NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012980

Metagenome / Metatranscriptome Family F012980

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012980
Family Type Metagenome / Metatranscriptome
Number of Sequences 275
Average Sequence Length 140 residues
Representative Sequence MYDVFERYRVEEKNPVGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPAVTPFYHRYNIAAPVEYQAYPVSNPSAPPS
Number of Associated Samples 196
Number of Associated Scaffolds 275

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 15.27 %
% of genes near scaffold ends (potentially truncated) 81.09 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 185
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(34.909 % of family members)
Environment Ontology (ENVO) Unclassified
(67.636 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(74.909 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.74%    β-sheet: 9.77%    Coil/Unstructured: 61.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 275 Family Scaffolds
PF00171Aldedh 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 275 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.36
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.36
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000130|SA_S2_NOR15_50mDRAFT_c10164922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300001830|ACM40_1040374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300004095|Ga0007829_10078881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300004789|Ga0007752_11069587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300004836|Ga0007759_11477953All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300005516|Ga0066831_10079269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum888Open in IMG/M
3300006117|Ga0007818_1071090All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300006357|Ga0075502_1695069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300006390|Ga0075509_1431500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300006392|Ga0075507_1475436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300006392|Ga0075507_1507642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300006393|Ga0075517_1517954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300006401|Ga0075506_1722006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300006404|Ga0075515_10808684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300006404|Ga0075515_10996022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum922Open in IMG/M
3300007550|Ga0102880_1131483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300007627|Ga0102869_1153094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300007864|Ga0105749_1137924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300008835|Ga0103883_1038782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300008998|Ga0103502_10339301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300009028|Ga0103708_100147407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300009055|Ga0102905_1116048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300009058|Ga0102854_1163714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300009155|Ga0114968_10454891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300009155|Ga0114968_10478035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300009172|Ga0114995_10298229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum887Open in IMG/M
3300009172|Ga0114995_10545345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300009193|Ga0115551_1206308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum881Open in IMG/M
3300009195|Ga0103743_1038557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300009239|Ga0103858_10193878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300009263|Ga0103872_1002444All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1274Open in IMG/M
3300009422|Ga0114998_10154671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1103Open in IMG/M
3300009422|Ga0114998_10332199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300009432|Ga0115005_10823040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum748Open in IMG/M
3300009432|Ga0115005_11512687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300009543|Ga0115099_11018393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300009592|Ga0115101_1185940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300009599|Ga0115103_1004295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300009606|Ga0115102_10171449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300009606|Ga0115102_10190161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300009606|Ga0115102_10411170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300009606|Ga0115102_10947362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300009606|Ga0115102_10991796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300009677|Ga0115104_10478619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300009679|Ga0115105_10040382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300009679|Ga0115105_10698896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300009679|Ga0115105_10718242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300009679|Ga0115105_10997818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300009679|Ga0115105_11109486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300009679|Ga0115105_11290001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300009728|Ga0123371_125987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300009785|Ga0115001_10534163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300010129|Ga0123376_1151108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300010297|Ga0129345_1172677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300010368|Ga0129324_10152325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum963Open in IMG/M
3300010368|Ga0129324_10245899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300010981|Ga0138316_10726586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300010981|Ga0138316_11463198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300010985|Ga0138326_10473438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300010985|Ga0138326_10529777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300010985|Ga0138326_12122109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300012030|Ga0136599_1030802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum765Open in IMG/M
3300012418|Ga0138261_1264555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300012472|Ga0129328_1136701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300012472|Ga0129328_1138261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300012518|Ga0129349_1237886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum740Open in IMG/M
3300012522|Ga0129326_1238908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300012524|Ga0129331_1242865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum764Open in IMG/M
3300012722|Ga0157630_1125999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300012730|Ga0157602_1313092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300012731|Ga0157616_1144689All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300012751|Ga0138277_1041799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300013310|Ga0157622_1212494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300016695|Ga0180059_1058329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300016723|Ga0182085_1050436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300016727|Ga0182051_1246499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300016735|Ga0182074_1071879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300016762|Ga0182084_1251930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300016781|Ga0182063_1646879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300017730|Ga0181417_1119739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300017757|Ga0181420_1195284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300017772|Ga0181430_1174042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300017781|Ga0181423_1257489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300017967|Ga0181590_10616031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300018515|Ga0192960_105408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300018596|Ga0193060_1014523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300018596|Ga0193060_1018644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018628|Ga0193355_1011171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum803Open in IMG/M
3300018628|Ga0193355_1019589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300018692|Ga0192944_1029287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300018725|Ga0193517_1080054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300018739|Ga0192974_1066085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300018741|Ga0193534_1071839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300018765|Ga0193031_1076987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300018765|Ga0193031_1077860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300018765|Ga0193031_1080715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300018765|Ga0193031_1081127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300018766|Ga0193181_1035302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum725Open in IMG/M
3300018776|Ga0193407_1059491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300018776|Ga0193407_1061160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300018776|Ga0193407_1062981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300018779|Ga0193149_1044504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300018782|Ga0192832_1061571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300018791|Ga0192950_1060015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300018800|Ga0193306_1029673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum856Open in IMG/M
3300018800|Ga0193306_1044851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300018831|Ga0192949_1102117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300018861|Ga0193072_1100909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300018873|Ga0193553_1152648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300018905|Ga0193028_1116193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300018926|Ga0192989_10085071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300018926|Ga0192989_10108997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300018926|Ga0192989_10149260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300018926|Ga0192989_10156832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018928|Ga0193260_10130617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300018975|Ga0193006_10217170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300018976|Ga0193254_10113163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300018977|Ga0193353_10161963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300018977|Ga0193353_10223978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300018982|Ga0192947_10233995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300018982|Ga0192947_10267143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300018989|Ga0193030_10141540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300018989|Ga0193030_10158822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum735Open in IMG/M
3300018989|Ga0193030_10188709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300018989|Ga0193030_10220207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300018989|Ga0193030_10235029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300018989|Ga0193030_10245881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300018989|Ga0193030_10278218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300018989|Ga0193030_10288289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300018997|Ga0193257_10227905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300019001|Ga0193034_10144577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300019001|Ga0193034_10168241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300019001|Ga0193034_10184666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300019003|Ga0193033_10216372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300019010|Ga0193044_10238638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300019021|Ga0192982_10352862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300019022|Ga0192951_10289979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300019022|Ga0192951_10355710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300019025|Ga0193545_10121934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300019025|Ga0193545_10123124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300019027|Ga0192909_10072619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum818Open in IMG/M
3300019031|Ga0193516_10240608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300019032|Ga0192869_10365532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300019032|Ga0192869_10375814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300019032|Ga0192869_10410826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300019033|Ga0193037_10215048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300019033|Ga0193037_10279633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300019045|Ga0193336_10190487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300019045|Ga0193336_10466856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300019045|Ga0193336_10478422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300019048|Ga0192981_10344761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300019051|Ga0192826_10219560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300019051|Ga0192826_10237449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300019051|Ga0192826_10279309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300019095|Ga0188866_1015582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum785Open in IMG/M
3300019095|Ga0188866_1017523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300019103|Ga0192946_1043378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300019103|Ga0192946_1049497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300019116|Ga0193243_1048114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300019118|Ga0193157_1026253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300019118|Ga0193157_1034156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300019118|Ga0193157_1034746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300019123|Ga0192980_1063456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300019123|Ga0192980_1079554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300019129|Ga0193436_1055311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300019149|Ga0188870_10077100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum812Open in IMG/M
3300019149|Ga0188870_10131891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300019253|Ga0182064_1310396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300019272|Ga0182059_1142563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300020159|Ga0211734_10623794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum975Open in IMG/M
3300020172|Ga0211729_10713949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum823Open in IMG/M
3300021334|Ga0206696_1079488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300021334|Ga0206696_1409174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300021342|Ga0206691_1166909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300021348|Ga0206695_1459586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300021350|Ga0206692_1136676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300021359|Ga0206689_10071574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300021389|Ga0213868_10414407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum742Open in IMG/M
3300021872|Ga0063132_114802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300021881|Ga0063117_1029078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300021889|Ga0063089_1055586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300021896|Ga0063136_1013189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300021912|Ga0063133_1004355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300021912|Ga0063133_1046049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300021913|Ga0063104_1103587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300021934|Ga0063139_1018608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300021959|Ga0222716_10595371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300022074|Ga0224906_1190496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300022369|Ga0210310_1022704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300022929|Ga0255752_10277360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum725Open in IMG/M
(restricted) 3300023276|Ga0233410_10283540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300023566|Ga0228679_1034232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300023704|Ga0228684_1039945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300023704|Ga0228684_1070420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300025138|Ga0209634_1173347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum854Open in IMG/M
3300025138|Ga0209634_1241074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300025340|Ga0208866_1004144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum894Open in IMG/M
3300025355|Ga0208254_1012583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300025367|Ga0208108_1028542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300025369|Ga0208382_1037869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300025392|Ga0208380_1051324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300025396|Ga0208874_1034920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300025449|Ga0208106_1078418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300025848|Ga0208005_1170149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300025869|Ga0209308_10433336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300025881|Ga0209309_10347277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300026182|Ga0208275_1045148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum888Open in IMG/M
3300026448|Ga0247594_1069397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300026448|Ga0247594_1088246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300026458|Ga0247578_1096013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300026462|Ga0247568_1098706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300026465|Ga0247588_1067271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300026468|Ga0247603_1097379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300026513|Ga0247590_1119221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300027225|Ga0208025_1051301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300027686|Ga0209071_1223685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300027687|Ga0209710_1134266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum921Open in IMG/M
3300027752|Ga0209192_10181023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum814Open in IMG/M
3300027801|Ga0209091_10535998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300028102|Ga0247586_1076649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300028102|Ga0247586_1091765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300028102|Ga0247586_1096795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300028109|Ga0247582_1058361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1009Open in IMG/M
3300028137|Ga0256412_1192761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300028137|Ga0256412_1226344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300028137|Ga0256412_1256237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300028137|Ga0256412_1356685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300028334|Ga0247597_1059376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300028575|Ga0304731_11031457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300028575|Ga0304731_11033725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300030699|Ga0307398_10409105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300030699|Ga0307398_10505174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300030702|Ga0307399_10515347All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300030780|Ga0073988_12291997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300030788|Ga0073964_10052463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300030788|Ga0073964_11580958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300030856|Ga0073990_12017996All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300030856|Ga0073990_12033827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300030856|Ga0073990_12050083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300030857|Ga0073981_11654418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300031062|Ga0073989_13491360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300031062|Ga0073989_13541053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300031557|Ga0308148_1028761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300031717|Ga0307396_10456467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300031717|Ga0307396_10580371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300031725|Ga0307381_10213331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300031729|Ga0307391_10480017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300031734|Ga0307397_10341998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300031739|Ga0307383_10594722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300031739|Ga0307383_10658309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300031743|Ga0307382_10344107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300031752|Ga0307404_10497350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300032463|Ga0314684_10671455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300032463|Ga0314684_10757885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300032470|Ga0314670_10331032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300032470|Ga0314670_10721304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300032517|Ga0314688_10567104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300032518|Ga0314689_10617526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300032522|Ga0314677_10406289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300032540|Ga0314682_10444432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300032616|Ga0314671_10536899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300032616|Ga0314671_10799389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300032707|Ga0314687_10659926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300032707|Ga0314687_10750610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300032708|Ga0314669_10516540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300032709|Ga0314672_1326484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300032714|Ga0314686_10612876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300032742|Ga0314710_10475256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300032748|Ga0314713_10393506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300032750|Ga0314708_10104807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1285Open in IMG/M
3300032751|Ga0314694_10416233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300032754|Ga0314692_10318249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum842Open in IMG/M
3300032755|Ga0314709_10742132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300034073|Ga0310130_0181766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300034272|Ga0335049_0655925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine34.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine19.27%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.64%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.27%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.09%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.27%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.27%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.18%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.18%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.18%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.18%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.09%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.09%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.09%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.73%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.73%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.36%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.36%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.36%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.36%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.36%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.36%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.36%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.36%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.36%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.36%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.36%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300001830Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3lEnvironmentalOpen in IMG/M
3300004095Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006117Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE08Jun09EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009239Microbial communities of water from Amazon river, Brazil - RCM11EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009728Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_213_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010129Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_237_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300012030Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012730Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012751Freshwater microbial communities from Lake Montjoie, Canada - M_130821_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013310Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016695Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016762Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016781Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101409CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025340Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025355Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025367Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025392Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025396Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025449Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027225Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031557Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_328_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR15_50mDRAFT_1016492213300000130MarineMYDVFERYRVEEKNPLGSGTGVWKLPKGSGPQWAADVVHRFHVMDDDKVNDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDLDSTAQLHQNQFSKVPDIKTFVVSPETYTANPATAAP*
ACM40_104037413300001830Marine PlanktonEEKNPLGAGTGIWKLPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSTAQIVQNEFSATPDKTAFAHRYPIKAEAALYPQGINGKQPEA*
Ga0007829_1007888113300004095FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPLK*
Ga0007752_1106958713300004789Freshwater LakeMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWAADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPLK*
Ga0007759_1147795313300004836Freshwater LakeMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQADKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKVKFVHRYPLK*
Ga0066831_1007926923300005516MarineMYDVFERYRVEEKNPIGAGTGIWKLPKYSGPQWASDVIRRFHIMQDGKVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGALSDMDNAEMIHQNEFSKAPQLTAFAHRYGMTADDANNWQR*
Ga0007818_107109013300006117FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKK
Ga0075502_169506913300006357AqueousADEDDIMYDVFERYRVEEKNPMGAGTGIWKLPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSASADVTPFAHRYPIEQTSAYHGYPVSNPSAPPM*
Ga0075509_143150013300006390AqueousGIWKLPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSASADVTPFAHRYPIEQTSAYHGYPVSNPSAPPM*
Ga0075507_147543613300006392AqueousMYDVFERYRVEEKNPMGAGTGIWKLPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSASADVTPFAHRYPIEQTSAYHGYPVSNPSAPPM*
Ga0075507_150764213300006392AqueousIMYDVFERYRVEEKNPLGSGTGVWKLPKGSGPQWSADIIRRFHVMDDDKVNDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDLDSAAQIHQNQFSKTPDIKAFVNSPTAYGAAPTPASG*
Ga0075517_151795413300006393AqueousWKLPKASGPQWASDVIRRMHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSAAPDLRPYKHRYELKDQDYPDGRRALQ*
Ga0075506_172200613300006401AqueousGIWKLPKASGPQWASDVIRRMHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHIQNEFSASPDLRPYKHRYELKDQAYPDGRSALQ
Ga0075515_1080868413300006404AqueousAGTGIWKLPKASGPQWAADIIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYETEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSASPDLLPFRHRYELTNGVYPDGRTALQ*
Ga0075515_1099602213300006404AqueousMYDVFERYRVEEKNPDGHGTGIWKLPKYSSPQWAHDIIHRFHVMDDDKVDPYIAANIENFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSATPDVTPFAHRYAIAPPTAYHGYPVSNPSAPPM*
Ga0102880_113148313300007550EstuarineYRVEERNPVGAGTGIWKLPKASGPQWASDIIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYETEGEVFMRALLGPNNRFRLAPGALSDMENDELWVPNDFSATPDHKTGPYVHRYALDDGPFGNGYNKNG*
Ga0102869_115309413300007627EstuarineGTGIWKLPKASGPQWASDIIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYETEGEVFMRALLGPNNRFRLAPGALSDMENDELWVPNDFSATPDHKTGPYVHRYALDDGPFGNGYNKNG*
Ga0105749_113792413300007864Estuary WaterDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWSADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFLRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSADPAVTGFYHRYPIDPPTSYHAYPVSNPSAPPA*
Ga0103883_103878213300008835Surface Ocean WaterLMYDTFARYRVEEKNPLGAGTGIWKLPKSSGPQWAADIIRKFNVMKDEQVDQYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSTAQIVQNEFSATPDKTPFAHRYPIKAEAALYPQGINGKQPEA*
Ga0103502_1033930113300008998MarineVEEKNPMGQGTGIWKLPKNSGPEWSADIIRRFNVMKEDKINDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMKSAAQIHQNQFSKAKDIDPFAWRYPIAESGVADGQLGEWNS*
Ga0103708_10014740713300009028Ocean WaterMYDTFARYRVEEKNPLGAGTGVWKLPKASGPQWAADILRKFNVMKDDAVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSAVPEVTPFSHAYSITPTAPMYPQGINGLQPEA*
Ga0102905_111604813300009055EstuarineVFERYRVEERNPVGAGTGIWKLPKASGPEWAADVVRRFHVMDDSKVDAYVAANFDNFWRKYDNNGTGEIYESEGETFLRALLGPNNRFRLAPGALSDMDSSAQVHQNQFSATPDKEAFQHRYKIDEAPTYVGGVTGGSS*
Ga0102854_116371413300009058EstuarineVFERYRVEERNPAGAGTGVWKLPKASGPQWAADVVRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFLRALLGPNNRFRLAPGALSDMQGAEYHIQNEFSATPDIKPFAHRYPIADQDYSMEGSV*
Ga0114968_1045489123300009155Freshwater LakeYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKKPFAHRYPLA*
Ga0114968_1047803513300009155Freshwater LakeYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKVKFAHRYPL*
Ga0114995_1029822913300009172MarineMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYIAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFAANGAASVTPFAHRYTIDQTSSYNIYPVANPSPAPTDDTSKK*
Ga0114995_1054534513300009172MarineRVEERNPIGAGTGIWKMPKSSGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAEGALSDMDSAAQLIPNEFSASTDVTPFYHRYEISDPSAEYKAYPVVNPSVDTTK*
Ga0115551_120630813300009193Pelagic MarineTECYGADEDDIMYDVFERYRVEEKNPMGAGTGIWKLPKASGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTPFAHRYEIAPPTAYHGYPVSNPSAPPS*
Ga0103743_103855713300009195Ice Edge, Mcmurdo Sound, AntarcticaMYDVFERYRVEERNPIGAGTGIWKMPKSSGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIFESEAETFMRALLGPNNRFRLAEGALSDMDSAAQLIPNEFSSGTDVTPFYHRYEIADPSAEYKAYPVANPSQDISNK*
Ga0103858_1019387813300009239River WaterLPKSSGPQWAADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPLK*
Ga0103872_100244413300009263Surface Ocean WaterDDIMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTPFYHRYDIAAPTQYQAYPVSNPSTVPQ*
Ga0114998_1015467113300009422MarineMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYIAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFAANGGASVTPFAHRYNIEQTSSYNIYPVANPSPAPTDDTSKK*
Ga0114998_1033219913300009422MarineERNPTGAGTGIWKLPKNSGPQWAADIVRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEMYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSASTDVTAFAHRYEIAQPDKYNVYPPVNASVEDPNAK*
Ga0115005_1082304013300009432MarineDDIMYDVFERYRVEEKNPMGASTGIWKLPKASGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSADPAVTPFAHRYVIEAPAAYHAYPVSNPSAPPM*
Ga0115005_1151268713300009432MarineADEDDIMYDVFERYRVEERNPVGAGTGIWKLPKASGPEWAADVVRRFHVMDDSKVDAYVAANFDNFWRKYDNNGTGEIYETEGETFLRALLGPNNRFRLAPGALSDMDSSAQVHQNQFSATPAKEAFQHRYKIDEAPTYVGGVTGGAS*
Ga0115099_1101839313300009543MarineSSECYGADEDDIMYDVFERYRVEEKNPFGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSAGAAVTPFAHRYPIE*
Ga0115101_118594013300009592MarineERNPQGAGTGVYKLPKYSAPQFAHDIITHFHVMDDDKVDAYIAANLDNFWHKYDNNGTGEIFESEGETFMRALLGPNNRFRLAEGALSDMDNAELIVPNQFSSTLDHQGFAHRYPIRGFDKATMPLA*
Ga0115103_100429513300009599MarineCYGADEDDIMYDVFERYRVEEKNPMGAGTGIWKLPKASGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTPFAHRYVIEAPAAYHAYPVSNPSAPPM*
Ga0115102_1017144913300009606MarineSTECYGADEDDIMYDVFERYRIEEKNPQGAGTGVYKLPKYSAPTWAHDIITHFHVMDDDKVDAYIAANLDNFWHKYDNNGTGEIFESEGETFMRALLGPNNRFRLAQGALSDMDNAELIVPNEFSAGRENKAFAHRYPLKGYDSTKMY*
Ga0115102_1019016113300009606MarineFERYRVEERNPVGAGTGIWKLPKASGPQWATDIIRRMHVMDNDKVNAYVAANFDNFWKKYDNNGSGEIYESEGEVFMRALLGPNNRYRLAPGALSDMDSASLHVQNEFSAAADLRPYKHRYELKDQDYPDGRSALQ*
Ga0115102_1041117013300009606MarineRVEEKNPMGAGTGVWKLPKGSGPEWSADVIRRFHVMDDDKVNDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDLDSTAEIHQNQFSKTPEIKPFAHRYTLGAAAPTDGK*
Ga0115102_1094736213300009606MarineNPMGAGTGIWKLPKASGPQWAADVVRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGETFLRALLGPNNRFRLAPGALSDMDSASLHVQNEFSASADLRPYRHRYELKDQEYPNGQSALQ*
Ga0115102_1099179613300009606MarineVFERYQVEERNPMGAGTGIYKLPKASGPQWASDVVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYALNYGAYPNNYGDNGIN*
Ga0115104_1047861913300009677MarineMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYTTEGETFMRALLGPNNRFRLAPGALSDMDSTGQQIRNNFGGAPGESPTPFRHRYNLNYGEYPNNYG
Ga0115105_1004038213300009679MarineLPKASGPQWAADVIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFLRALLGPNNRFRLAPGALSDMDSASLHVQNEFSASADLRPYKHRYELKDMDYPNGQSALQ*
Ga0115105_1069889613300009679MarineEDDIIYDTFERYRVEEKNPLGSGTGIWKLPKWSGPQWSAYIISHMHVMDADKVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDNAETIVQNEFSGTPDKVAFKHRYQLV*
Ga0115105_1071824213300009679MarineRYRVEELNPLGAGTGTWKLPKASGPQWAADIIRKFNVMKDDAVDPYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSAVPAVTPFAHAYSITPTAAMYPQGINGLQPEA*
Ga0115105_1099781813300009679MarineDEDDIMYDVFERYRVEEKNPVGAGTGIWKLPKNSGPQWAADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTAFYHRYNIAAPAVYQAYPVSNPSLPPE*
Ga0115105_1110948613300009679MarineVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYTTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYNLNYGEYPNNYGDNGIN*
Ga0115105_1129000113300009679MarineMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFSHRYNLGYQEYPNNYNGIN*
Ga0123371_12598713300009728MarineLGAGTGIWKLPKSSGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTAFYHRYDIAAPTVYQAYPVSNPSTVPQ*
Ga0115001_1053416323300009785MarineEIMYDVFERFRVEEKNPLGSGMGVFKLPKWSGPQWSRDIISHMHVMDEDKVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDNAELITQNKFSATPSLTPFKHRYELV*
Ga0123376_115110813300010129MarineLSTECYGADEDDIMYDVFERYRVEEKNPDGHGTGIWKLPKYSSPQWAHDIIHRFHVMDDDKVDPYIAANIENFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFRHRYNLNYGEYPNNYGANGVN*
Ga0129345_117267713300010297Freshwater To Marine Saline GradientRVEEKNPLGAGTGVWKLPKGSGPEWSADIIRRFHVMDEDKVNDYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTAFYHRYDIAAPTVYQAYPVSNPSTVPQ*
Ga0129324_1015232513300010368Freshwater To Marine Saline GradientMYDVFERYRVEEKNPLGSGTGVWKLPKGSGPQWSADIIRRFHVMDDDKVNDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDLDSAAQIHQNQFSKTPDIKAFVNSPTAYGAAPTPASG*
Ga0129324_1024589913300010368Freshwater To Marine Saline GradientECYGADEDDIMYDVFERYRVEERNPVGAGTGIWKLPKASGPQWASDVVRRFHVMDNDKVDAYVKANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMKNEEEIHQNEFSAAVDKRAFAHRYNLTDPDFSNNYNRVDIV*
Ga0138316_1072658613300010981MarineMYDVFARYRVEEKNPLGAGTGVWKLPKGSGPQWAGDVIRKFNVMKDDQIDSYLAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGAISDMESTAQIVQNEFSATPDKEVFSHAYALTPTHDYV*
Ga0138316_1146319813300010981MarineDEDDIMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYNLNYGEYPNNYGDNGIN*
Ga0138326_1047343813300010985MarineLSSECYGADEDDIMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFSSTGPDTTAFRHRYGLNYGAMPNNYGDNGIN*
Ga0138326_1052977713300010985MarineDEDDIMYDVFARYRVEEKNPLGAGTGVWKLPKGSGPQWAGDVIRKFNVMKDDQIDSYLAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGAISDMESTAQIVQNEFSATPDKEVFSHAYALTPTHDYV*
Ga0138326_1212210923300010985MarineVEEKNPLGAGTGVWKLPKGSGPQWAGDVIRKFNVMKDDQIDSYLAANFDNFWKKYDNNGTGEIYETEGETFMRALLGPNNRFRLAPGAISDMESTAQIVQNEFSATPDKENFKHAYALTPTHDYLGSGTGA*
Ga0136599_103080213300012030Saline LakeHLSNECYGADEDDIMYDIFDRYRVEERNPVGAGTGIWKLPKSSGPQWATDIIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFIRALLGPNNRYRLAPGALSDMDSASLHVQNEFSASPDLQPYRHRYELKDQDYPDGKHNLQ*
Ga0138261_126455513300012418Polar MarineHLSNECYGGDEDEIIYDVFERFRVEEKNPLGSGMGIFKLPKWSGPQWSRDIISHMHVMDEDKVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDNAELITQNKFSGTPDLKPFAHRYELV*
Ga0129328_113670113300012472AqueousAGTGVWKLPKGSGPEWAANVIQRFHVMDADKVNEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDTAAEIHNNQFSVKKEIKEFKWPYELSAGSGVESAPATTA*
Ga0129328_113826113300012472AqueousMYDVFERYRVEEKNPMGASTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQRIANEFSAGGDTTAFAHRYPIEQTSAYHLYPVSNPSAPPM*
Ga0129349_123788613300012518AqueousSSECYGADEDDIMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTAFYHRYDIAAPTVYQAYPVSNPSTVPQ*
Ga0129326_123890813300012522AqueousWKLPKASGPQWASDVVRRFHVMDNDKVDAYVKANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMKNEEEIHQNEFSATPDKRAFAHRYNLTDPDFSNNYNRVDIV
Ga0129331_124286513300012524AqueousYDVFARYRVEERNPVGAGTGIWKLPKNSGPTWAADVIRKFNVMKEDQVDTYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGAISDMATTAQIIQNEFSTTPDKEAFAHAYALTPTHTYADAAAAGK*
Ga0157630_112599913300012722FreshwaterMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQADKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHAIPDKVKFVHRYPLK*
Ga0157602_131309213300012730FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWAADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPLK*
Ga0157616_114468913300012731FreshwaterHLSNECYGADEDDIMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQADKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKVKFVHRYPLK*
Ga0138277_104179913300012751Freshwater LakeMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYYNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPLK*
Ga0157622_121249413300013310FreshwaterMLRADEDDIMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQADKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKKKFVHRYPLK*
Ga0180059_105832913300016695FreshwaterMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQADKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKVKFVHRYP
Ga0182085_105043613300016723Salt MarshDDIMYDVFARYRVEERNPVGAGTGIWKLPKSSGPSWAADIIRKFNVMKDDQIDSYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGAISDMASTAQIVQNEFSATPDKMAFAHAYSLTPTHTYGTAGGNAN
Ga0182051_124649923300016727Salt MarshMYDVFERYRVEERNPVGAGTGIWKLPKASGPQWASDVVRRFHVMDNDKVDAYVKANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMKNEEEIHQNEFSAAVDKRAFAHRYNLTDPDFANNYNRVDIV
Ga0182074_107187913300016735Salt MarshADEDDIMYDVFNRYRVEERNPLGAGTGIWKLPKSSGPQWAADIIRKFNVMKEEQVDQYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGAISDMASTAQIVQNEFSATPEKDAFAHAYSLTPTHTYAAAGGAGGK
Ga0182084_125193013300016762Salt MarshRNPVGAGTGIWKLPKASGPQWASDIIRRMHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHIQNEFSATPDILPFRHRYELKDQVYPDGRTALQ
Ga0182063_164687923300016781Salt MarshSNECYGADEDDIMYDVFERYRVEERNPVGAGTGIWKLPKSSGPEWASDIIRRFHVMDNDKVDAYVAANFDNFWRKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAAQVHQNQFSATPDKEPFAHRYPLA
Ga0181417_111973913300017730SeawaterYDVFERYRVEERNPVGAGTGIWKLPKASGPEWAADVVRRFHVMDDSKVDAYVAANFDNFWRKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSSAQIHQNQFSATPDKEPFQNRYKLDEAPTYVGGATGGAS
Ga0181420_119528423300017757SeawaterEDDIMYDVFARYRVEEKNPLGAGTGVWKLPKGSGPQWAGDVIRKFNVMKEDQINSYLAANFDNFWKKYDNNGTGEIYETEGETFMRALLGPNNRFRLAPGAISDMESTAQIVQNEFSATPDKEVFAHAYALTPTHDYVGSGTGA
Ga0181430_117404213300017772SeawaterRYRVEEKNPMGAGTGIWKLPKASGPQWAADVVRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSSADIHQNAFSTTPDIKPFAHRYNLDGSQAGAGAGGDVAK
Ga0181423_125748913300017781SeawaterELNPLGAGTGEWKLPKSSGPQWAADIIRKFNVMKDDQVDAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSATPDVDVFAHAYTIAPTAVAYPQGINPLQPGEENSFQENKSNYVDNGLA
Ga0181590_1061603113300017967Salt MarshEDDIMYDVFERYRVEEKNPLGAGTGVWKLPKGSGPEWAADIIRRFHVMDDDKVDDYVAANFENFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHIQNEFSASADILPFRHRYELKDQVYPDGRTALQ
Ga0192960_10540813300018515MarineDVFERYRVEEKNPFGAGTGIWKLPKNLGPQWSADVLRRFHVMAEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALMGPNNRFRLAEGALSDMDSAAQRIQNEFSATPATTAFAHRYNID
Ga0193060_101452313300018596MarineDEDDLMYDVFERYRVEEKNPVGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSKDAAVTPFYHRYNIAAPKEYQAYPVSNPSAAPE
Ga0193060_101864413300018596MarinePVGAGTGIWKLPKSSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAPGALSDMDSAGQLIQNEFSSAPAVTPFYHRYNIAAPAEYQAYPVSNPSAAPA
Ga0193355_101117113300018628MarineADEDDIMYDVFARYRVEERNPVGAGTGIWKLPKNSGPQWAADIVRKFNVMKEDQVDSYVAANFDNFWKKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGAISDMASTAQIVQNEFSATPEKDAFAHAYSLTPTHTYTAAGSGTTR
Ga0193355_101958913300018628MarineEEKNPVGAGTGIWKLPKNSGPQWAADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSAETAVTPFYHRYNIAAPVQYQAYPVSNPSAPPM
Ga0192944_102928713300018692MarineMYDVFERYRVEEKNPVGAGTGIWKMPKSSGPQWAADIIRKFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAGPASTPFYHRYNIAAPAEYQAYPVSNPSAATE
Ga0193517_108005413300018725MarineHLSNECYGADEDDIMYDVFERYRVEEKNPMGAGTGIWKLPKYSGPQWAGDVIHKFHVMDDDKVAAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAAEIQQNEFSAAPELKPFVHRYELV
Ga0192974_106608513300018739MarineADEDDIMYDVFERYRVEEKNPFGAGTGIWKLPKNSGPQWSADVLRRFHVMAEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALMGPNNRFRLAEGALSDMDSAAQRIQNEFSSTPATTAFAHRYTIDQPASYHAYPVSNPSAPPA
Ga0193534_107183913300018741MarineGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSATPAATPFYHRYPIDPPTSYHGYPVSNPSAPPA
Ga0193031_107698713300018765MarineDEDDIMYDVFERYRVEEKNPVGAGTGIWKLPKNSGPEWAADVIRRFNVMQESKINDYVAANFDKFWAKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGALSDMNSAGQLIQNEFSATPEVTTFGHLYNITAPTGDAAYGAYPVSNP
Ga0193031_107786013300018765MarineVFERYRVEEKNPVGAGTGIWKLPKNSGPQWSADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSKDGAVTPFYHRYNIAAPKEYQAYPVSNPSAAPE
Ga0193031_108071513300018765MarineDVFERYRVEEKNPLGAGTGIWKMPKNSGPQWAADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSGTPAVTPFYHRYDIAAPVEYQAYPVSNPSAPPL
Ga0193031_108112713300018765MarineYRVEEKNPVGAGTGIWKLPKASGPQWAADIIRRFHVMTEGKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSSTPAVTNFYHRYNIAAPVEYQAYPVSNPSEAPL
Ga0193181_103530213300018766MarineMYDVFERYRVEEKNPVGAGTGIWKMPKASGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPAVTPFYHRYNIDAPVQYQAYPVSNPSAAPL
Ga0193407_105949113300018776MarineVEEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSATPAVTPFYHRYPIDPPTSYHAYPVSNPSPPPM
Ga0193407_106116013300018776MarineRVEEKNPVGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSKDAAVTPFYHRYNIAAPKEYQAYPVSNPSAAPAE
Ga0193407_106298113300018776MarineDIMYDVFERYRVEEKNPVGAGTGIWKLPKSSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAGPAVTPFYHRYNIAAPVEYQAYPVSNPSAAPQ
Ga0193149_104450413300018779MarineEDDLMYDVFERYRVEEKNPVGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSKDAAVTPFYHRYNIAAPKEYQAYPVSNPSAAPE
Ga0192832_106157113300018782MarineQWASDVIRRMHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSATPDLRPYKHRYELKDMNYPDGRTAL
Ga0192950_106001513300018791MarineIMYDVFERYRVEEKNPVGAGTGIWKMPKSSGPQWAADIIRKFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAGPASTPFYHRYNIAAPAEYQAYPVSNPSAATE
Ga0193306_102967313300018800MarineMYDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSATPAVTPFYHRYPIDPPTSYHAYPVSNPSPPPM
Ga0193306_104485113300018800MarineMYDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGADVTPFYHRYPITQTSAYHAYPVSNPSPPPM
Ga0192949_110211713300018831MarineGTGIWKLPKSSGPQWAADIIRKFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAGPASTPFYHRYNIAAPAEYQAYPVSNPSAATE
Ga0193072_110090913300018861MarineVERYRVEEKNPFGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSATPAATPFYHRYPIDPPTSYHGYPVSNPSAPPA
Ga0193553_115264813300018873MarineIRRFHVMDNDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFIRALLGPNNRFRLAPGALSDMDSASLHVQNEFSATADLRPYKHRYELKDQDYPDGRSALQ
Ga0193028_111619313300018905MarineEDDLMYDVFERYRVEEKNPLGAGTGIWKLPKASGPQWAADVIRRFHVMTESKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFASETAVTPFYHRYNIAAPAEYQAYPVSNPSAPPM
Ga0192989_1008507113300018926MarineRYRVEERNPVGAGTGIWKLPKASGPQWAADIIRKFNVMKDENIDTYLQRNFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGAISDMESTAQIVQNEFAAKPEKDAFAHAYSLTPTHTYASASSTVVSGAPAGALPL
Ga0192989_1010899713300018926MarineMYDVFERYQVEENNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALLGPNNRFRLAPGALSDMDSTGQQIRNNFGGAPGESPTPFRHRYNLNYGEYPNNYGSNGVN
Ga0192989_1014926013300018926MarineIWKLPKNSGPQWSADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSSDPAVSPFYHRYPIDPPTSYHAYPVSNPSAPPA
Ga0192989_1015683213300018926MarineGIWKLPKASGPQWASDTIRRMHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRYRLAPGALSDMDSASLHVQNEFSATPDLRPYKHRYELKDMNYPDGRSSL
Ga0193260_1013061713300018928MarineEKNPLGAGTGIWKMPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSASPAVTPFYHRYDLAAPVEYQAYPVSNPSAPPL
Ga0193006_1021717013300018975MarineDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYNLNYGAYPNNYGDNGIN
Ga0193254_1011316313300018976MarineDDIMYDVFERYRVEEKNPLGAGTGIWKMPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPEVTPFYHRYDIAAPAIYQAYPVSNPSAPPVTGV
Ga0193353_1016196313300018977MarinePVAPGPYASDTDHLSSECYGADEDDIMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALLGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYNLNYGAYPNNYGDNGIN
Ga0193353_1022397813300018977MarineDDIMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFVGAPGESPTPFKHRYNLNYGEYPNNYGDNGIN
Ga0192947_1023399513300018982MarineYGGDEDDIMYDVFERYRVEEKNPVGAGTGIWKLPKASGPQWAADVVRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSASPDLLPYRHRYELTNQEYPDGRTKLQ
Ga0192947_1026714313300018982MarineVFERYQVEERNPMGAGTGIYKLPKASGPQWASDVVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIFVTEGETFMRALLGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYGLNYGAYPNNYGDNGIN
Ga0193030_1014154023300018989MarineMYDVFERYRVEEKNPVGAGTGIWKMPKSSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAGPAVTPFYHRYNIAAPAEYQAYPVSNPSEAPQ
Ga0193030_1015882223300018989MarineMYDVFERYRVEEKNPVGAGTGIWKMPKSSGPQWAADIIRKFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAGPATTPFYHRYNIAAPAEYQAYPVSNPSAAPE
Ga0193030_1018870913300018989MarineFERYRVEEKNPLGAGTGIWKMPKSSGPQWSADIIRRFHVMNEGKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSASPAVTPFYHRYNIAAPEKYQAYPVSNPSAPPE
Ga0193030_1022020713300018989MarineGADEDDIMYDVFERYRVEEKNPFGAGTGIWKLPKNSGPQWSADIIRRFHVMSEAKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSSGADTTAFYHRYPIEQTSAYHIYPVSNPSAPPA
Ga0193030_1023502913300018989MarineEDDIMYDVFERYRVEEKNPMGAGTGIWKMPKNSGPEWAADVIRRMNVMKEDKINEYVAANFDNFWKKYDNNGTGEIYESEAETFVRALLGPNNRFRLAPGALSDMSSAAQLIQNEFSATPAVTPFEHLYNITAPTDYQAYPVAAAVTP
Ga0193030_1024588113300018989MarineECYGADEDDIMYDVFERYRVEEKNPVGAGTGIWKLPKASGPQWSADIIRRFHVMTEGKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAQTAVTPFYHRYNIDAPVQYQAYPVSNPSEPPM
Ga0193030_1027821813300018989MarineVEEKNPVGAGTGIWKMPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAGQLIPNEFTAGGQTTPFYHRYNIDAPVQYQAYPVSNPSAPPL
Ga0193030_1028828913300018989MarineEDDIMYDVFERYRVEERNPFGAGTGIWKMPKASGPQWSADIIRRFHVMDESKIDEYVTANFDNFWKKYDNNGTGEIYESEAETFIRALMGPNNRFRLAEGALSDMDSAAQRIPNEFSATPDATPFAFRYPLDSGAAVNAYPVSNP
Ga0193257_1022790513300018997MarineKNPFGAGTGIWKLPKNSGPQWSADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFLRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGGAVTPFYHRYPIEQTSAYHIYPVMNPSAPPA
Ga0193034_1014457713300019001MarineAGTGIWKLPKASGPQWASDVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGALSDMDSAAQLIPNEFGAAGGDLIPFYHRYPILPPEEYHGYPVSNPSQPPM
Ga0193034_1016824113300019001MarineTWGYRVEEKNPLGAGTGIWKMPKASGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPAVTPFYHRYNIDAPVQYQAYPVSNPSAPPM
Ga0193034_1018466613300019001MarineGIWKMPKASGPQWSADIIRRFHVMDESKIDEYVTANFDNFWKKYDNNGTGEIYESEAETFIRALMGPNNRFRLAEGALSDMDSAAQRIPNEFSATPDATPFAFRYNLDSGAAVNAYPVSN
Ga0193033_1021637213300019003MarineCYGADEDDIMYDVFERFRVEEKNPMGQGTGIWKLPKNSGPEWSADILRRFNVMKEDKINDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTTFAHRYNITAPTDYNAYPVSNP
Ga0193044_1023863813300019010MarineEEKNPFGAGTGIWKLPKSSGPQWSADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFLRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGGAVTPFYHRYPIEQTSAYHIYPVMNPSAPPA
Ga0192982_1035286213300019021MarineEDDIMYDVFERYRVEEKNPMGAGTGIWKLPKASGPQWASDAVRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGETFLRALLGPNNRFRLAPGALSDMDSASLHMQNEFSGTPDLRPYKHRYELKDQDYPDGRSALQ
Ga0192951_1028997913300019022MarineDHLSNECYGGDEDEIMYDVFERFRVEEKNPLGSGMGIFKLPKWSGPQWSRDIISHMHVMDEDKVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDNAELITQNMFSATPSLTPFKHRYELV
Ga0192951_1035571013300019022MarinePIGAGTGIWKLPKSSGPQWAADIIRRFNVMKEDKIDEYIAANFDNFWKKYDNNGTGEIYESEGETFIRAILGPNNRFRLAEGALSDMDSAGQLIPNEFSANGAATVTPFYHRYEIKQDSDYKYYPGLNPDPKPTGDDTKK
Ga0193545_1012193413300019025MarineEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGAAVTPFYHRYPIEQTSAYHAYPVMNPSAPPA
Ga0193545_1012312413300019025MarineGMYDTFTRYRVEELNPLGAGTGVWKLPKASGPQWAADIIRKFNVMKDDAVDPYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSATPEVTPFAHAYSITPTAAMYPQGINGLQPEAAV
Ga0192909_1007261913300019027MarineMYDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSASPAVSPFYHRYPIDPPTSYHAYPVSNPSPPPM
Ga0193516_1024060813300019031MarineSSECYGADEDDIMYDVFERYRVEERNPFGAGTGIWKMPKASGPQWSADIIRRFHVMDETKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAEGALSDMDSAAQRIPNEFSATPDATPFAFRYDLAPAATVQAYPVSNP
Ga0192869_1036553213300019032MarineECYGGDEDEIMYDVFERFRVEEKNPLGSGMGIFKLPKWSGPQWSRDIISHMHVMDEDKVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDNAELITQNKFSATPDVKPFAHRYDLV
Ga0192869_1037581413300019032MarineDDIMYDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFLRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGAAVTPFYHRYPIEQTSAYHLYPVMNPSAPPA
Ga0192869_1041082613300019032MarineHLSAECYGGDEDDIMYDVFERYRVEEMNPVGAGTGIWKMPKSSGPEWAADVIRRMNVMKEDKINEYVTANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMESAGQLIQNEFSAEPAVTPFAHLYNITAPTDYQAYPVANNTASG
Ga0193037_1021504823300019033MarineMYDVFERYRVEEKNPLGTGTGIWKLPKWSGPQWAADIISHMHVMDADKVDAYIAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLSPGALSDMDNAETIVQNEFSKEKDIKPFAHRYQLV
Ga0193037_1027963313300019033MarineGPYASDTDHLSSECYGADEDDIMYDVFERYQVEERNPMGAGSGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYNLNYGAYPNNYGDNGIN
Ga0193336_1019048713300019045MarineMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPQWSADIIRKFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAGPAVTPFYHRYNIAAPKEYQAYPVSNPSAAPA
Ga0193336_1046685623300019045MarineHLSVECYGADEDDIMYDVFERYRVEEKNPLGAGTGIWKLPKASGPQWASDVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAAQLIPNEFGAAGGDLIPFYHRYPIAPPEEYHGYPVSNPSQPPPM
Ga0193336_1047842213300019045MarineDVFERYRVEEKNPLGAGTGIWKMPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSASPDVTPFYHRYNLTVNYSEMAAYPVSNPSSF
Ga0192981_1034476123300019048MarineGIWKLPKASGPQWAADVVRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSATPDLLPYRHRYELTNQEYPDGRTKLQ
Ga0192826_1021956013300019051MarineHLSSECYGADEDDIMYDVFERYRVEEKNPVGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSKDAAVTPFYHRYNIAAPKEYQAYPVSNPSAAPAE
Ga0192826_1023744913300019051MarineNECYGADEDDIMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSKDPAVTPFAHRYTIAPPKEYAIYP
Ga0192826_1027930913300019051MarineFERYRVEEKNPLGAGTGIWKMPKASGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTAFYHRYNIAAPEKYQAYPVSNPSAPPL
Ga0188866_101558213300019095Freshwater LakeMYDTFARYRVEELNPLGAGTGVWKLPKNSGPQWAADILRKFNVMKDDQVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSADVVPDTFAHAYTITPTALMYPQGINDAVPE
Ga0188866_101752323300019095Freshwater LakeMYDTFARYRVEELNPLGAGTGVWKLPKNSGPQWAADILRKFNVMKDDQVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSVVPEADVFAHAYTINATAPAYPQGINDKQPEA
Ga0192946_104337813300019103MarineIMYDTFERYRVEERNPLGAGTDTWKLPKNSGPQWAADVIRKMNVMKDDQVDPYITANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSAEPEVTPFAHAYTITATAAAYPQGINDAAPEADAKK
Ga0192946_104949713300019103MarinePFGAGTGIWKLPKNSGPQWSADVLRRFHVMAEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALMGPNNRFRLAEGALSDMDSAAQRIQNEFSATPATTAFAHRYNID
Ga0193243_104811423300019116MarineFGAGTGIWKLPKNSGPQWAADIVRRFHVMSEAKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSAGGDTTAFAHRYPIEQTSEYHAYPVSNPSAPPA
Ga0193157_102625313300019118MarineYGADEDDIMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYTTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYNLNYGAYPNNYGDNGIN
Ga0193157_103415613300019118MarineDEDDIMYDVFERYRVEEKNPMGQGTGIWKLPKNSGPEWSADILRRFNVMKEDKINDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTTFAHRYNITAPTDYNAYPVSNP
Ga0193157_103474613300019118MarineHGGAGTGIWKLPKASGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSATPAVTNFYHRYNIAAPSEYQAYPVSNPSAAPL
Ga0192980_106345613300019123MarineERYRVEEKNPFGAGTGIWKLPKNSGPQWSADVLRRFHVMAEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALMGPNNRFRLAEGALSDMDSAAQRIQNEFSSTPATTAFAHRYTIDQPASYHAYPVSNPSAPPA
Ga0192980_107955413300019123MarineGAGTGIWKLPKNSGPQWAADVVRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALMGPNNRFRLAEGALSDMDSAAQRIQNEFSAGGAVTPFAHRYPIEQTSAYHVYPVSNPSEAPAF
Ga0193436_105531113300019129MarineIMYDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAAQMIQNEFSATPAVTPFYHRYPIDPPTSYHAYPVSNPSPPPM
Ga0188870_1007710023300019149Freshwater LakeMYDAFERYRVEEKNPLGAGTGIWKLPKSSGPQWSADIIRKFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAQPAVTPFYHRYNISAPEAYQAYPVSNPSASPA
Ga0188870_1013189113300019149Freshwater LakeAGTGTYKLPKSSGPQWAADIIRKLNVMKDDQVDSYVSANFDNFWKKYDNNGTGEIYETEGEVFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSDTPDLSVFAHAYTIAPTTSAPYPQGANPLQPESF
Ga0182064_131039613300019253Salt MarshMYDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSAAPDLRPYKHRYELKDQDYPDGRRAL
Ga0182059_114256313300019272Salt MarshDDIMYDVFERYRVEEKNPLGAGTGVWKLPKGSGPQWAADIVRRFHVMDDDKVNDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDLDSAAQIHQNQFSKTPDIKTFTVNPTTYGVAAAPAAPPA
Ga0211734_1062379423300020159FreshwaterMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQADKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKVKFVHRYPLKXNLLNSN
Ga0211729_1071394913300020172FreshwaterMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIIRRLHVIQADKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKVKFVHRYPLK
Ga0206696_107948813300021334SeawaterGPQWASDVVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYETEGETFMRALLGPNNRFRLAPGALSDMDTASQQIQNNFSATPDKTAFGHRYSLHYDDYPNNYAPEIFRQGISGVN
Ga0206696_140917413300021334SeawaterVWKLPKGSGPEWSADVIRRFHVMDDTKVNDYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSADPAVTGFYHRYPIDPPTSYHAYPVSNPSAPPA
Ga0206691_116690913300021342SeawaterGTGIYKLPKSSGPQWAADAIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMNTAELHVQNEFSATPDLRPFAHRYPLADQAYPDGRTA
Ga0206695_145958613300021348SeawaterDHLSSECYGADEDDIMYDIFERYRVEEKNPNGAGTGIWKLPKYSGPDWSAAIIKHFNVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAEGALSDMASAAQIHQNEFSATPDIEKFKHRYELV
Ga0206692_113667613300021350SeawaterRNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGVPGGPTPFRHRYALNYGDMPNNYGDNGIN
Ga0206689_1007157413300021359SeawaterERYRVEEKNPMGQGTGIWKLPKNSGPEWSADIIRRFNVMTESKINDYVAANFDNFWKKYDNNGTGEIYESEGETFMLALLGPNNRFRLAPGALSDMNSAGQLIQNEFHASPDVTPFAHLYNITAPTDYAAYPVSNP
Ga0213868_1041440713300021389SeawaterSECYGADEDDIMYDVFERYRVEERNPVGAGTGIWKLPKASGPQWASDVVRRFHVMDNDKVDAYVKANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMKNEEEIHQNEFSAAVDKRAFAHRYNLTDPDFANNYNRVDIV
Ga0063132_11480213300021872MarineRVEERNPLGAGTGVWKLPKNSGPQWAADILRKFNVMKDDQVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSATPEADTFAHAYTITPTAVAYPQGINALAPGEENSFQENKSNYEDNGLA
Ga0063117_102907813300021881MarineIMYDVFERYRVEEKNPLGAGTGIWKLPKASGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSATPAVTNFYHRYNIAAPSEYQAYPVSNPSAPPL
Ga0063089_105558613300021889MarineDDIMYDVFERYRVEEKNPMGASTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQRIANEFSAGGDTVAFAHRYPIEQTSAYHLYPVSNPSAPPM
Ga0063136_101318913300021896MarineVFERYRVEEKNPFGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSADPAATPFYHRYPIDPPTSYHAYPVSNPSAPPA
Ga0063133_100435513300021912MarineMYDVFERYRVEEKNPVGAGTGIWKMPKSSGPQWAADIIRKFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAGPAVTPFYHRYNIAAPAEYQAYPVSNPSAAPQ
Ga0063133_104604913300021912MarineIMYDVFERYRVEEKNPLGAGTGIWKMPKASGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSASPDATPFYHRYNIDAPVQYQAYPVSNPSAPPL
Ga0063104_110358713300021913MarineSGPQWASDVIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSAAADLKPYKHRYELKDQDYPDGRSALQ
Ga0063139_101860813300021934MarineEDDIMYDVFERYRVEEKNPLGAGTGIWKMPKSSGPQWSADIIRRFHVMNEGKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSASPAVTPFYHRYNIAAPEKYQAYPVSNPSAPPE
Ga0222716_1059537113300021959Estuarine WaterERYRVEERNPVGAGTGIWKLPKASGPEWAADVVRRFHVMDDSKVDAYVAANFDNFWRKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSSAQIHQNQFSATPDKEAFQHRYKIDEAPTYVGGVTGGAS
Ga0224906_119049623300022074SeawaterIMYDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGAEVTPFYHRYPIEQTSAYHAYPVSNPSAPPA
Ga0210310_102270413300022369EstuarineIMYDTFARYRVEELNPLGAGTGVCKLPKNSGPQWAADILRKFNVMKDDQVDAYVSANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSVVPEADTFAHAYTITPTAVAYPQGINDAVPE
Ga0255752_1027736013300022929Salt MarshADEDDIMYDVFERYRVEERNPVGAGTGIWKLPKASGPQWASDVVRRFHVMDNDKVDAYVKANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMKNEEEIHQNEFSATPDKRAFAHRYNLTDPDFANNYNRVDIV
(restricted) Ga0233410_1028354013300023276SeawaterMYDVFERYRVEEKNPQGAGTGVYKLPKYSAPTWAHDIITHFHVMDDDKVDAYIAANLDNFWHKYDNNGSGEIFESEGETFIRALLGPNNRFRLAPGALSDMDNAELIVPNKFSATNDHITFAHRYPLA
Ga0228679_103423213300023566SeawaterGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGGAVTPFYHRYPIEQTSAYHLYPVMNPSAPPA
Ga0228684_103994513300023704SeawaterMYDVFERYRVEEKNPFGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSASPAVSPFYHRYPIDPPTSYHAYPVSNPSPPPM
Ga0228684_107042013300023704SeawaterNPLGAGTGIWKMPKASGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSASPAVTPFYHRYNIAAPVQYQAYPVSNPSAPPE
Ga0209634_117334713300025138MarineHLSSECYGADDDDIMYDVFERYRVEEKNPLGAGTGIWKMPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSATPEATPFYHRYDIAAPSVYQAYPVSNPSAPPVTG
Ga0209634_124107413300025138MarineMYDVFERYRVEEKNPVGAGTGIWKLPKSSGPQWAADIVRKFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSATPEATPFYHR
Ga0208866_100414413300025340FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPLK
Ga0208254_101258313300025355FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDANVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPLK
Ga0208108_102854213300025367FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPL
Ga0208382_103786913300025369FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVQTHEFVFVVATIILAILMMLIL
Ga0208380_105132413300025392FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVH
Ga0208874_103492013300025396FreshwaterYGADEDDIMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRYPLK
Ga0208106_107841813300025449FreshwaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPQWSADIIRRLHVIQEDKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADYIQNEFHATPDKKKFVHRY
Ga0208005_117014913300025848AqueousVEEKNPLGAGTGIWKLPKASGPQWAADIIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASQHIQNNFSATPDVLPFRHRYELKDQDYADGRHAL
Ga0209308_1043333613300025869Pelagic MarineDTDHLSSECYGADEDDIMHDIFERYRVEEKNPLGAGTGIWKLPKYSGPQWAAAVVKHFHVMDDDKVDAYVAANFDNFWHKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAEGALSDMDSAAQIHQNEFSEKPDLQKFKHRYALV
Ga0209309_1034727713300025881Pelagic MarineRVEEKNPMGAGTGIWKLPKASGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTPFAHRYEIAPPTAYHGYPVSNPSAPPS
Ga0208275_104514813300026182MarineMYDVFERYRVEEKNPIGAGTGIWKLPKYSGPQWASDVIRRFHIMQDGKVDAYVAANFDNFWKKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGALSDMDNAEMIHQNEFSKAPQLTAFAHRYGMTADDANNWQR
Ga0247594_106939713300026448SeawaterDIMYDVFERYRVEEKNPMGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALMGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTAFAHRYTIEAPTAYHGYPVSNPSAPPM
Ga0247594_108824613300026448SeawaterKNPLGAGTGIWKMPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSASPAVTPFYHRYNIAAPVQYQAYPVSNPSAPPE
Ga0247578_109601313300026458SeawaterRVEEKNPFGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSADPAVTGFYHRYPIDPPTSYHAYPVSNPSAPPA
Ga0247568_109870613300026462SeawaterVFERYRVEEKNPLGAGTGIWKMPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSASPAVTPFYHRYNIAAPVQYQAYPVSNPSAPPE
Ga0247588_106727123300026465SeawaterMSVECYGADEDDIMYDVFERFRVEEKNPMGSGTGIWKLPKNSGPEWSADILRRFNVMKEDKINDYVAANFDNFWKKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSATPDVTAFAHRYNITAPTEYAAYPVSNP
Ga0247603_109737913300026468SeawaterECYGADEDDIMYDVFERYRVEEKNPMGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEFFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGAEATPFYHRYPIEQTSAYHAYPVSNPSPPPM
Ga0247590_111922113300026513SeawaterKNPVGAGTGIWKLPKNSGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKRYDNNGTGEIYESEAETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSASPAVTPFYHRYNIAAPEKYQAYPVSNPSAPPTE
Ga0208025_105130113300027225EstuarineYRVEERNPVGAGTGIWKLPKASGPQWASDIIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYETEGEVFMRALLGPNNRFRLAPGALSDMENDELWVPNDFSATPDHKTGPYVHRYALDDGPFGNGYNKNG
Ga0209071_122368513300027686MarineIMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDVVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIFVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGIPGPPTAFRHRYALNYGDMPNNYGDNGIN
Ga0209710_113426613300027687MarineMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYIAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFAANGGASVTPFAHRYNIEQTSSYNIYPVANPSPAPTDDTSKK
Ga0209192_1018102313300027752MarineMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYIAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFAANGAASVTPFAHRYTIDQTSSYNIYPVANPSPAPTDDTSKKXKNEIKLDPQKQLNCHYL
Ga0209091_1053599813300027801MarineAGTGIWKLPKSSGPQWAADIVRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSSTPELTPFFHRYEIAPPDEYKLYPNVNATSSNDNNDKKE
Ga0247586_107664913300028102SeawaterEDDIMYDVFERYRVEEKNPMGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALMGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTPFAHRYTIEAPTAYHGYPVSNPSAPPM
Ga0247586_109176513300028102SeawaterEKNPFGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSADPAVTGFYHRYPIDPPTSYHAYPVSNPSAPPA
Ga0247586_109679513300028102SeawaterNPFGAGTGIWKLPKSSGPQWSADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFLRALLGPNNRFRLAEGALSDMDSAAQMIQNEVSAGGAVTPFYHRYPIEQTSAYHLYPVMNPSAPPA
Ga0247582_105836113300028109SeawaterMYDVFERYRVEEKNPFGAGTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSADPAVTGFYHRYPIDPPTSYHAYPVSNPSAPPA
Ga0256412_119276113300028137SeawaterMYDVFERYRVEEKNPLGAGTGIWKMPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPEVTPFYHRYDIAAPSVYQAYPVSNPSAPPVTGA
Ga0256412_122634413300028137SeawaterVEEKNPLGAGTGIWKLPKSSGPQWSADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFIRALMGPNNRFRLAPGALSDMDSAGQLIQNEFSASQDQTAFYHRYNIAAPTAYQAYPVSNPSAPPL
Ga0256412_125623723300028137SeawaterVFARYRLEEKNPQGAGTGVYKLPKYSGPQWAADIIKHFNVMDESKVDEYVAANFDNFWHKYDNNGTGEIYESEGETFMRALMGPNNRFRLAPGALSDLDNAELIEPNMFSAGKERKNFTHRYTLPGYDTNKALGY
Ga0256412_135668513300028137SeawaterGIWKLPKNSGPQWSADIIRRFHVMTEDKIDEYVAANSDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSASPAVSPFYHRYPIDPPTSYHAYPVSNPSPPPM
Ga0247597_105937613300028334SeawaterGTGIWKLPKSSGPQWSADVIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGAEATPFYHRYPIEQTSAYHAYPVSNPSPPPM
Ga0304731_1103145713300028575MarineMYDVFARYRVEEKNPLGAGTGVWKLPKGSGPQWAGDVIRKFNVMKDDQIDSYLAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGAISDMESTAQIVQNEFSATPDKEVFSHAYALTPTHDYV
Ga0304731_1103372513300028575MarineDEDDIMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALMGPNNRFRLAPGALSDMDSTGQQIINNFGGAPGESPTPFKHRYNLNYGEYPNNYGDNGIN
Ga0307398_1040910513300030699MarineMYDVFERYRVEERNPLGAGTGIWKLPKSAGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFLRALLGPNNRFRLAEGALSDMDSAGQLIPNEFAANGAATVTPFYHRYEIEQTSAYKYYPGLNPDPKPTEEKK
Ga0307398_1050517413300030699MarineECYGGDEDDIMYDVFERYRVEEKNPVGAGTGIWKLPKASGPQWAADVVRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSASPDLLPYRHRYELTNQEYPDGRTKLQ
Ga0307399_1051534713300030702MarineGTGIWKLPKASGPQWASDVIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSAAADLRPYKHRYELKDQDYSDGRSSLQ
Ga0073988_1229199713300030780MarineYGADEDDIMYDVFERYQVEERNPMGAGTGIYKLPKASGPQWASDIVRRFHVMDNDKVDAYVAANFDNFWNKYDNNGTGEIYVTEGETFMRALLGPNNRFRLAPGALSDMDSTGQQIRNNFGGMGGESPSPFKHRYGLNYGEYPNNYGDNGIN
Ga0073964_1005246313300030788MarineDIMYDTFARYRVEEKNPVGAGTGIWKLPKSSGPTWAADIIRKMNVMKDDQVDAYLAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMESSAQIVQNEFSATPDKTPFAHAYPIKAEAAGYNPSPAAAGGDKGGKAEAPAEK
Ga0073964_1158095813300030788MarineHVRHVRRYRVEERNPLGAGTGVWKLPKNSGPQWAADIIRKFNVMKDDQVDAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSATPDVDVFAHAYPITPTAPMYPQGINPLQPGEENSFQENKSNYKDNGLA
Ga0073990_1201799613300030856MarineKNPLGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSKEPAVTPFYHRYNIAAPAAYQAYPVSNPSAAPA
Ga0073990_1203382713300030856MarineKSSGPQWAADIIRKFNVMKDDQVDSYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSDTPDVSVFAHAYPITATAPAYPQGINTAAPGDDLPGGSPGLSADGNQNQDLGAITPAA
Ga0073990_1205008313300030856MarineIMYDVFERYRVEEKNPFGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAEGALSDMDSAAQMIQNEFSAGADVTPFYHRYPIEQTSAYHAYPVSNPSAPPA
Ga0073981_1165441813300030857MarineMYDVFERYRVEEKNPVGAGTGIWKLPKSSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPAVTPFYHRYNIAAPVEYQAYPVSNPSAPPS
Ga0073989_1349136013300031062MarineDDIMYDVFERYRVEEKNPLGAGTGIWKMPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSAAPDFTQFYHRYDIAAPTQYQAYPVSNPSLPPV
Ga0073989_1354105313300031062MarineAKDIDHLSAECYGADEDDIMYDTFARYRVEERNPLGAGTGVWKLPKESGPQWAADIIRKFNVMKDDQVDSYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSATPEADTFAHAYPITPTAAMYPQGINPVQPEA
Ga0308148_102876113300031557MarineDDIMYDVFERYRVEEKNPMGASTGIWKLPKASGPQWAADIIRRFHAMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTAFAHRYEISPPSAYHGYPVSNPSAPPS
Ga0307396_1045646713300031717MarineMYDVFERYRVEERNPVGAGTGIWKLPKSSGPEWASDVTRKFHVMDNDKVDAYVAANFDNFWRKYDNNGTGEIYESEGETFMRALLGPDNRFRLAPGALSDMDSSAQVHQNQFSTTPDKEAFAHRYPLESMLMSLVPT
Ga0307396_1058037113300031717MarineADEDDIMYDVFERYRVEERNPLGAGTGIWKLPKSAGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFLRALLGPNNRFRLAEGALSDMDSAGQLIPNEFAANGAATVTPFYHRYEIEQTSAYKYYPGLNPDPKPTEEKK
Ga0307381_1021333113300031725MarineRYRVEERNPIGAGTGIWKLPKASGPLWAADIVRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSSTPELTPFFHRYEITAPTEYKLYPLAGAPEEKKEEK
Ga0307391_1048001713300031729MarineMPKASGPQWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEAETFMRALLGPNNRFRLAEGALSDMDSAAQLIPNEFSSATDVTPFYHRYEIADPSAEYKAYPVANPSIDTPTK
Ga0307397_1034199813300031734MarineMYDVFERYRVEERNPIGAGTGIWKLPKASGPLWAADIVRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSSTPELTPFFHRYEITAPTEYKLYPLAGAPEEKKEEK
Ga0307383_1059472213300031739MarineTDHLSAECYGADEDDIMYDVFERYRVEERNPAGAGTGIWKLPKASGPQWAADVVRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFLRALLGPNNRFRLAPGALSDMDSASLHVQNEFSATPDLRPFAHRYPLADVDYPQAREKL
Ga0307383_1065830913300031739MarineERYRVEERNPMGAGTGIWKLPKAAGPQWSSDVIRRMHVMDNDKVNAYVAANFDNFWKKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSASLHVQNEFSAAADLRPYKHRYELKDQDYSDGRSSLQ
Ga0307382_1034410713300031743MarineMNPIGAGTGIWKLPKSSGPEWAGDIVRRFNVMKDEQVDSYVAANFDNFWKKYDNNGSGEIYESEAETFIRALLGPNNRFRLAPGALSDMEGSGQYVQNEFSATPDAANFTHAYEITPTHDYASNTTGGDAAAGGAAV
Ga0307404_1049735013300031752MarineWASDVIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYESEGEVFMRALLGPNNRFRLAPGALSDMDSASLHVQNEFSAAADLRPYKHRYELKDQDYSDGRSSLQ
Ga0314684_1067145513300032463SeawaterLSSECYGADEDDIMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIVRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSSTPELTPFYHRYEIAPPDEYKLYPLTNVTTDNADDKK
Ga0314684_1075788513300032463SeawaterSAECYGADEDDIMYDTFERYRVEERNPLGAGTGTWKLPKNSGPQWAADVIRKMNVMKDDQVDAYIAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSAEPDVSVFAHAYPITATAAAYPQGINDAAPEAEAKK
Ga0314670_1033103213300032470SeawaterMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIVRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSSTPELTPFYHRYEIAPPDEYKLYPLTNVTTDNADDKK
Ga0314670_1072130413300032470SeawaterEKNPMGASTGIWKLPKSSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTPFAHRYVIEAPAAYHAYPVSNPSAPPM
Ga0314688_1056710413300032517SeawaterAECYGADEDDIMYDTFERYRVEERNPLGAGTGTWKLPKNSGPQWAADVIRKMNVMKDDQVDAYIAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSAEPDVSVFAHAYPITATAAAYPQGINDAAPEAEGKK
Ga0314689_1061752623300032518SeawaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYIAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFAANGAASVTPFAHRYNIEQTSSYNIYPVSN
Ga0314677_1040628913300032522SeawaterMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIVRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSSTPELTPFYHRYEIAPPDEYKLYPLTNVTTDNSDDKK
Ga0314682_1044443213300032540SeawaterMYDVFERYRVEERNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYIAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFAANGAASVTPFAHRYNIEQTSSYNIYPVSNPSPAPTDDTSKK
Ga0314671_1053689913300032616SeawaterMYDVFERYRVEERNPVGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYIAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFAANGAASVTPFAHRYNIEQTSSYNIYPVSNPSPAPTDDTSKKXKNEIKLDPQKQL
Ga0314671_1079938913300032616SeawaterFERYRVEEKNPMGAGTGIWKLPKASGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTPFAHRYVIEAPAAYHAYPVSNPSAPPM
Ga0314687_1065992613300032707SeawaterDDIMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIVRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSASTDVTPFAHRYEIAQPDKYNVYPPVNASKDDPNAK
Ga0314687_1075061013300032707SeawaterVWKLPKGSGPEWASDVVRRFHVMDDDKVNDYVAANFDNFWKKYDNNGTGEIYESEGETFLRALLGPNNRFRLAPGALSDMDSTAQIHQNQFSTTPDLIPFAHAYELGPGSAPAAPA
Ga0314669_1051654013300032708SeawaterEEKNPLGAGTGIWKMPKNSGPQWAADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAPGALSDMDSAGQLIQNEFSATPEATPFYHRYDISAPSIYQAYPVSNPSLPPA
Ga0314672_132648413300032709SeawaterEKNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFSASGNATVTPFYHRYEIDQTSAYKLYPVMNPSPAPTEDKK
Ga0314686_1061287613300032714SeawaterKNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFSASGNATVTPFYHRYEIDQTSAYKLYPVMNPSPAPTEDKK
Ga0314710_1047525613300032742SeawaterMGASTGIWKLPKNSGPQWSADIIRRFHVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESETETFIRALLGPNNRFRLAEGALSDMDSAAQRIQNEFSATPAVTPFAHRYEIAPPSAYHGYPVSNPSAPPS
Ga0314713_1039350613300032748SeawaterFERYRVEEKNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFSASGNATVTPFYHRYEIDQTSAYKLYPVMNPSPAPTEDKK
Ga0314708_1010480713300032750SeawaterMYDVFERYRVEEKNPLGAGTGIWKLPKSSGPTWAADIIRRFNVMKEDKIDEYVAANFDNFWKKYDNNGTGEIYESEGETFMRAILGPNNRFRLAEGALSDMDSAGQLIPNEFSASGNATVTPFYHRYEIDQTSAYKLYPVMNPSPAPTEDKK
Ga0314694_1041623313300032751SeawaterDTFERYRVEERNPLGAGTGTWKLPKNSGPQWAADVIRKMNVMKDDQVDAYIAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSAEPDVSVFAHAYPITATAAAYPQGINDAAPEAEGKK
Ga0314692_1031824913300032754SeawaterMYDVFERYRVEERNPIGAGTGIWKLPKSSGPQWAADIVRRFNVMKEDKIDDYVAANFDNFWKKYDNNGTGEIYESEGETFIRALMGPNNRFRLAEGALSDMDSAAQLIPNEFSSTPELTPFYHRYEIAPPDEYKLYPLTNVTTDNADDKK
Ga0314709_1074213213300032755SeawaterDHMSAECYGADEDDIMYDTFERYRIEERNPLGAGTGTWKLPKNSGPQWAADVIRKMNVMKDDQVDAYIAANFDNFWKKYDNNGTGEIYESEGETFMRALLGPNNRFRLAPGALSDMESTAQIVQNEFSAEPDVSVFAHAYPITATAAAYPQGINDAAPEAEGKK
Ga0310130_0181766_1_4023300034073Fracking WaterVEERNPVGAGTGIWKLPKASGPQWASDIIRRFHVMDDDKVNAYVAANFDNFWKKYDNNGTGEIYETEGEVFMRALLGPNNRFRLAPGALSDMENDELWVPNEFSATPDHKTGPYVHRYNLDDGPFGNGYNKIG
Ga0335049_0655925_301_6423300034272FreshwaterIGAGTGIWKLPKSSGPQWAADIIRRLHVIQADKIDAYVAANFDNFWAKYDNNGTGEIYESEGETFIRALLGPNNRFRLAPGALSDMDSHADIIQNEFHATPDKVKFVHRYPLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.