 | 3300009137 | Grasslands Soil | GPMSRRIRTLLALFLVSFALTAAACADASGPTSGTCDQNNPNVCH* |
Ga0075423_100317117 | 3300009162 | Populus Rhizosphere | MSRRIRFALALVLVSFALTASACADTSGPSGVCDTNNPVTCH* |
Ga0105347_10645812 | 3300009609 | Soil | MTRRIRFALTLFLVSFALTAAACSDASGPSETACDNNNPVTCK* |
Ga0105252_100086544 | 3300009678 | Soil | MARRIRFALTLFLVSFALSAAACADASGPSETACDNSNPATCK* |
Ga0105057_10629232 | 3300009813 | Groundwater Sand | MSRRIRYALSLLLVSFALTAAACADASGPSNVCDNSNPVTC* |
Ga0127483_12043412 | 3300010142 | Grasslands Soil | QPAHGGIMSRRIRFALALILVSFALTASACADASGPSGVCDTSNPNTCR* |
Ga0134109_101661951 | 3300010320 | Grasslands Soil | RIRILIALFLVSFALTASACADASGPTSNACDNNNPNTCR* |
Ga0134111_102769191 | 3300010329 | Grasslands Soil | LALVLVSFALTASACADASGPSGVCDNSNPVTCH* |
Ga0134080_100128783 | 3300010333 | Grasslands Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDTNNPNTCR* |
Ga0134080_103499791 | 3300010333 | Grasslands Soil | QPAHGGIMSRRIRFALALVLVSFALTASACADASGPSGVCDNSNPVTCH* |
Ga0134080_105892691 | 3300010333 | Grasslands Soil | MSRRIRILIALFLVSFALTASACADASGPTSNTCDNSNPNTCR |
Ga0137392_103569692 | 3300011269 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDQNNPNTCH* |
Ga0137391_101969812 | 3300011270 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADASGPSGVCDQSNPVTCR* |
Ga0137424_11210012 | 3300011412 | Soil | MARRIRFALALFLVSFALTAAACGDASGPSETTCDNNNPVTCK* |
Ga0137455_10231334 | 3300011429 | Soil | MARRIRFALALFLVSFALTAAACSDASGPSETACDNSNPVTCK* |
Ga0137429_10887222 | 3300011437 | Soil | MARRIRFALALFLVSFALTAAACSDASGPSETACDNNNPVTCK* |
Ga0137452_10116542 | 3300011441 | Soil | MARRIRFALMLFLVSFALSAAACSDASGPSETACDNSNPVTCK* |
Ga0137320_10872211 | 3300012172 | Soil | DRGGVMARRIRFALVLFLVSFALSAAACADASGPSETTCDQNNPLCK* |
Ga0137364_100133472 | 3300012198 | Vadose Zone Soil | MSRRIRSLFVLFLVSFALTASACASSTGPSTETCDTSNPNTCHH* |
Ga0137364_101882072 | 3300012198 | Vadose Zone Soil | MSRQIRTLLALFLVSFALTAAACADASGPTNGVCDQNNPNTCH* |
Ga0137383_1000132817 | 3300012199 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDHSNPVTCQ* |
Ga0137383_102390161 | 3300012199 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDHNNPVTCQ* |
Ga0137382_100320044 | 3300012200 | Vadose Zone Soil | MSRRIRILIALFLVSFALTASACADASGPTSNVCDNNNPNTCR* |
Ga0137382_100527452 | 3300012200 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSNACDTNNPNTCR* |
Ga0137382_101609072 | 3300012200 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADTSGPSGVCDTSNPNTCH* |
Ga0137365_100709001 | 3300012201 | Vadose Zone Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGACDTSNPNV |
Ga0137365_102455922 | 3300012201 | Vadose Zone Soil | MSRQIRTLLALFLVSFALTAAACADASGPTSGVCDQSNPNTCH* |
Ga0137363_105225922 | 3300012202 | Vadose Zone Soil | SISGGIMSRRIRTLVALLLVSFALSAAACADASGPTSSACDVNNPVTCH* |
Ga0137399_100573444 | 3300012203 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADTSGPSGVCDTSNPNTCH* |
Ga0137399_102278331 | 3300012203 | Vadose Zone Soil | MSRRIRTLIALFLVSFALTASACADASGPTSNACDNNNPNTCR* |
Ga0137399_102397991 | 3300012203 | Vadose Zone Soil | HSTDHGGIMSRRIRFALALVLVSFALTASACADSSGPSGVCDNNNPVTCH* |
Ga0137399_102478392 | 3300012203 | Vadose Zone Soil | SRRIRFALALVLVSFALTASSCADTSGPSGVCDTNNPVTCH* |
Ga0137374_100246085 | 3300012204 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADATAPTPKVCDHSNPITC* |
Ga0137380_100193998 | 3300012206 | Vadose Zone Soil | MSRRIRTLVALFLVSFALTAAACADASGPTSNVCDTNNPATCH* |
Ga0137380_103151401 | 3300012206 | Vadose Zone Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGACDTNNPNVCH* |
Ga0137381_100745753 | 3300012207 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADASGPSELTCDQNNPAVCR* |
Ga0137376_100346534 | 3300012208 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADASGPTELTCDQNNPAVCR* |
Ga0137376_101879372 | 3300012208 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADTSGPSGVCDQSNPVTCH* |
Ga0137376_104357072 | 3300012208 | Vadose Zone Soil | SNPTVEAFMSRRIRFALALVLVSFALTAAACADASGPSSVTCDNNNPVTCH* |
Ga0137376_104645692 | 3300012208 | Vadose Zone Soil | RFALALVLVSFALTAAACADASGPSPVTCDQNNPVTCH* |
Ga0137376_108543751 | 3300012208 | Vadose Zone Soil | RRIRILIALFLVSFALTASACADASGPTSNVCDNSNPNTCR* |
Ga0137379_101139542 | 3300012209 | Vadose Zone Soil | MSRRIRTLVALFLVSFALTAAACADASGPTNNVCDTNNPATCH* |
Ga0137379_101214993 | 3300012209 | Vadose Zone Soil | MSRRIRFALSLVLVSFALAASACASATGPSTETCDTSNPVTCHH* |
Ga0137377_101600442 | 3300012211 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADASGPSGVCDHNNPVTCH* |
Ga0150985_1048121752 | 3300012212 | Avena Fatua Rhizosphere | MSRRIRAIVALFLVSFVLTATACADASGPTSNVCDTNNPNTCR* |
Ga0137465_10002236 | 3300012231 | Soil | MTRRIRFALTLFLVSFALTAAACSDASGPSETACDNSNPVTCK* |
Ga0137387_101580681 | 3300012349 | Vadose Zone Soil | MSRQIRTLVALLLVSFALSAAACADASGPTSNACDQSNP |
Ga0137387_111387812 | 3300012349 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADASGPTSNICDQNNPNTCH |
Ga0137367_100138162 | 3300012353 | Vadose Zone Soil | MSRRIRFAIALVLVSFALTAAACADASGPSTVTCDQNNPVTCH* |
Ga0137384_102988351 | 3300012357 | Vadose Zone Soil | IQPDNGGIMSRRIRTLLALFLVSFALTAAACADASGPTSGACDTNNPNVCH* |
Ga0137385_110198882 | 3300012359 | Vadose Zone Soil | MSRRIRTLVALFLVSFALTAAACADASGPTSNACDQSNPATCH* |
Ga0137375_100947782 | 3300012360 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADASGPSTETCDNSNPVTCH* |
Ga0137375_101464661 | 3300012360 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPTNNVCDTNNPITCR* |
Ga0137375_104737012 | 3300012360 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSNACDTSNPVTCR* |
Ga0137360_108546352 | 3300012361 | Vadose Zone Soil | MSRQIRTLVALLLFSFALSAAACADASGPSSNVCDQSNPVTC |
Ga0137361_100709674 | 3300012362 | Vadose Zone Soil | MSPRIRTLVALLLVSFALSAAACADASGPTSNICDTNNPVTCH* |
Ga0137361_107283911 | 3300012362 | Vadose Zone Soil | DHGGIMSRRIRFALALVLVSLALTASACADASGPSGVCDHNNPVTCH* |
Ga0134058_12352302 | 3300012379 | Grasslands Soil | MSRRIRFALALVLVSFALTAAACADASGPSGVCDTSNPVTCR* |
Ga0134046_10588422 | 3300012386 | Grasslands Soil | SQPAHGGIMSRRIRFALALVLVSFALTASACADASGPSGVCDTNNPNTCR* |
Ga0134044_11970781 | 3300012395 | Grasslands Soil | PAHGGIMSRRIRFALALVLVSFALTAAACADASGPSGVCDTNNPNTCR* |
Ga0134061_12787811 | 3300012399 | Grasslands Soil | QSPDHGGIMSRRIRFALALVLVSFALTAVACADASGPSGVCDTSNPVTCR* |
Ga0137398_108244222 | 3300012683 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSNICDTNNPVTCR* |
Ga0137397_100754493 | 3300012685 | Vadose Zone Soil | MSRRIRCALALLLVSFALTAAACADASGPSSGTTCDTENPNTCR* |
Ga0137396_100106082 | 3300012918 | Vadose Zone Soil | MSRRIRTLVALVLVSFALTAAACADASGPTSSVCDVNNPVTCH* |
Ga0137396_100886562 | 3300012918 | Vadose Zone Soil | MTRRIRFALSLVLVSFALTASACASATGPSTETCDQSNPVTCHH* |
Ga0137396_101813062 | 3300012918 | Vadose Zone Soil | MSRRIRFALSLVLVSFALTAAACADATGPSHVTCDTNNPVTCH* |
Ga0137394_100225721 | 3300012922 | Vadose Zone Soil | AHGGFMSRRIRFALALVLVSFALTASACADASGPSGVCDQNNPVTCR* |
Ga0137394_100311247 | 3300012922 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDQ |
Ga0137394_101291683 | 3300012922 | Vadose Zone Soil | PHSTDHGGIMSRRIRFALALVLVSFALTASACADASGPSGVCDHNNPVTCH* |
Ga0137419_103115941 | 3300012925 | Vadose Zone Soil | PFNQTHGGFMSRRIRFALALVLVSFALTASACADASGPSGVCDTNNPVTCR* |
Ga0137419_105917852 | 3300012925 | Vadose Zone Soil | VCNPQSLDHGGIMSRRIRFALALVLVSFALTASACADTSGPSGVCDTSNPNTCH* |
Ga0137419_115020922 | 3300012925 | Vadose Zone Soil | DHGGIMSRRIRFALALVLVSFALTASACADTSGPSGVCDHNNPVTCH* |
Ga0137416_100289432 | 3300012927 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADSSGPSGVCDQNNPNTCH* |
Ga0137404_114565342 | 3300012929 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADASGPSTETCDTSNPVTCHH* |
Ga0137404_115081361 | 3300012929 | Vadose Zone Soil | GGIMSRRIRTLVALVLVSFALSAAACADASGPSSSVCDNNNPVTCR* |
Ga0137407_104353691 | 3300012930 | Vadose Zone Soil | GGIMSRRIRFALALVLVSFALTASACADASGPSGVCDQSNPVTCR* |
Ga0137410_100798833 | 3300012944 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSNVCDNNNPVTCR* |
Ga0137410_103348642 | 3300012944 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADTSGPSGVCDHNNPVTCH* |
Ga0134075_102835801 | 3300014154 | Grasslands Soil | MPRRIRILIALFLVSFALTASACADASGPTSNACDNNNPNTCR* |
Ga0134079_100001871 | 3300014166 | Grasslands Soil | CGGHMSRRIRILIALFLVSFALTASACADASGPTSNACDNNNPNTCR* |
Ga0180087_10021843 | 3300014872 | Soil | MTRRIRFALTLFLVSSALTAAACSDASGPSETACDNNNPVTCK* |
Ga0180082_11643321 | 3300014880 | Soil | MARRTRFALMLFLVSFALSAAACSDASGPSETACDNSNPVTCQ* |
Ga0137418_100406864 | 3300015241 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADTSGPSGLCDTSNPNTCH* |
Ga0137418_101109401 | 3300015241 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADASGPSSVTCDQNN |
Ga0137418_103241522 | 3300015241 | Vadose Zone Soil | TDHGGIMSRRIRFALALVLVSFALTASACADASGPSGICDHSNPVTCH* |
Ga0137418_103275211 | 3300015241 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADTSGPSGICDHNNPVTCH* |
Ga0137418_103639262 | 3300015241 | Vadose Zone Soil | HGGFMSRRIRFALALVLVSFALTASACADASGPSNACDTNNPVTCR* |
Ga0137409_100807404 | 3300015245 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSGICDHSNPVTCH* |
Ga0137409_103965051 | 3300015245 | Vadose Zone Soil | HGGFMSRRIRFALALVLVSFALTASACADASGPSNVCDNNNPVTCR* |
Ga0137409_104105951 | 3300015245 | Vadose Zone Soil | HGGFMSRRIRFALALVLVSFALTASACADASGPSGVCDQNNPVTCR* |
Ga0180073_10858102 | 3300015256 | Soil | MSRRIRYALSLLLVSFALTAAACAYASGPTTGICDNNNPVTCR* |
Ga0137403_111145231 | 3300015264 | Vadose Zone Soil | IRFALALVLVSFALTAAACADASGPSTETCDTSNPVTCHH* |
Ga0134085_100781931 | 3300015359 | Grasslands Soil | NGGPMSRRIRTLLALFLVSFALTAAACADASGPTSGVCDQNNPNTCH* |
Ga0134069_10599381 | 3300017654 | Grasslands Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGVCDTNNPNTC |
Ga0184610_10029592 | 3300017997 | Groundwater Sediment | MSRRIRYALSLLLVSFALTAAACADASGPSEVTCDNSNPVTCK |
Ga0184605_103410672 | 3300018027 | Groundwater Sediment | MSRRIRFALALVLVSFALTASACADASGPSGVCDTNNPVTCR |
Ga0184608_100014366 | 3300018028 | Groundwater Sediment | MSRRIRFALALVLVSFALTASACADASGPSNVCDNNNPVTCR |
Ga0184634_100870713 | 3300018031 | Groundwater Sediment | MTRRIRFALSLLLVSFALSAAACADATGPSAGICDT |
Ga0184638_10108134 | 3300018052 | Groundwater Sediment | WDPIQLDRGGTMSRRIRYALSLLLVSFALTAAACADASGPSTGICDNNNPVTCR |
Ga0066667_100213335 | 3300018433 | Grasslands Soil | MSRRIRFALALVLVSLALTASACADASGPSGVCDNSNPVTCH |
Ga0066667_100963024 | 3300018433 | Grasslands Soil | MSRRIRTLVALFLVSFALTAAACADASGPTSNVCDQNNPATCH |
Ga0066667_101742812 | 3300018433 | Grasslands Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGVCDQNNPNTCH |
Ga0066662_101405981 | 3300018468 | Grasslands Soil | PDNGGPMSRRIRTLLALFLVSFALTAAACADASGPTSGTCDQNNPNVCH |
Ga0066662_105685562 | 3300018468 | Grasslands Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDNNNPVTCH |
Ga0180119_10571522 | 3300019228 | Groundwater Sediment | MARRIRFALALFLVSFALTAAACSDASGPSETACDNSNPVTCK |
Ga0180112_11194941 | 3300019238 | Groundwater Sediment | MARRIRFALMLFLVSFALSAAACSDASGPSETACDNSNPVTCK |
Ga0184643_11892472 | 3300019255 | Groundwater Sediment | MSRRIRFALALVLVSFALTASACADASGPSGVCDHSNPVTCR |
Ga0184646_12454411 | 3300019259 | Groundwater Sediment | LDRGGTMSRRIRYALSLLLVSFALTAAACADASGPSEVTCDQNNPVTCR |
Ga0184646_12478081 | 3300019259 | Groundwater Sediment | LDRGGTMSRRIRYALSLLLVSFALTAAACADASGPSEVTCDNSNPVTCK |
Ga0184646_14957351 | 3300019259 | Groundwater Sediment | MSRRIRYALSLLLVSFALTAAACADASGPSEVTCD |
Ga0193723_10035428 | 3300019879 | Soil | IRFALALVLVSFALSAAACADASGPSSNICDNNNPVTCH |
Ga0193723_10093532 | 3300019879 | Soil | MSRRIRFALALVLVSFALTASACADASGPSNICDNNNPVTCH |
Ga0193723_10340222 | 3300019879 | Soil | RRIRFALALVLVSFALTASACADASGPSNICDTSNPVTCH |
Ga0193723_10348952 | 3300019879 | Soil | MSRRIRFALALVLVSFALSAAACADASGPSSNICDNSNPVTCH |
Ga0193712_11334392 | 3300019880 | Soil | MSRRIRFALALVLVSFALTASACADASGPSNICDNSNPVT |
Ga0193713_10032226 | 3300019882 | Soil | MSRRIRFALALVLVSFALTASACADASGPSNICDNSNPVTCH |
Ga0193725_100022217 | 3300019883 | Soil | MSRRIRFALALVLVSFALTASACADASGPSNVCDTSNPVTCR |
Ga0193725_10520361 | 3300019883 | Soil | FALALVLVSFALTASACADASGPSNVCDNNNPVTCR |
Ga0193711_10094241 | 3300019997 | Soil | GGFMSRRIRFALALVLVSFALTASACADASGPSNVCDTSNPVTCR |
Ga0193739_10007872 | 3300020003 | Soil | MSRRIRYALSLLLVSFALTAAACADASGPSEVTCDTNNPVTCK |
Ga0193755_10016637 | 3300020004 | Soil | MSRRIRFALALVLVSLALTASACADASGPSGICDQNNPVTCH |
Ga0210378_100183284 | 3300021073 | Groundwater Sediment | MSRRIRFALSLLLVSFALTAAACADASGPTTGICDQSNPVTCR |
Ga0210378_100433763 | 3300021073 | Groundwater Sediment | PSQPAHGGFMSRRIRFALALVLVSFALTASACADASGPSNVCDNNNPVTCR |
Ga0210382_100653001 | 3300021080 | Groundwater Sediment | TQPDHGGIMSRRIRFALALVLVSFALTASACADASGPSGVCDTNNPITCR |
Ga0179596_107233281 | 3300021086 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSNICDTNN |
Ga0179585_10320831 | 3300021307 | Vadose Zone Soil | PDHGGIMSRRIRFALALVLVSLALTASACADTSGPSGICDHNNPVTCH |
Ga0222625_16649842 | 3300022195 | Groundwater Sediment | MSRRIRFALALVLVSFALTASACADASGPSGVCDHSNPVTCH |
Ga0137417_12631661 | 3300024330 | Vadose Zone Soil | EALMSRRIRFALALVLVSFALTAAACADASGPSSVTCDQNNPAVCH |
Ga0207653_1000004080 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRFALALVLVSFALSAAACADASGPSSNVCDNNNPVTCH |
Ga0207660_100084166 | 3300025917 | Corn Rhizosphere | MTRRIRCALALLLVSFALTAAACADASGPSRETTCDTNNPNTCR |
Ga0207660_100825114 | 3300025917 | Corn Rhizosphere | MSRKIRSLLALFVVAFALTAAACADASGPSETTCDQSNPATCK |
Ga0207646_102214192 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIRTLLALFLVSFALTAAACADASGPTSGTCDTNNPNVCH |
Ga0207708_100553852 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRQIRSLLALLLVSFALTAAACADASGPNDTTCDTNNPATCK |
Ga0209438_10234402 | 3300026285 | Grasslands Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDQNNPVTCR |
Ga0209235_10239954 | 3300026296 | Grasslands Soil | MSRQIRTLLALFLVSFALTAAACADASGPVSGTCDQSNPNVCH |
Ga0209235_10587403 | 3300026296 | Grasslands Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGTCDQNNPNVCH |
Ga0209237_10272762 | 3300026297 | Grasslands Soil | MSRRIRFALALVLVSFALTASACADTTAPTRGVCDQSNPNTCH |
Ga0209237_11454911 | 3300026297 | Grasslands Soil | MSRRIRFALSLVLVSFALTASACASATGPSTETCDQSNPVTCHH |
Ga0209237_12575272 | 3300026297 | Grasslands Soil | GGLMSRRIRTLLALFLVSFALTAAACADASGPTSGTCDQNNPNVCH |
Ga0209468_10014226 | 3300026306 | Soil | MSRRIRTLVALFLVSFALTAGACADASGPTNNVCDQSNPNTCH |
Ga0209468_10128885 | 3300026306 | Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDNSNPVTCH |
Ga0209131_10028129 | 3300026320 | Grasslands Soil | MSRQIRTLVALLLVSFALSAAACADASGPTSNACDVNNPVTCH |
Ga0209472_10279902 | 3300026323 | Soil | MTRRLRCAVALLLVSFALTAAACADASGPSGVTCDNNNPVTCR |
Ga0209470_10231451 | 3300026324 | Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDNNNPVTCR |
Ga0209152_100153143 | 3300026325 | Soil | MSRRIRFALALVLVSFALTAAACADASGPSGVCDHNNPVTCH |
Ga0209266_10060913 | 3300026327 | Soil | MSRRIRTLLALFLVSFALTAAACADASGPTSGACDTSNPNVCH |
Ga0209378_11077492 | 3300026528 | Soil | MSRRIRTLVALFLVSFALTAAACADASGPTNNICDNNNPATCH |
Ga0209058_11487492 | 3300026536 | Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDTSNPNTCH |
Ga0208454_10021213 | 3300027573 | Soil | MARRIRFALVLFLVSFALSAAACADASGPSETTCDQNNPLCK |
Ga0208454_10031035 | 3300027573 | Soil | MARRIRFALTLFLVSFALSAAACADASGPSETACDNSNPATCK |
Ga0209588_10005699 | 3300027671 | Vadose Zone Soil | MTRRIRFALSLVLVSFALAASACASPTAPRTQTCDTNNPVTCH |
Ga0209073_100064453 | 3300027765 | Agricultural Soil | MSRSIRTIRTLVALLLVSFALTAVSACADATGPTHAACDWSNGNVCH |
Ga0209488_100441542 | 3300027903 | Vadose Zone Soil | MSRRIRFALALVLVSFALTATACADASGPSGVCDNNNPVTCR |
Ga0209488_100493132 | 3300027903 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADASGPSNACDTNNPVTCR |
Ga0209382_104412992 | 3300027909 | Populus Rhizosphere | MTRRIRYALALVLVSFALTAAACADASGPSHEAACDTSNPNTCL |
Ga0247684_10571112 | 3300028138 | Soil | MSRQIRSLLALFLVSFALTAAACADASGPNDTTCDSNNPATCK |
Ga0137415_100038427 | 3300028536 | Vadose Zone Soil | MSRRIRFALALVLVSFALTAAACADASGPSSVTCDQNNPAVCH |
Ga0137415_100067455 | 3300028536 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADTSGPSGICDHNNPVTCH |
Ga0137415_100901755 | 3300028536 | Vadose Zone Soil | MSRRIRFALALVLVSFALTASACADSSGPSGVCDQNNPNTCH |
Ga0137415_102023042 | 3300028536 | Vadose Zone Soil | MSRRIRFALSLVLVSFALTAAACADATGPSHVTCDTNNPVTCH |
Ga0137415_104105382 | 3300028536 | Vadose Zone Soil | MSRRIRFALALVLVSLALTASACADTSGPSGVCDTSNPNTCR |
Ga0307312_100434304 | 3300028828 | Soil | MSRRIRFALALVLVSFALTASACADASGPSGVCDQNNPVTCH |
Ga0138303_12543532 | 3300030939 | Soil | MTRPTRSALAMLLVSFALTLAACADASGPSSETTCDHNNPVTCH |
Ga0308190_11382251 | 3300030993 | Soil | LSQPAHGGFMSRRIRFALALVLVSFALTASACADASGPSGVCDHSNPVTCH |
Ga0138298_10264603 | 3300031015 | Soil | MTRRTRSALAMLLVSFALTLAACADASGPSSETTCDHNNPVTCH |
Ga0308199_11696331 | 3300031094 | Soil | DHGGIMSRRIRFALALVLVSFALTASACADASGPSGVCDNNNPVTCR |
Ga0307495_100611021 | 3300031199 | Soil | MSRRIRTLIALFLVSFALTASACADASGPTSNVCDNSNPNTCR |
Ga0307495_101104501 | 3300031199 | Soil | MSRRIRTLIALFLVSFALTASACADASGPTTNACDNNNPNTCR |
Ga0307497_100118362 | 3300031226 | Soil | MSRRIRYALSLLLVSFALTAAACADASGPSSETCDHNNPICH |
Ga0170824_1163190172 | 3300031231 | Forest Soil | MTRRTRSALAMLLVSFALAAAACADASGPSSETTCDHNNPVTCH |
Ga0308194_100060512 | 3300031421 | Soil | MSRRIRFALALVLVSFALTASACADTSGPSGVCDQNNPNTCH |
Ga0308194_100202101 | 3300031421 | Soil | QPDHGGFMSRRIRFALALVLVSFALTASACADASGPSNICDNSNPVTCH |
Ga0308194_100737481 | 3300031421 | Soil | QPDHGGFMSRRIRFALALVLVSFALTASACADASGPSNICDNNNPVTCH |
Ga0308179_10606972 | 3300031424 | Soil | PIQPDHGGFMSRRIRFALALVLVSFALTASACADASGPSNICDTSNPVTCH |
Ga0307469_100102042 | 3300031720 | Hardwood Forest Soil | MSRRIRTLLALFLVSFALTAAACADATGPTSGACDTSNPNVCH |
Ga0307473_100634012 | 3300031820 | Hardwood Forest Soil | MTRRLRCALALLLVSFALSAAACADASGPSGVTCDNNNPVTCR |
Ga0310810_105235642 | 3300033412 | Soil | LWSLFQLDCGGIMSRRIRSLVALFLVSFALTAAACADSTAPRADTTCDTSNPNTCHH |
Ga0314782_082238_474_599 | 3300034661 | Soil | MTRRIRYALVLFLVSFALTSAACADASGPSETGCEQNNPIC |
⦗Top⦘ |