Basic Information | |
---|---|
Family ID | F013103 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 274 |
Average Sequence Length | 42 residues |
Representative Sequence | VGVEKGTKAVISVNFSAYGERTFNNLRANFAGEIPRKEFFNS |
Number of Associated Samples | 180 |
Number of Associated Scaffolds | 274 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 27.57 % |
% of genes near scaffold ends (potentially truncated) | 74.82 % |
% of genes from short scaffolds (< 2000 bps) | 78.83 % |
Associated GOLD sequencing projects | 164 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.24 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.803 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.518 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.628 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.285 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 274 Family Scaffolds |
---|---|---|
PF00072 | Response_reg | 1.82 |
PF13620 | CarboxypepD_reg | 1.82 |
PF01035 | DNA_binding_1 | 1.82 |
PF14559 | TPR_19 | 1.46 |
PF03544 | TonB_C | 1.46 |
PF14534 | DUF4440 | 1.09 |
PF15594 | Imm50 | 1.09 |
PF07883 | Cupin_2 | 1.09 |
PF08238 | Sel1 | 0.73 |
PF03551 | PadR | 0.73 |
PF02371 | Transposase_20 | 0.73 |
PF00691 | OmpA | 0.73 |
PF01548 | DEDD_Tnp_IS110 | 0.73 |
PF07238 | PilZ | 0.73 |
PF13671 | AAA_33 | 0.73 |
PF14684 | Tricorn_C1 | 0.73 |
PF13432 | TPR_16 | 0.73 |
PF00903 | Glyoxalase | 0.73 |
PF00982 | Glyco_transf_20 | 0.73 |
PF13424 | TPR_12 | 0.73 |
PF00106 | adh_short | 0.73 |
PF13751 | DDE_Tnp_1_6 | 0.73 |
PF06877 | RraB | 0.36 |
PF13418 | Kelch_4 | 0.36 |
PF14437 | MafB19-deam | 0.36 |
PF13472 | Lipase_GDSL_2 | 0.36 |
PF13602 | ADH_zinc_N_2 | 0.36 |
PF12390 | Se-cys_synth_N | 0.36 |
PF03572 | Peptidase_S41 | 0.36 |
PF03473 | MOSC | 0.36 |
PF01315 | Ald_Xan_dh_C | 0.36 |
PF01590 | GAF | 0.36 |
PF00939 | Na_sulph_symp | 0.36 |
PF12681 | Glyoxalase_2 | 0.36 |
PF13520 | AA_permease_2 | 0.36 |
PF01553 | Acyltransferase | 0.36 |
PF12893 | Lumazine_bd_2 | 0.36 |
PF01068 | DNA_ligase_A_M | 0.36 |
PF01950 | FBPase_3 | 0.36 |
PF11329 | DUF3131 | 0.36 |
PF13411 | MerR_1 | 0.36 |
PF02358 | Trehalose_PPase | 0.36 |
PF08843 | AbiEii | 0.36 |
PF03403 | PAF-AH_p_II | 0.36 |
PF09278 | MerR-DNA-bind | 0.36 |
PF00571 | CBS | 0.36 |
PF11937 | DUF3455 | 0.36 |
PF01641 | SelR | 0.36 |
PF03284 | PHZA_PHZB | 0.36 |
PF02652 | Lactate_perm | 0.36 |
PF00027 | cNMP_binding | 0.36 |
PF01402 | RHH_1 | 0.36 |
PF11838 | ERAP1_C | 0.36 |
PF12706 | Lactamase_B_2 | 0.36 |
PF01618 | MotA_ExbB | 0.36 |
PF02075 | RuvC | 0.36 |
PF12697 | Abhydrolase_6 | 0.36 |
PF04116 | FA_hydroxylase | 0.36 |
PF13188 | PAS_8 | 0.36 |
PF03720 | UDPG_MGDP_dh_C | 0.36 |
PF06662 | C5-epim_C | 0.36 |
PF06439 | 3keto-disac_hyd | 0.36 |
PF13200 | DUF4015 | 0.36 |
PF12695 | Abhydrolase_5 | 0.36 |
PF02837 | Glyco_hydro_2_N | 0.36 |
PF00486 | Trans_reg_C | 0.36 |
PF09346 | SMI1_KNR4 | 0.36 |
PF00117 | GATase | 0.36 |
PF13466 | STAS_2 | 0.36 |
PF11154 | DUF2934 | 0.36 |
PF04087 | DUF389 | 0.36 |
PF01565 | FAD_binding_4 | 0.36 |
PF00355 | Rieske | 0.36 |
PF04079 | SMC_ScpB | 0.36 |
PF05048 | NosD | 0.36 |
PF13450 | NAD_binding_8 | 0.36 |
PF07690 | MFS_1 | 0.36 |
PF13442 | Cytochrome_CBB3 | 0.36 |
PF08447 | PAS_3 | 0.36 |
PF00326 | Peptidase_S9 | 0.36 |
PF08308 | PEGA | 0.36 |
PF06537 | DHOR | 0.36 |
PF00248 | Aldo_ket_red | 0.36 |
PF13414 | TPR_11 | 0.36 |
PF13229 | Beta_helix | 0.36 |
PF00821 | PEPCK_GTP | 0.36 |
PF02785 | Biotin_carb_C | 0.36 |
PF00510 | COX3 | 0.36 |
PF05960 | DUF885 | 0.36 |
PF03725 | RNase_PH_C | 0.36 |
PF01663 | Phosphodiest | 0.36 |
PF13590 | DUF4136 | 0.36 |
COG ID | Name | Functional Category | % Frequency in 274 Family Scaffolds |
---|---|---|---|
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 1.82 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 1.82 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.46 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.46 |
COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.73 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.73 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.73 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.73 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.36 |
COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.36 |
COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.36 |
COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.36 |
COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.36 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.36 |
COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 0.36 |
COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 0.36 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.36 |
COG1620 | L-lactate permease | Energy production and conversion [C] | 0.36 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.36 |
COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 0.36 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.36 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.36 |
COG1980 | Archaeal fructose 1,6-bisphosphatase | Carbohydrate transport and metabolism [G] | 0.36 |
COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.36 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.36 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.36 |
COG3076 | Regulator of RNase E activity RraB | Translation, ribosomal structure and biogenesis [J] | 0.36 |
COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.36 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.36 |
COG4188 | Predicted dienelactone hydrolase | General function prediction only [R] | 0.36 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.80 % |
Unclassified | root | N/A | 29.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10012428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7141 | Open in IMG/M |
3300001593|JGI12635J15846_10246807 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300001593|JGI12635J15846_10357209 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300001593|JGI12635J15846_10380309 | Not Available | 857 | Open in IMG/M |
3300001593|JGI12635J15846_10730452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 569 | Open in IMG/M |
3300002562|JGI25382J37095_10116739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
3300004152|Ga0062386_100014463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5666 | Open in IMG/M |
3300004152|Ga0062386_100112303 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
3300004152|Ga0062386_100699320 | Not Available | 832 | Open in IMG/M |
3300005167|Ga0066672_10381694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300005167|Ga0066672_10673862 | Not Available | 665 | Open in IMG/M |
3300005171|Ga0066677_10108158 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
3300005172|Ga0066683_10097811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1778 | Open in IMG/M |
3300005172|Ga0066683_10403540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300005176|Ga0066679_10205474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
3300005177|Ga0066690_10215742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1280 | Open in IMG/M |
3300005177|Ga0066690_10955813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
3300005181|Ga0066678_10673742 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005181|Ga0066678_10693385 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005186|Ga0066676_10564540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 771 | Open in IMG/M |
3300005447|Ga0066689_10249872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
3300005447|Ga0066689_10622680 | Not Available | 679 | Open in IMG/M |
3300005450|Ga0066682_10552084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 728 | Open in IMG/M |
3300005540|Ga0066697_10717194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300005553|Ga0066695_10103273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1749 | Open in IMG/M |
3300005553|Ga0066695_10291252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
3300005553|Ga0066695_10423734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 822 | Open in IMG/M |
3300005555|Ga0066692_10013669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3935 | Open in IMG/M |
3300005556|Ga0066707_10144707 | Not Available | 1502 | Open in IMG/M |
3300005557|Ga0066704_10290926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
3300005558|Ga0066698_10221680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1298 | Open in IMG/M |
3300005559|Ga0066700_10036484 | All Organisms → cellular organisms → Bacteria | 2925 | Open in IMG/M |
3300005574|Ga0066694_10544670 | Not Available | 540 | Open in IMG/M |
3300005586|Ga0066691_10395918 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300005586|Ga0066691_10469211 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 752 | Open in IMG/M |
3300005598|Ga0066706_10042379 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
3300005598|Ga0066706_11278206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 555 | Open in IMG/M |
3300006050|Ga0075028_100472232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300006102|Ga0075015_100749038 | Not Available | 583 | Open in IMG/M |
3300006176|Ga0070765_100190357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1857 | Open in IMG/M |
3300006176|Ga0070765_100382484 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300006176|Ga0070765_100452353 | Not Available | 1203 | Open in IMG/M |
3300006176|Ga0070765_100952115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
3300006796|Ga0066665_10070935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 2474 | Open in IMG/M |
3300006797|Ga0066659_10223607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Azospira → Azospira oryzae | 1393 | Open in IMG/M |
3300006893|Ga0073928_10027250 | All Organisms → cellular organisms → Bacteria | 5606 | Open in IMG/M |
3300009012|Ga0066710_100091601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4021 | Open in IMG/M |
3300009038|Ga0099829_10787150 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300009038|Ga0099829_11185905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300009038|Ga0099829_11267589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300009088|Ga0099830_10501079 | Not Available | 991 | Open in IMG/M |
3300009088|Ga0099830_10692141 | Not Available | 839 | Open in IMG/M |
3300009089|Ga0099828_10341540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1349 | Open in IMG/M |
3300009089|Ga0099828_10624779 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
3300009137|Ga0066709_100145947 | Not Available | 3014 | Open in IMG/M |
3300009137|Ga0066709_100193726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2660 | Open in IMG/M |
3300009137|Ga0066709_100943620 | Not Available | 1260 | Open in IMG/M |
3300009137|Ga0066709_102562677 | Not Available | 685 | Open in IMG/M |
3300009143|Ga0099792_10439453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300009518|Ga0116128_1046937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1374 | Open in IMG/M |
3300009524|Ga0116225_1450326 | Not Available | 572 | Open in IMG/M |
3300009552|Ga0116138_1023703 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300009552|Ga0116138_1096644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
3300009552|Ga0116138_1120937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300009616|Ga0116111_1004294 | All Organisms → cellular organisms → Bacteria | 7424 | Open in IMG/M |
3300009616|Ga0116111_1011805 | All Organisms → cellular organisms → Bacteria | 3496 | Open in IMG/M |
3300009616|Ga0116111_1040820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1404 | Open in IMG/M |
3300009616|Ga0116111_1076984 | Not Available | 887 | Open in IMG/M |
3300009616|Ga0116111_1147548 | Not Available | 560 | Open in IMG/M |
3300009629|Ga0116119_1071358 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300009630|Ga0116114_1149946 | Not Available | 596 | Open in IMG/M |
3300009639|Ga0116122_1013234 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
3300009640|Ga0116126_1037221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1998 | Open in IMG/M |
3300009672|Ga0116215_1206841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 863 | Open in IMG/M |
3300009672|Ga0116215_1314263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300009698|Ga0116216_10088645 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
3300009700|Ga0116217_10635255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300009762|Ga0116130_1073675 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300009839|Ga0116223_10570766 | Not Available | 654 | Open in IMG/M |
3300010159|Ga0099796_10298477 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300010301|Ga0134070_10184674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300010304|Ga0134088_10154995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
3300010329|Ga0134111_10436336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300010335|Ga0134063_10769384 | Not Available | 503 | Open in IMG/M |
3300010339|Ga0074046_10000448 | All Organisms → cellular organisms → Bacteria | 38030 | Open in IMG/M |
3300010339|Ga0074046_10223146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
3300010339|Ga0074046_10402380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 827 | Open in IMG/M |
3300010341|Ga0074045_10914316 | Not Available | 553 | Open in IMG/M |
3300010343|Ga0074044_10357337 | Not Available | 958 | Open in IMG/M |
3300010343|Ga0074044_10705237 | Not Available | 659 | Open in IMG/M |
3300010376|Ga0126381_101342331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_2_55_5 | 1034 | Open in IMG/M |
3300010379|Ga0136449_100365841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2581 | Open in IMG/M |
3300010379|Ga0136449_100597221 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300010379|Ga0136449_102566495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300011120|Ga0150983_12782198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300011269|Ga0137392_10456266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
3300011269|Ga0137392_11368993 | Not Available | 567 | Open in IMG/M |
3300011269|Ga0137392_11506074 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300011270|Ga0137391_10369187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1231 | Open in IMG/M |
3300011270|Ga0137391_10602133 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300011270|Ga0137391_11380370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300011271|Ga0137393_10673231 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300011271|Ga0137393_11749869 | Not Available | 510 | Open in IMG/M |
3300012096|Ga0137389_10045341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3289 | Open in IMG/M |
3300012096|Ga0137389_10653548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300012096|Ga0137389_10771232 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300012189|Ga0137388_10137374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2149 | Open in IMG/M |
3300012200|Ga0137382_10306203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
3300012205|Ga0137362_11502522 | Not Available | 560 | Open in IMG/M |
3300012207|Ga0137381_10135947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2107 | Open in IMG/M |
3300012210|Ga0137378_10466044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1169 | Open in IMG/M |
3300012211|Ga0137377_10805271 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300012285|Ga0137370_11026742 | Not Available | 507 | Open in IMG/M |
3300012349|Ga0137387_10423895 | Not Available | 965 | Open in IMG/M |
3300012351|Ga0137386_10041784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3148 | Open in IMG/M |
3300012351|Ga0137386_10084380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2229 | Open in IMG/M |
3300012351|Ga0137386_10744691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
3300012356|Ga0137371_10042296 | All Organisms → cellular organisms → Bacteria | 3518 | Open in IMG/M |
3300012356|Ga0137371_10211188 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
3300012361|Ga0137360_11057075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300012361|Ga0137360_11062938 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300012363|Ga0137390_10540977 | Not Available | 1136 | Open in IMG/M |
3300012917|Ga0137395_10149074 | Not Available | 1600 | Open in IMG/M |
3300012923|Ga0137359_10327681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1362 | Open in IMG/M |
3300012923|Ga0137359_11013669 | Not Available | 712 | Open in IMG/M |
3300012925|Ga0137419_10423857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
3300012929|Ga0137404_10386866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
3300012977|Ga0134087_10002130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 5856 | Open in IMG/M |
3300014150|Ga0134081_10324004 | Not Available | 559 | Open in IMG/M |
3300014154|Ga0134075_10013965 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
3300014159|Ga0181530_10027700 | All Organisms → cellular organisms → Bacteria | 4123 | Open in IMG/M |
3300014159|Ga0181530_10188924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
3300014491|Ga0182014_10218607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus → unclassified Phycicoccus → Phycicoccus sp. CSK15P-2 | 1018 | Open in IMG/M |
3300014498|Ga0182019_10862871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300014501|Ga0182024_10326800 | Not Available | 2014 | Open in IMG/M |
3300014501|Ga0182024_10510933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1526 | Open in IMG/M |
3300014501|Ga0182024_11345594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300014501|Ga0182024_11596708 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300014638|Ga0181536_10410103 | Not Available | 604 | Open in IMG/M |
3300015241|Ga0137418_10440452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1055 | Open in IMG/M |
3300015264|Ga0137403_10223139 | Not Available | 1806 | Open in IMG/M |
3300015356|Ga0134073_10017667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1677 | Open in IMG/M |
3300016705|Ga0181507_1355530 | Not Available | 673 | Open in IMG/M |
3300017821|Ga0187812_1270653 | Not Available | 541 | Open in IMG/M |
3300017823|Ga0187818_10006766 | All Organisms → cellular organisms → Bacteria | 4915 | Open in IMG/M |
3300017823|Ga0187818_10023319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2648 | Open in IMG/M |
3300017823|Ga0187818_10027155 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2451 | Open in IMG/M |
3300017823|Ga0187818_10043488 | Not Available | 1929 | Open in IMG/M |
3300017823|Ga0187818_10171452 | Not Available | 946 | Open in IMG/M |
3300017823|Ga0187818_10241281 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300017823|Ga0187818_10248245 | Not Available | 778 | Open in IMG/M |
3300017823|Ga0187818_10478499 | Not Available | 557 | Open in IMG/M |
3300017928|Ga0187806_1196689 | Not Available | 682 | Open in IMG/M |
3300017931|Ga0187877_1167279 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300017933|Ga0187801_10214831 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300017935|Ga0187848_10420012 | Not Available | 550 | Open in IMG/M |
3300017940|Ga0187853_10024600 | All Organisms → cellular organisms → Bacteria | 3290 | Open in IMG/M |
3300017942|Ga0187808_10158871 | Not Available | 998 | Open in IMG/M |
3300017943|Ga0187819_10381844 | Not Available | 811 | Open in IMG/M |
3300017943|Ga0187819_10467444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
3300017943|Ga0187819_10586072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300017943|Ga0187819_10603099 | Not Available | 622 | Open in IMG/M |
3300017943|Ga0187819_10795488 | Not Available | 531 | Open in IMG/M |
3300017955|Ga0187817_10009826 | All Organisms → cellular organisms → Bacteria | 5458 | Open in IMG/M |
3300017955|Ga0187817_10671185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300017975|Ga0187782_10123365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1916 | Open in IMG/M |
3300017995|Ga0187816_10247731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 777 | Open in IMG/M |
3300017995|Ga0187816_10274148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 738 | Open in IMG/M |
3300017995|Ga0187816_10318427 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300017995|Ga0187816_10415176 | Not Available | 599 | Open in IMG/M |
3300018001|Ga0187815_10305223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300018001|Ga0187815_10432255 | Not Available | 562 | Open in IMG/M |
3300018004|Ga0187865_1274004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300018006|Ga0187804_10189144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
3300018006|Ga0187804_10455245 | Not Available | 571 | Open in IMG/M |
3300018006|Ga0187804_10523667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
3300018007|Ga0187805_10641915 | Not Available | 503 | Open in IMG/M |
3300018012|Ga0187810_10343956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 621 | Open in IMG/M |
3300018017|Ga0187872_10059182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2018 | Open in IMG/M |
3300018024|Ga0187881_10309666 | Not Available | 654 | Open in IMG/M |
3300018025|Ga0187885_10234546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
3300018030|Ga0187869_10110361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1383 | Open in IMG/M |
3300018030|Ga0187869_10177004 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300018037|Ga0187883_10124741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1331 | Open in IMG/M |
3300018042|Ga0187871_10228728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
3300018058|Ga0187766_11217677 | Not Available | 546 | Open in IMG/M |
3300018086|Ga0187769_10408721 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
3300018090|Ga0187770_11806582 | Not Available | 500 | Open in IMG/M |
3300018431|Ga0066655_10135520 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
3300018431|Ga0066655_10359942 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 956 | Open in IMG/M |
3300018433|Ga0066667_10195619 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
3300018433|Ga0066667_10447124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-55 | 1055 | Open in IMG/M |
3300018433|Ga0066667_11452896 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300018468|Ga0066662_10764143 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300018482|Ga0066669_12167869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 526 | Open in IMG/M |
3300019788|Ga0182028_1051334 | Not Available | 701 | Open in IMG/M |
3300019887|Ga0193729_1058125 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
3300020199|Ga0179592_10076156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
3300020579|Ga0210407_10021193 | All Organisms → cellular organisms → Bacteria | 4826 | Open in IMG/M |
3300020579|Ga0210407_10166639 | Not Available | 1703 | Open in IMG/M |
3300020579|Ga0210407_10529461 | Not Available | 920 | Open in IMG/M |
3300020579|Ga0210407_10766591 | Not Available | 745 | Open in IMG/M |
3300020580|Ga0210403_10121048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2129 | Open in IMG/M |
3300020580|Ga0210403_10582766 | Not Available | 904 | Open in IMG/M |
3300020581|Ga0210399_10022774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4970 | Open in IMG/M |
3300020581|Ga0210399_10107494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 2285 | Open in IMG/M |
3300020581|Ga0210399_10109113 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
3300020581|Ga0210399_10753740 | Not Available | 797 | Open in IMG/M |
3300020583|Ga0210401_11235714 | Not Available | 605 | Open in IMG/M |
3300021086|Ga0179596_10312066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
3300021168|Ga0210406_10015156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7351 | Open in IMG/M |
3300021168|Ga0210406_10063748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 3189 | Open in IMG/M |
3300021168|Ga0210406_10153079 | Not Available | 1935 | Open in IMG/M |
3300021170|Ga0210400_10799550 | Not Available | 773 | Open in IMG/M |
3300021403|Ga0210397_10814850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
3300021478|Ga0210402_11393074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300021560|Ga0126371_10495170 | Not Available | 1370 | Open in IMG/M |
3300022518|Ga0224548_1025239 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300023058|Ga0193714_1008088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
3300023090|Ga0224558_1185137 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300024233|Ga0224521_1121454 | Not Available | 557 | Open in IMG/M |
3300024240|Ga0224522_1106841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300025442|Ga0208034_1033670 | Not Available | 1205 | Open in IMG/M |
3300025442|Ga0208034_1040305 | Not Available | 1039 | Open in IMG/M |
3300025442|Ga0208034_1050787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
3300025448|Ga0208037_1010379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2581 | Open in IMG/M |
3300025454|Ga0208039_1049927 | Not Available | 774 | Open in IMG/M |
3300025604|Ga0207930_1117277 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300026277|Ga0209350_1023386 | Not Available | 1892 | Open in IMG/M |
3300026328|Ga0209802_1010153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5615 | Open in IMG/M |
3300026482|Ga0257172_1075426 | Not Available | 619 | Open in IMG/M |
3300026524|Ga0209690_1172150 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300026528|Ga0209378_1021883 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3543 | Open in IMG/M |
3300026528|Ga0209378_1025767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3179 | Open in IMG/M |
3300026532|Ga0209160_1195487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
3300026538|Ga0209056_10138217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1895 | Open in IMG/M |
3300026540|Ga0209376_1143463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1154 | Open in IMG/M |
3300026540|Ga0209376_1233645 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300026551|Ga0209648_10760327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300027439|Ga0209332_1054742 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300027610|Ga0209528_1005275 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
3300027625|Ga0208044_1130326 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300027645|Ga0209117_1003619 | All Organisms → cellular organisms → Bacteria | 5391 | Open in IMG/M |
3300027645|Ga0209117_1007210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3787 | Open in IMG/M |
3300027651|Ga0209217_1010860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2981 | Open in IMG/M |
3300027667|Ga0209009_1123391 | Not Available | 658 | Open in IMG/M |
3300027674|Ga0209118_1031549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1625 | Open in IMG/M |
3300027678|Ga0209011_1164783 | Not Available | 618 | Open in IMG/M |
3300027748|Ga0209689_1035785 | All Organisms → cellular organisms → Bacteria | 2904 | Open in IMG/M |
3300027783|Ga0209448_10232917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300027825|Ga0209039_10010716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5329 | Open in IMG/M |
3300027854|Ga0209517_10359618 | Not Available | 831 | Open in IMG/M |
3300027875|Ga0209283_10621023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
3300027903|Ga0209488_10442823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
3300027905|Ga0209415_10205581 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
3300027905|Ga0209415_10632777 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300028047|Ga0209526_10404997 | Not Available | 905 | Open in IMG/M |
3300028906|Ga0308309_11326277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300029636|Ga0222749_10392099 | Not Available | 734 | Open in IMG/M |
3300030494|Ga0310037_10158337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
3300031718|Ga0307474_11386779 | Not Available | 554 | Open in IMG/M |
3300031718|Ga0307474_11606146 | Not Available | 511 | Open in IMG/M |
3300031820|Ga0307473_10937286 | Not Available | 628 | Open in IMG/M |
3300031823|Ga0307478_10803593 | Not Available | 787 | Open in IMG/M |
3300032160|Ga0311301_10246894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2952 | Open in IMG/M |
3300033402|Ga0326728_10001250 | All Organisms → cellular organisms → Bacteria | 91023 | Open in IMG/M |
3300033402|Ga0326728_10024611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10887 | Open in IMG/M |
3300033823|Ga0334837_010446 | All Organisms → cellular organisms → Bacteria | 4216 | Open in IMG/M |
3300033887|Ga0334790_001879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16902 | Open in IMG/M |
3300033887|Ga0334790_031889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2169 | Open in IMG/M |
3300033983|Ga0371488_0099825 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300034091|Ga0326724_0006347 | All Organisms → cellular organisms → Bacteria | 14309 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.87% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 10.95% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.47% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.47% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.47% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.28% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.55% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.19% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.46% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.46% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.46% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.46% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.09% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.73% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.73% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.36% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.36% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
3300024240 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T25 | Environmental | Open in IMG/M |
3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033823 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_100124281 | 3300001593 | Forest Soil | VGVEKGTKAVISVNFSAYGERTFNNLRTNFVVETPLKR |
JGI12635J15846_102468073 | 3300001593 | Forest Soil | VAVEKGTKAVISVNFSVYGLRTFNNLRTNFVVEIP* |
JGI12635J15846_103572092 | 3300001593 | Forest Soil | TPVAVEKGTKPVISVNFSAYGKRRFNNLRANFVREIP* |
JGI12635J15846_103803092 | 3300001593 | Forest Soil | MLKTGVGVEKGTKAVISVNSSAYDERTFNNLRADFGVEIP* |
JGI12635J15846_107304523 | 3300001593 | Forest Soil | VDHPQLLKYPVAVEKGTKAVISVNFSAYGLRTFNDLRTNFAVE |
JGI25382J37095_101167393 | 3300002562 | Grasslands Soil | VKSPVRVEKGTKAVISANSSVYDGLEFNNLRSNFVAEIPGKE |
Ga0062386_1000144633 | 3300004152 | Bog Forest Soil | VAVEKGTKAVISVHFSAHGERTFNNLRANFVGEIPRKEFFNSHEIFQQ* |
Ga0062386_1001123034 | 3300004152 | Bog Forest Soil | VGVEKGTKAVISVHFSVYGERTFNKLPTNFVVEMPRKEFFNSHA* |
Ga0062386_1006993202 | 3300004152 | Bog Forest Soil | VAVEKGTKAVISVNFSVYGKRTFNNLQTKFAVEIPRKEFFNSHKR* |
Ga0066672_103816942 | 3300005167 | Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSH |
Ga0066672_106738621 | 3300005167 | Soil | VRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPEKEFFNSHAI* |
Ga0066677_101081584 | 3300005171 | Soil | VIWRVRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHAI* |
Ga0066683_100978113 | 3300005172 | Soil | VGIEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNS |
Ga0066683_104035402 | 3300005172 | Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHAI* |
Ga0066679_102054742 | 3300005176 | Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSHACF |
Ga0066690_102157422 | 3300005177 | Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFN |
Ga0066690_109558131 | 3300005177 | Soil | VKSPVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFF |
Ga0066678_106737421 | 3300005181 | Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSH |
Ga0066678_106933851 | 3300005181 | Soil | KGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHAI* |
Ga0066676_105645401 | 3300005186 | Soil | VQTPVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFF |
Ga0066689_102498721 | 3300005447 | Soil | VLWRVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFF |
Ga0066689_106226802 | 3300005447 | Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPEKEFFNSHA |
Ga0066682_105520842 | 3300005450 | Soil | VQTPVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPA |
Ga0066697_107171941 | 3300005540 | Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEF |
Ga0066695_101032734 | 3300005553 | Soil | MQTGVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPA |
Ga0066695_102912521 | 3300005553 | Soil | VGIEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSH |
Ga0066695_104237342 | 3300005553 | Soil | VRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHA* |
Ga0066692_100136695 | 3300005555 | Soil | MGVAVEKGTKATISVNFSVYGRRTLNNLRTNFAVEIL* |
Ga0066707_101447072 | 3300005556 | Soil | PVGVEKGTKAVISANSSVCGERTFNNLPTNFVIEIP* |
Ga0066704_102909261 | 3300005557 | Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEF |
Ga0066698_102216803 | 3300005558 | Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSHAC |
Ga0066700_100364845 | 3300005559 | Soil | VGVEKGTKAVFSANSNVYGGLEVNNLRSNLVAEIPGKEFFNSHRR |
Ga0066694_105446702 | 3300005574 | Soil | VRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPG |
Ga0066691_103959183 | 3300005586 | Soil | VIWRVRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPEKEFFNSHAI* |
Ga0066691_104692112 | 3300005586 | Soil | VKSPVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPA |
Ga0066706_100423791 | 3300005598 | Soil | VGVEKGTKAVFSANSNVYGGLEVNNLRSNLVAEIPGKEFFNSHLNAQQ* |
Ga0066706_112782061 | 3300005598 | Soil | KGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHA* |
Ga0075028_1004722322 | 3300006050 | Watersheds | VEKGTKAVISANLSVHRERKLNNLQTNFDVETPR* |
Ga0075015_1007490381 | 3300006102 | Watersheds | AVEKGTKPVISANFSAGGEQTFNNLRTNFAVEMP* |
Ga0070765_1001903571 | 3300006176 | Soil | VAVEKGTKAVISVNFSAYGKRTFNNLRANFVREIPREEFFNTY |
Ga0070765_1003824841 | 3300006176 | Soil | MTGVAVEKGTKAVISVDFSACGGRTFNKLRMNFAVEIP* |
Ga0070765_1004523533 | 3300006176 | Soil | VAVEKGTKPVISVNFSAYDKRRFNNLRANFVREIPREEFFNTYA* |
Ga0070765_1009521153 | 3300006176 | Soil | GVAVEKGTKAVISVSFSVYGRRTFNKLRTNFAVEIT* |
Ga0066665_100709353 | 3300006796 | Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFF |
Ga0066659_102236073 | 3300006797 | Soil | VGVEKGTTAVISANSSVYGGLEFNNLRSNFVAEIPEKEFLQQPRNI* |
Ga0073928_100272501 | 3300006893 | Iron-Sulfur Acid Spring | VEKGTKAVICVNFSACGKRRFNNLRANFVREIPRKEFFNTHGMLRQPST* |
Ga0066710_1000916012 | 3300009012 | Grasslands Soil | VKNRVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFF |
Ga0099829_107871503 | 3300009038 | Vadose Zone Soil | KAVISVNFSAYGERIFNNLRAIFAGEVPRKEFFNTHRR* |
Ga0099829_111859051 | 3300009038 | Vadose Zone Soil | VGVEKGTKAVISVNFSAYGERTFNNLRANFAGEIPRKEFFNS |
Ga0099829_112675891 | 3300009038 | Vadose Zone Soil | GVAVEKGTKAVISVNSSAYDERTFNNLRADFGVEIP* |
Ga0099830_105010792 | 3300009088 | Vadose Zone Soil | PVGVEKGTKAVISVNSSAYDERTFNNLRADFSVEIP* |
Ga0099830_106921411 | 3300009088 | Vadose Zone Soil | TGVGVEKGTKAVISVNFCVYGRRTFNNLQTNFAAEIP* |
Ga0099828_103415401 | 3300009089 | Vadose Zone Soil | GVAVEKGTKAVISVNFSAYGERTFNNLRANFAGEIPRKEFFNSHALFTSTTL* |
Ga0099828_106247792 | 3300009089 | Vadose Zone Soil | AVEKGTKAVISVNFSAYGERIFNNLRASFAGEIPRKEFFNSHRRFH* |
Ga0066709_1001459471 | 3300009137 | Grasslands Soil | VGVEKGTKAVISANSSAYGDLEFNNLRANFFAEIPAKEFFNSHRR* |
Ga0066709_1001937264 | 3300009137 | Grasslands Soil | VGVEKGTKAVISANSSAYGELEFNKLRANFFAEIPAKEFFNSHA* |
Ga0066709_1009436203 | 3300009137 | Grasslands Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGK |
Ga0066709_1025626771 | 3300009137 | Grasslands Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPEKEFFNSHAILRQQSQGYAS* |
Ga0099792_104394531 | 3300009143 | Vadose Zone Soil | VQTLVAVEKGTKAVISVNFSAYGEPTFNNLRANFAGEIPRKEFFNTHRR* |
Ga0116128_10469372 | 3300009518 | Peatland | MGRGVEKGTKAVISVHFSVYGKRTFNNLRTDFVGEIPLKEFFNSHGLLQQ* |
Ga0116225_14503262 | 3300009524 | Peatlands Soil | VEKGTKALISVHFSTNGERTFNNLRTNFVGEIPWKEFFNSHRP* |
Ga0116138_10237031 | 3300009552 | Peatland | VAVEKGTKAVISVNFSASGERTFNNLRTNFVGEIP* |
Ga0116138_10966442 | 3300009552 | Peatland | VAVEKGTKAVISVNFSAHGERTFNNLRTNFVGEIP* |
Ga0116138_11209372 | 3300009552 | Peatland | MGRGVEKGTKAVISVHFSVYGKRTFNNLRTDFVGEIPLKEFFNSHGMLQQ* |
Ga0116111_10042941 | 3300009616 | Peatland | KGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKEFFNTHRR* |
Ga0116111_10118056 | 3300009616 | Peatland | VGVEKGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKEFFNT |
Ga0116111_10408202 | 3300009616 | Peatland | VEKGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKEFFNTHA* |
Ga0116111_10769841 | 3300009616 | Peatland | LLLTGVAVEKGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKEF |
Ga0116111_11475481 | 3300009616 | Peatland | VQTPVAVEKGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKE |
Ga0116119_10713582 | 3300009629 | Peatland | VAVEKGTKAVISVNFSVYGERTFNNLRTSFAVEIP* |
Ga0116114_11499462 | 3300009630 | Peatland | AVEKGTKAVISVDFSVYGERTINNLRTNFAITIP* |
Ga0116122_10132342 | 3300009639 | Peatland | MGRGVEKGTKAVISVHFSVYGERTFNNLRTDFVGEIPLKEFFNSHGMLQQ* |
Ga0116126_10372214 | 3300009640 | Peatland | VEKGTKAVISVNFSVYGRRTFNNLRTNFVVEILRKEFFNSHA* |
Ga0116215_12068413 | 3300009672 | Peatlands Soil | GVAVEKGSKAVISVNFSAYGERTFNNLRTNFVGEIP* |
Ga0116215_13142631 | 3300009672 | Peatlands Soil | GVAVEKGTKAVISVNFSAYGERTFNNLRTNFTVEIP* |
Ga0116216_100886451 | 3300009698 | Peatlands Soil | PVAVEKGTKAVISVHFSAYGERRFNNLRTNFVGEIP* |
Ga0116217_106352551 | 3300009700 | Peatlands Soil | LKNHVAVEKGTKAVISVNFGVYGERTFNNLQTNFAV |
Ga0116130_10736751 | 3300009762 | Peatland | TPVGVEKGTRTVISVSFRAYAELRFNNLRTSFVAEIP* |
Ga0116223_105707662 | 3300009839 | Peatlands Soil | RGVEKGTKAVISVHFSVYGKRTFNNLRTDFVGEIPLKEFFSSHGMLQQ* |
Ga0099796_102984771 | 3300010159 | Vadose Zone Soil | LSKSGVAVEKGSKAVISVNFSVDGKRTFNNLRTNFAVEIP* |
Ga0134070_100434184 | 3300010301 | Grasslands Soil | ISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHAI* |
Ga0134070_101846742 | 3300010301 | Grasslands Soil | VGVEQGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHA* |
Ga0134088_101549952 | 3300010304 | Grasslands Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSHA* |
Ga0134111_104363362 | 3300010329 | Grasslands Soil | VRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHAI* |
Ga0134063_107693841 | 3300010335 | Grasslands Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSHRR* |
Ga0074046_1000044825 | 3300010339 | Bog Forest Soil | LAKTDVGVEKGTKAVIFVNFSVYGEQKFNNLRANFVVEIP* |
Ga0074046_102231461 | 3300010339 | Bog Forest Soil | TPVAVEKGTKAVISVHFSAYGQRTFNNLRVNFVGEIPRKEFFNSHA* |
Ga0074046_104023802 | 3300010339 | Bog Forest Soil | VAVEKGTKAVISVNFSVCGERTFNNLRTNFVVEIP* |
Ga0074045_109143162 | 3300010341 | Bog Forest Soil | LAKTDVGVEKGTKAVIFVNFSVYGEQKFNNLRANFVVEIP |
Ga0074044_103573372 | 3300010343 | Bog Forest Soil | VAVEKGTKAVISENFSVHGERTFNNLRTNFVGEIP* |
Ga0074044_107052371 | 3300010343 | Bog Forest Soil | LLKNPVAVEKGTKAVISVNFSVYGRRTFNNLRTNFAVEI |
Ga0126381_1013423311 | 3300010376 | Tropical Forest Soil | KRMLLLTPVAVEKGTKPVISDNFSVCHERAFNNLQANFLVEKCKK* |
Ga0136449_1003658411 | 3300010379 | Peatlands Soil | VLQSGVGVEKGTKAVISANSSVYGRRTFNNLRTSFVLEILRKEFFNSH |
Ga0136449_1005972215 | 3300010379 | Peatlands Soil | VEKGTKAVISINSSVYGERTFNNLRANFAREIRLREFFNSHA* |
Ga0136449_1025664952 | 3300010379 | Peatlands Soil | AVEKGTKAVISVNFGVYGERTFNNLQTNFAVEIP* |
Ga0150983_127821982 | 3300011120 | Forest Soil | VAVEKGTKAVISVNFSVYGRRTFNCLRTNFAVEIP* |
Ga0137392_104562662 | 3300011269 | Vadose Zone Soil | MKSGVAVEKGTKAVISVNFSVDGGRTFNNLRTNFAVEIP* |
Ga0137392_113689931 | 3300011269 | Vadose Zone Soil | TKAVISVNFSAYGERIFNNLRAIFAGEVPRKEFFNTHRR* |
Ga0137392_115060741 | 3300011269 | Vadose Zone Soil | GVAVEKGTKAVISVNFSVHGERTINNLRTNFAAEIP* |
Ga0137391_103691871 | 3300011270 | Vadose Zone Soil | MLSPVAVEKGTKPVISVNFSAYGKRRLNNLRATFVREIP* |
Ga0137391_106021331 | 3300011270 | Vadose Zone Soil | PVAVEKGTKPVISVNFSAYGKRRFNNLRATFVREIP* |
Ga0137391_113803701 | 3300011270 | Vadose Zone Soil | GVAVEKGTKAVISVNFSAYGERTFNNLRANFAGEIPRKEFFNSHAYLQQ* |
Ga0137393_106732313 | 3300011271 | Vadose Zone Soil | GQLLKPGVAIEKGTKEVISVNFSAYGERTFNNLGTNFIGETP* |
Ga0137393_117498691 | 3300011271 | Vadose Zone Soil | TGVAVEKGTKAVISVNFSVDGRRTFNNLRTNFAVEIP* |
Ga0137389_100453414 | 3300012096 | Vadose Zone Soil | AVEKGTEAVISVNYSVYGTRTFNNLRTEFAVEIP* |
Ga0137389_106535482 | 3300012096 | Vadose Zone Soil | SQTGVAVEKGTKAVISTIFNACGERTFNNLRTNFGG* |
Ga0137389_107712323 | 3300012096 | Vadose Zone Soil | VADEKGTKAVISVNFSAYGERIFNNLRAIFAGEVPRKEFFNTHRR* |
Ga0137388_101373741 | 3300012189 | Vadose Zone Soil | VISVNFSAYGERTFNNLRANFAGEIPRKEFFNSHA* |
Ga0137383_104341942 | 3300012199 | Vadose Zone Soil | MLDEGLLVKNRVGVEKGTKAVISANSSVCGERTFNNLR |
Ga0137382_103062032 | 3300012200 | Vadose Zone Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFCAEIPAKEFFNSHR |
Ga0137362_115025221 | 3300012205 | Vadose Zone Soil | GVAVEKGTKAVISVNFSVYGRRTFNNLRTNFAVEIP* |
Ga0137381_101359471 | 3300012207 | Vadose Zone Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPEKEFFNSHRRFRS |
Ga0137378_104660441 | 3300012210 | Vadose Zone Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSHRR |
Ga0137377_108052712 | 3300012211 | Vadose Zone Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAK |
Ga0137370_110267421 | 3300012285 | Vadose Zone Soil | VGVEKGTKAVISANSSVCGERTFNNLRTNFVIEIP* |
Ga0137387_104238951 | 3300012349 | Vadose Zone Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPEKEF |
Ga0137386_100417841 | 3300012351 | Vadose Zone Soil | VEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHAI* |
Ga0137386_100843803 | 3300012351 | Vadose Zone Soil | GLDLHSKITGVAVEKGTKPVISLNFSIYGRRTFNNLRTDFAVEIP* |
Ga0137386_107446912 | 3300012351 | Vadose Zone Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNS |
Ga0137371_100422961 | 3300012356 | Vadose Zone Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKE |
Ga0137371_102111882 | 3300012356 | Vadose Zone Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAQEFFYSHA* |
Ga0137360_110570751 | 3300012361 | Vadose Zone Soil | LLKSGVAVEKGTKAVISVNFSAYGKPRFNNLRANFVREIPRKGF |
Ga0137360_110629382 | 3300012361 | Vadose Zone Soil | TANPRSLLQSGVAVEKGAKAVISVNFSVYGRRTLNNLRTTFAFEIP* |
Ga0137390_105409771 | 3300012363 | Vadose Zone Soil | VAVEKGTKPVISVNFSAYGKRRFNNLRATFVREIPSKEFFNSHGILRQ* |
Ga0137395_101490743 | 3300012917 | Vadose Zone Soil | ALSGVAVEKGTKAVISVNFSVYDRRTFNNLRTNFAVEIP* |
Ga0137359_103276812 | 3300012923 | Vadose Zone Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHT* |
Ga0137359_110136691 | 3300012923 | Vadose Zone Soil | VISVNFSAYGERTFNNLGANFAGEIPRKEFFNTHA* |
Ga0137419_104238572 | 3300012925 | Vadose Zone Soil | PVAVEKGTKAVISVNFSVYGRQTFNNLRTNFDVEIP* |
Ga0137404_103868662 | 3300012929 | Vadose Zone Soil | LALTGVGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHA* |
Ga0134087_100021308 | 3300012977 | Grasslands Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIP |
Ga0134081_103240041 | 3300014150 | Grasslands Soil | PVGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHACFRQLS* |
Ga0134075_100139652 | 3300014154 | Grasslands Soil | LLVKWRVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSHRR* |
Ga0181530_100277001 | 3300014159 | Bog | KIAITPVGVEKGTRTVISVSFRAYAELRFNNLRTSFVAEIP* |
Ga0181530_101889242 | 3300014159 | Bog | VAVEKGTKAVISVNFSAHGERTFNNLRMNFAGEIP* |
Ga0182014_102186072 | 3300014491 | Bog | VAVEKGTKAVISGDFSVFGERTFNNLQTNFAVEIP* |
Ga0182019_108628712 | 3300014498 | Fen | VVGDKSRAVEKGTKGVISVNFGAYGERTFNNLRTNFGG* |
Ga0182024_103268001 | 3300014501 | Permafrost | VGVEKGTKAVISVNFSVHGERTFNNLRTDFAVNIRGKE |
Ga0182024_105109331 | 3300014501 | Permafrost | KGTKAVISVNFSVHGERTFNNLRTDFAVNIRGKEFFNSHRR* |
Ga0182024_113455941 | 3300014501 | Permafrost | VGVEKGTKAVISVNFSVHGERTFNNLRTDFAVNIRGKEFFN |
Ga0182024_115967081 | 3300014501 | Permafrost | LAQTGVGVEKGTKAVISVNFSVHGERTFNNLRTDFAVNIRGKE |
Ga0181536_104101031 | 3300014638 | Bog | MLSIYVGVEKGTKEVISVNFSAYGELRFNNLRRIFVA |
Ga0137418_104404521 | 3300015241 | Vadose Zone Soil | LVQTPVAVEKGTKAVISVNFSVYGRQTFNNLRTNFDVEIP* |
Ga0137403_102231393 | 3300015264 | Vadose Zone Soil | KPHESVEKGTKAVILANFCDFDERMFNNLRAILVSKTP* |
Ga0134073_100176671 | 3300015356 | Grasslands Soil | VGVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPEKEFFNSHAI* |
Ga0181507_13555302 | 3300016705 | Peatland | VAVEKGTKAVISVNFRAGDERTFNNLRTSFVREIP |
Ga0187812_12706532 | 3300017821 | Freshwater Sediment | VAVEKGTKAVILANFGVFGERTFNDLRANFVVETPRKEFFN |
Ga0187818_100067661 | 3300017823 | Freshwater Sediment | KGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKEFFNSHA |
Ga0187818_100233195 | 3300017823 | Freshwater Sediment | VAVEKGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKEFFN |
Ga0187818_100271553 | 3300017823 | Freshwater Sediment | VAVEKGTKAVILVNFSPSSERTFNNLRTNFVVEIP |
Ga0187818_100434881 | 3300017823 | Freshwater Sediment | VAVEKGTKAVISVNFSAYGERTFNNLRANFVGEIPRKEFFNSHGLFS |
Ga0187818_101714522 | 3300017823 | Freshwater Sediment | VAVEKGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKEFF |
Ga0187818_102412812 | 3300017823 | Freshwater Sediment | VAVEKGTKAVISVSLSVHGERTFNNLQANFVAERP |
Ga0187818_102482451 | 3300017823 | Freshwater Sediment | VGVEKGTKAVISRKFSVYCQRTFNNLQPNFIVEIP |
Ga0187818_104784991 | 3300017823 | Freshwater Sediment | VGVEKGTKAVIFVNFSVYCEPKFNNLRANFVVEIPWKEFFNTHACFQQ |
Ga0187806_11966891 | 3300017928 | Freshwater Sediment | TPVAVEKGTKAVISAYSNVYGERTFNNLRANFVVETRRKEFFNSHRGSH |
Ga0187877_11672792 | 3300017931 | Peatland | MGRGVEKGTKAVISVHFSVYGKRTFNNLRTDFVGEIPLKEFFNSHGLLQQ |
Ga0187801_102148312 | 3300017933 | Freshwater Sediment | VGVEKGTKAVIFVNFSVYCEPKFNNLRANFVVEIPWKEFFNTRVG |
Ga0187848_104200121 | 3300017935 | Peatland | AVISVHFSVYGKRTFNNLRTDFVGEIPSKEFFNSHGMLQQ |
Ga0187853_100246002 | 3300017940 | Peatland | MGRGVEKGTKAVISVHFSVYGKRTFNNLRTDFVGEIPLKEFFNSHGMLQQ |
Ga0187808_101588712 | 3300017942 | Freshwater Sediment | TGVAVEKGTKAVISADSSVYGERTFNNLRANFLVETPQKKFFNSHRHYH |
Ga0187819_103818441 | 3300017943 | Freshwater Sediment | VAVEKGTKAVISVNFRIHGERTFNNLQTNFVVETPGKEFFNSHRG |
Ga0187819_104674441 | 3300017943 | Freshwater Sediment | VAVEKGTKAVISANSSVFGERTFNNLRANFVVETPRKEFFNSHRRYH |
Ga0187819_105860721 | 3300017943 | Freshwater Sediment | LVKNRVAVEKGTKAVISAYSNVYGERTFNNLRANFVVETRRKEF |
Ga0187819_106030991 | 3300017943 | Freshwater Sediment | VGVEKGTKAVISANSSVCREPTFNHLRPAFVVEILRKEFFNSH |
Ga0187819_107954881 | 3300017943 | Freshwater Sediment | VAVEKGTKAVISVNFSAYGERTFNNLRANFVGEIPRKEFFNSHSRFHS |
Ga0187817_100098267 | 3300017955 | Freshwater Sediment | VSELSNSGLLKPGVAVEKGTKAVISVNFSVYGERTFNNLR |
Ga0187817_106711852 | 3300017955 | Freshwater Sediment | ANPKRVITPVAVEKGTKAVISANFGVFGERTFNNLRANFVV |
Ga0187782_101233653 | 3300017975 | Tropical Peatland | VAVEKGTKAVILANFSVYGERTFNNLRANFVVETPRKDPFNSHP |
Ga0187816_102477311 | 3300017995 | Freshwater Sediment | VAVEKGNKAVISVHFSAYGELTFNNLRANFVGEIPRKEFFNSHACYQQPSPAAAP |
Ga0187816_102741481 | 3300017995 | Freshwater Sediment | VGVEKGTKAVISASFSVYGRRTFNNLRTNFAAEIL |
Ga0187816_103184271 | 3300017995 | Freshwater Sediment | VAVEKGTKAVISVDFSVNRERTFNNLQTNFVVEIHRKEFFNSHA |
Ga0187816_104151761 | 3300017995 | Freshwater Sediment | VGVEKVTKAVIFVNFSVYCEPKFNNLRANFVVEIPWKEFFNTHACFQQ |
Ga0187815_103052233 | 3300018001 | Freshwater Sediment | AVEKGTKAVISANLSVYGERTVNNLQANFVVETPRKEFFNSHRGYH |
Ga0187815_104322551 | 3300018001 | Freshwater Sediment | MTGVAVEKGTKAVISANSSVFGERTFNNLRANFVVETPRKEFF |
Ga0187865_12740042 | 3300018004 | Peatland | TSVAVEKGTKAVISVNFSAHGERTFNNLRMNFAGEIP |
Ga0187804_101891441 | 3300018006 | Freshwater Sediment | GVGVEKGTKAVISVNFSVYGRRTFNNLRTNFVVEILRKEFFNSHRH |
Ga0187804_104552452 | 3300018006 | Freshwater Sediment | LTKSGVAVEKGTKEVISANCSVYGERTFNNLRADFVAEIP |
Ga0187804_105236671 | 3300018006 | Freshwater Sediment | VAVEKGTKAVISVNFSVYRKRKFNNLQTDFAVTIPGKEFFNTH |
Ga0187805_106419152 | 3300018007 | Freshwater Sediment | VAVEKGTKAVISAYSNVYGERTFNNLRANFVVETRRKEFFN |
Ga0187810_103439561 | 3300018012 | Freshwater Sediment | VISVHFSAYGQRTFNNLRANFVGEIPRKEFFNSHAC |
Ga0187872_100591824 | 3300018017 | Peatland | VEKGTKAVISVNFSVYGRRTFNNLRTNFVVEILRKEFFNSHA |
Ga0187881_103096661 | 3300018024 | Peatland | GVAVEKGTKAVISVNFSVYGERTFNNLRTNFAVETPWKEFFNSYRR |
Ga0187885_102345461 | 3300018025 | Peatland | RDVEKGTKAVISVNFSAHGERTFNNLRMNFAGQIP |
Ga0187869_101103611 | 3300018030 | Peatland | PVAVEKGTKAVISVDFSAHGERRFNNLRTNFVREVP |
Ga0187869_101770042 | 3300018030 | Peatland | LKYPVAVEKGTKAVISVNFSAYGERTFNNLRANFAAEILRKEFFNSQACLHQLTAVES |
Ga0187883_101247413 | 3300018037 | Peatland | TPVAVEKGTKAVISVNFSAYGEQRFNKLQTNFVGEIP |
Ga0187871_102287282 | 3300018042 | Peatland | MAKTAVAVEKGTKAVISLNFSVYGDRTFNNLRTNFAVEIR |
Ga0187766_112176771 | 3300018058 | Tropical Peatland | VAVEKGTKAVIPKNFGVFGEQTFNNLRANLVVETPRKEFFNSDG |
Ga0187769_104087211 | 3300018086 | Tropical Peatland | VAVEKGTKAVILANFSVYGERTFNNLRANFVVETPRKEFFNSHR |
Ga0187770_118065822 | 3300018090 | Tropical Peatland | VAVEKGTKAVISTNFRVEDQPGFNNLQTNFVAEIPQKEFFNNHRR |
Ga0066655_101355203 | 3300018431 | Grasslands Soil | VRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFN |
Ga0066655_103599423 | 3300018431 | Grasslands Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFN |
Ga0066667_101956192 | 3300018433 | Grasslands Soil | VGVEKGTKAVISANSSAYGELEFDNLRANFFAEIPAKEFFNSHA |
Ga0066667_104471242 | 3300018433 | Grasslands Soil | LVINRVGVEKGTKAVISANSSVCGERTFNNLRTNFVIEIA |
Ga0066667_114528961 | 3300018433 | Grasslands Soil | VGVEKGTEAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSH |
Ga0066662_107641433 | 3300018468 | Grasslands Soil | EKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNSHAMFQQ |
Ga0066669_121678691 | 3300018482 | Grasslands Soil | VQTPVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEF |
Ga0182028_10513342 | 3300019788 | Fen | VAVEKGTKAVISGDFSVFGERTFNNLQTNFAVEIP |
Ga0193729_10581251 | 3300019887 | Soil | AGPYAVEKGTKPVISVNFSAYGKRRFNDLRANFVREIP |
Ga0179592_100761561 | 3300020199 | Vadose Zone Soil | VAVEKGTKAVISVNFSAYGKPRFNKLRANFVREIP |
Ga0210407_100211931 | 3300020579 | Soil | LLTGVAVEKGTKAVISVNFSVYGKRRFNNLRANFVREIPRKEFF |
Ga0210407_101666391 | 3300020579 | Soil | VLAVEKGTKAVICVNFSACGKRKFNNLRANFVREIPRKEFFNTHA |
Ga0210407_105294611 | 3300020579 | Soil | VAVEKGTKAVISVNFSVYGKRRFNNLRANFVREIPRKEFF |
Ga0210407_107665911 | 3300020579 | Soil | GVAVEKGTKAVISVNFSVYGKRRFNNLRANFVREIPRKEFFNTHRRFH |
Ga0210403_101210484 | 3300020580 | Soil | EKGTKAVISVNFSVYGKRRFNNLRANFVREIPRKEFFNTHRR |
Ga0210403_105827661 | 3300020580 | Soil | LLTGVAVEKGTKAVISVNFSVYGKRRFNNLRANFVREIP |
Ga0210399_100227741 | 3300020581 | Soil | EKGTKAVISVNFSAYGKRRFNNLRANFVREIPREEFFNTYRR |
Ga0210399_101074941 | 3300020581 | Soil | KAVISVNFSAYGKRRFNNLRANFVREIPREEFFNTYSRFRSLTG |
Ga0210399_101091132 | 3300020581 | Soil | VKSPVAVEKGTKAVISVNFSAYGKRRFNNLRANFVREILRKEFFNTHA |
Ga0210399_107537401 | 3300020581 | Soil | GTKAVISVNFSAYGKRRFNNLRANFVREIPREEFFNTYA |
Ga0210401_112357142 | 3300020583 | Soil | VKSGVAVEKGTKPVISVNFSAYDKRRFNNLRANFVREIPREEFFNTYA |
Ga0179596_103120661 | 3300021086 | Vadose Zone Soil | LKPGVAIEKGTKEVISVNFSAYGERTFNNLRANFAGEIPRKE |
Ga0210406_100151563 | 3300021168 | Soil | VKSPVAVEKGTKAVISVNFSVYGLRTFNNLRTNFVREIPREEFFNTYTC |
Ga0210406_100637486 | 3300021168 | Soil | VAVEKGTKPVISVNFSAYDKRRFNNLRANFVREIPREEFFNTYA |
Ga0210406_101530794 | 3300021168 | Soil | LLKKGTKAVICVNFSACGKRRFNNLRANFVREIPRKEFFNTHA |
Ga0210400_107995501 | 3300021170 | Soil | MIAEKGVAVEKGTKQVISVNFSAYDKRRFNNLRANFVREIPREEFFNTYA |
Ga0210397_108148502 | 3300021403 | Soil | VAVEKGTKAVISVNFSAYGKRTFNNLRANFVREIPREEFFNTYSSWHSTSRN |
Ga0210402_113930741 | 3300021478 | Soil | AVEKGTKAVISVNFSAYGKRTFNNLRANFVREIPREEFFNTYSSWHSTSRN |
Ga0126371_104951701 | 3300021560 | Tropical Forest Soil | VAVEKGTKAVISLNFSVYSERKFNNLRTNFLAETGQKEF |
Ga0224548_10252391 | 3300022518 | Soil | LAQTGVGVEKGTKAVISVNFSVHGERTFNNLRTDFAVNIRGKEFFN |
Ga0193714_10080881 | 3300023058 | Soil | MTDVVRDVEKGTTAVISVNFTAYVGRTFNNLRTNFADEIPRKEFFNTHVCLQPL |
Ga0224558_11851371 | 3300023090 | Soil | VGVEKGTKAVISVNFNACGEPTFNNLRTKFAIEIP |
Ga0224521_11214541 | 3300024233 | Soil | SITYVAVEKGTKAVISGDFSVFGERTFNNLQTNFAVEIP |
Ga0224522_11068411 | 3300024240 | Soil | YVAVEKGTKAVISGDFSVFGERTFNNLQTNFAVEIP |
Ga0208034_10336703 | 3300025442 | Peatland | VAVEKGTKAVISVYFSAYGQRTFNNLRANFVGEIPRKEFFN |
Ga0208034_10403052 | 3300025442 | Peatland | VAVEEGTKALISVNFSAYGQRTFNNLRANFVGEIPRKEFFNS |
Ga0208034_10507872 | 3300025442 | Peatland | VAVEKGTKAVISVHFSAYGQRTFNNLRANFVGEIPRKEFFNT |
Ga0208037_10103791 | 3300025448 | Peatland | MPVAVEKGTKAVISVNFSAHGERTFNNLRTNFVGEIP |
Ga0208039_10499272 | 3300025454 | Peatland | VAVEKGTKAVISVNFSAHGERTFNNLRTNFVGEIP |
Ga0207930_11172771 | 3300025604 | Arctic Peat Soil | SREQLSQTGVAVEKGTKAVISVNFSVCGQRTFNNLQTNFIVEIP |
Ga0209350_10233861 | 3300026277 | Grasslands Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNS |
Ga0209802_101015311 | 3300026328 | Soil | VWKKERFSTKFGLLVKWRVGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKEFFNS |
Ga0257172_10754261 | 3300026482 | Soil | VAVEKGTKAVISVNFSVYGRQTFNNLRTNFAVGNSLKRVF |
Ga0209690_11721501 | 3300026524 | Soil | VGVEKGTKAVISANSNVYGGLEVNNLRSNFVAEIPGKEFFNSH |
Ga0209378_10218831 | 3300026528 | Soil | VGVEKGTKAVISANSSAYGELEFNNLRANFFAEIPAKE |
Ga0209378_10257671 | 3300026528 | Soil | VEKGTRAVISVNFSACGERTFNNLRANFVIEKAGKEFFNSHA |
Ga0209160_11954871 | 3300026532 | Soil | VRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPEKEFFNSHAI |
Ga0209056_101382174 | 3300026538 | Soil | VRVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNS |
Ga0209376_11434634 | 3300026540 | Soil | GVEKGTKAVISANSSVYGGLEFNNLRSNFVAEIPGKEFFNSHAI |
Ga0209376_12336451 | 3300026540 | Soil | VGVEKGTKAVFSANSNVYGGLEVNNLRSNLVAEIPG |
Ga0209648_107603271 | 3300026551 | Grasslands Soil | GTKAVISVNFSAYGERTFNNLRANFAGEIPRKEFFNSHAGFNS |
Ga0209332_10547421 | 3300027439 | Forest Soil | GVAVEKGTKAVISVNFSAYGLRTFNNLRTNFAVEIP |
Ga0209528_10052751 | 3300027610 | Forest Soil | TLLLKNPVAVEKGTKAVISVNFSVYGRRTFNNLRTNFALEIP |
Ga0208044_11303261 | 3300027625 | Peatlands Soil | VEKGTKALISVHFSTNGERTFNNLRTNFVGEIPWKEFFNSHRP |
Ga0209117_10036199 | 3300027645 | Forest Soil | MLKTGVGVEKGTKAVISVNSSAYDERTFNNLRADFG |
Ga0209117_10072101 | 3300027645 | Forest Soil | ASTGVAVEKGTKTVISVNFSVYGRRTFNNLQTNFAAEIP |
Ga0209217_10108601 | 3300027651 | Forest Soil | VAVEKGTKAVISATFSVYSERTFNNLQRNFEIERLRKEFFNSH |
Ga0209009_11233911 | 3300027667 | Forest Soil | GVAVEKGTKALISVNFSAYGLRTFNDLRTNFAVEIP |
Ga0209118_10315493 | 3300027674 | Forest Soil | MKTGVGVEKGTKAVISVNSSASGQRTFNNLRANFAAEIPRKEFF |
Ga0209011_11647832 | 3300027678 | Forest Soil | LLKTGVAVEKGTKAVISVNFSAYGKRRFNNLRANFVREIPREEFFNTYGIFQQQ |
Ga0209689_10357855 | 3300027748 | Soil | VGVEKGTKAVFSANSNVYGGLEVNNLRSNLVAEIPGKEFFNSHR |
Ga0209448_102329172 | 3300027783 | Bog Forest Soil | VAVEKGTKAVISANFSVDGERTFNNLRINFAVEIRWKEFFNSHKAFTLTI |
Ga0209039_100107163 | 3300027825 | Bog Forest Soil | VGVEKGTKAVISVHFSVYGERTFNKLPTNFVVEMPRKEFFNSHA |
Ga0209517_103596181 | 3300027854 | Peatlands Soil | SPVAVEKGTKAVISVNFSVYDKRTFNNLRTNFAVKIPWKEFFNSHAC |
Ga0209283_106210231 | 3300027875 | Vadose Zone Soil | LAKPGVAVEKGTKAVISVNFSAYGERTFNNLRVNFAGEIP |
Ga0209488_104428232 | 3300027903 | Vadose Zone Soil | LKPGVAIEKGTKEVISVNFSAYGERTFNNLRANFAGEIPRKEFFNSHRR |
Ga0209415_102055812 | 3300027905 | Peatlands Soil | VQWGVAVEKATKAVISVHFSVNGKRTFNSLRTDFVGEIPLKEFFNSPGMLQQ |
Ga0209415_106327771 | 3300027905 | Peatlands Soil | VAVEKGTKAVISINSSVYGERTFNNLRANFAREIRLREFFNSHA |
Ga0209526_104049971 | 3300028047 | Forest Soil | LAKSGVGVEKGTKAVISANRSVSGEPTFNNLRTNF |
Ga0308309_113262772 | 3300028906 | Soil | MTGVAVEKGTKAVISVDFSACGGRTFNKLRMNFAVEIP |
Ga0222749_103920992 | 3300029636 | Soil | EKGTKPVISVNFSAYDKRRFNNLRANFVREIPREEFFNTYTC |
Ga0310037_101583371 | 3300030494 | Peatlands Soil | GVEKGTKAVISANSSVYGRRTFNNLRTSFVVEILRKEFFNSHRR |
Ga0307474_113867791 | 3300031718 | Hardwood Forest Soil | VAVEKGNKAVIPVIFRVDNKRTINNLRTNFAAESPSKEFFNSHAWFQQL |
Ga0307474_116061461 | 3300031718 | Hardwood Forest Soil | LKTGVAVEKGTKAVISVNFGVYGRRAFNDLRTNFAPEIP |
Ga0307473_109372862 | 3300031820 | Hardwood Forest Soil | MTRTGVAVEKGTKAVISVNFSPYGERTFNSLRANFAGEIPR |
Ga0307478_108035932 | 3300031823 | Hardwood Forest Soil | GVAVEKGTKAVISVNFSVYGRRTFNNLQTNFAVEIP |
Ga0311301_102468942 | 3300032160 | Peatlands Soil | VAVEKGTKAVVLMNFSVYDERTFNNLRANFAGEIPRKEFFNSHAC |
Ga0326728_1000125018 | 3300033402 | Peat Soil | MQTGVGVEKGTKQVISANFNACGERRFNGLQANFVFKIP |
Ga0326728_1002461110 | 3300033402 | Peat Soil | MKSPVGVEKGTKAVISVNFSVYGERIFNNLQTNFVVEIP |
Ga0334837_010446_867_1007 | 3300033823 | Soil | LQSGAGWVKANVGVEKGTKAVISLNFSVYGERRFNNLRKNFVGEIP |
Ga0334790_001879_15863_15997 | 3300033887 | Soil | VGVEKGTKAVISVNFSVHGERTFNNLRTDFAVNIRGKEFFNSHA |
Ga0334790_031889_614_766 | 3300033887 | Soil | LAQTGVGVEKGTKAVISVNFSVHGERTFNNLRTDFAVNIRGKEFFNSHRR |
Ga0371488_0099825_766_915 | 3300033983 | Peat Soil | VQRPEAVEKGTKAVISTNFNACGERIFNNLRTNFVGEIPGKEFFNTHAC |
Ga0326724_0006347_20_139 | 3300034091 | Peat Soil | MKYPVGVEKGTKAVISANFRAYGERTFNDLRTNFVVEIA |
⦗Top⦘ |