NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013369

Metagenome / Metatranscriptome Family F013369

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013369
Family Type Metagenome / Metatranscriptome
Number of Sequences 272
Average Sequence Length 43 residues
Representative Sequence MATNFVQIENDAEIKQRLEAERARLRKIAGLDQPKHFHRPVER
Number of Associated Samples 208
Number of Associated Scaffolds 272

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 98.90 %
% of genes from short scaffolds (< 2000 bps) 91.54 %
Associated GOLD sequencing projects 201
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.559 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(23.529 % of family members)
Environment Ontology (ENVO) Unclassified
(26.838 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.824 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.35%    β-sheet: 0.00%    Coil/Unstructured: 74.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 272 Family Scaffolds
PF04055Radical_SAM 2.57
PF13620CarboxypepD_reg 1.47
PF00294PfkB 1.10
PF00005ABC_tran 1.10
PF01594AI-2E_transport 1.10
PF00873ACR_tran 0.74
PF13545HTH_Crp_2 0.74
PF02492cobW 0.74
PF13444Acetyltransf_5 0.74
PF02517Rce1-like 0.74
PF02310B12-binding 0.74
PF10282Lactonase 0.74
PF08240ADH_N 0.74
PF07963N_methyl 0.74
PF04454Linocin_M18 0.37
PF16363GDP_Man_Dehyd 0.37
PF13186SPASM 0.37
PF04168Alpha-E 0.37
PF04986Y2_Tnp 0.37
PF00392GntR 0.37
PF01980TrmO 0.37
PF13785DUF4178 0.37
PF00111Fer2 0.37
PF01061ABC2_membrane 0.37
PF02321OEP 0.37
PF17131LolA_like 0.37
PF07883Cupin_2 0.37
PF13231PMT_2 0.37
PF00884Sulfatase 0.37
PF00924MS_channel 0.37
PF09411PagL 0.37
PF13173AAA_14 0.37
PF00072Response_reg 0.37
PF01642MM_CoA_mutase 0.37
PF13091PLDc_2 0.37
PF07503zf-HYPF 0.37
PF00196GerE 0.37
PF01081Aldolase 0.37
PF00155Aminotran_1_2 0.37
PF01546Peptidase_M20 0.37
PF16576HlyD_D23 0.37
PF01627Hpt 0.37
PF03824NicO 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 272 Family Scaffolds
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 1.10
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.74
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 0.74
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.74
COG0068Hydrogenase maturation factor HypF (carbamoyltransferase)Posttranslational modification, protein turnover, chaperones [O] 0.37
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.37
COG08002-keto-3-deoxy-6-phosphogluconate aldolaseCarbohydrate transport and metabolism [G] 0.37
COG1720tRNA (Thr-GGU) A37 N6-methylaseTranslation, ribosomal structure and biogenesis [J] 0.37
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.37
COG2307Uncharacterized conserved protein, Alpha-E superfamilyFunction unknown [S] 0.37
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.56 %
UnclassifiedrootN/A15.44 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459023|GZGNO2B02HYIZWAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101295251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300000559|F14TC_102057567Not Available834Open in IMG/M
3300000650|AP72_2010_repI_A1DRAFT_1020169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300001175|JGI12649J13570_1009602All Organisms → cellular organisms → Bacteria → Acidobacteria1159Open in IMG/M
3300001175|JGI12649J13570_1028248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300002245|JGIcombinedJ26739_100143489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2256Open in IMG/M
3300002245|JGIcombinedJ26739_100599083All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium979Open in IMG/M
3300003505|JGIcombinedJ51221_10319010All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium632Open in IMG/M
3300003659|JGI25404J52841_10074519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium709Open in IMG/M
3300004479|Ga0062595_100533154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae893Open in IMG/M
3300004800|Ga0058861_12036515All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium523Open in IMG/M
3300005293|Ga0065715_10977888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300005329|Ga0070683_100075562All Organisms → cellular organisms → Bacteria3148Open in IMG/M
3300005332|Ga0066388_103608472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium790Open in IMG/M
3300005332|Ga0066388_107303176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300005434|Ga0070709_10601270All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300005435|Ga0070714_101391702Not Available685Open in IMG/M
3300005467|Ga0070706_100035236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4622Open in IMG/M
3300005535|Ga0070684_100121199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans2353Open in IMG/M
3300005540|Ga0066697_10761947All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium527Open in IMG/M
3300005548|Ga0070665_102080131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300005552|Ga0066701_10136696All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300005554|Ga0066661_10549374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300005555|Ga0066692_10181027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1310Open in IMG/M
3300005577|Ga0068857_101331678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300005610|Ga0070763_10246086All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium968Open in IMG/M
3300005610|Ga0070763_10266129All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300005614|Ga0068856_100649834All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300005764|Ga0066903_104986716All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300005764|Ga0066903_105523886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae666Open in IMG/M
3300006028|Ga0070717_11173791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300006052|Ga0075029_100009737All Organisms → cellular organisms → Bacteria5294Open in IMG/M
3300006059|Ga0075017_100981873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300006059|Ga0075017_101334879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium563Open in IMG/M
3300006086|Ga0075019_10739723All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300006163|Ga0070715_10376709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae782Open in IMG/M
3300006173|Ga0070716_101484727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300006175|Ga0070712_101113053All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300006800|Ga0066660_10293932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1293Open in IMG/M
3300006800|Ga0066660_10591371All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae928Open in IMG/M
3300006852|Ga0075433_10074834All Organisms → cellular organisms → Bacteria2980Open in IMG/M
3300006931|Ga0097620_102246004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium602Open in IMG/M
3300007258|Ga0099793_10467451All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300009525|Ga0116220_10100651All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1224Open in IMG/M
3300009553|Ga0105249_12163689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300009630|Ga0116114_1113192All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300009700|Ga0116217_10977562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300009824|Ga0116219_10671616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300010046|Ga0126384_12037640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300010048|Ga0126373_10272320Not Available1676Open in IMG/M
3300010048|Ga0126373_10380729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1431Open in IMG/M
3300010048|Ga0126373_12509653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300010339|Ga0074046_10627879All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300010343|Ga0074044_10142046All Organisms → cellular organisms → Bacteria → Acidobacteria1608Open in IMG/M
3300010358|Ga0126370_10870388All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus811Open in IMG/M
3300010358|Ga0126370_11470073Not Available646Open in IMG/M
3300010359|Ga0126376_10354290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1302Open in IMG/M
3300010359|Ga0126376_12199802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300010360|Ga0126372_11358073Not Available742Open in IMG/M
3300010361|Ga0126378_12586000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300010366|Ga0126379_11743376All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300010366|Ga0126379_12665700Not Available597Open in IMG/M
3300010366|Ga0126379_13845266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300010376|Ga0126381_101097282All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300010376|Ga0126381_101216429Not Available1089Open in IMG/M
3300010396|Ga0134126_12295360Not Available588Open in IMG/M
3300010398|Ga0126383_12886030Not Available561Open in IMG/M
3300010937|Ga0137776_1665057All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300011120|Ga0150983_11901973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300011269|Ga0137392_11564311All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300012201|Ga0137365_10548508All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300012202|Ga0137363_10523310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium998Open in IMG/M
3300012204|Ga0137374_10061525All Organisms → cellular organisms → Bacteria3764Open in IMG/M
3300012351|Ga0137386_11093728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300012925|Ga0137419_11717451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300012951|Ga0164300_10306303Not Available833Open in IMG/M
3300012971|Ga0126369_13290161All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300012986|Ga0164304_11402618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300013308|Ga0157375_11843759Not Available717Open in IMG/M
3300014165|Ga0181523_10386849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300015241|Ga0137418_10558341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300015372|Ga0132256_100856200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1025Open in IMG/M
3300015372|Ga0132256_101044245Not Available932Open in IMG/M
3300016294|Ga0182041_10861853All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300016750|Ga0181505_10662743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300017792|Ga0163161_11936342All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300017928|Ga0187806_1321462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300017929|Ga0187849_1360485All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300017930|Ga0187825_10232641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300017933|Ga0187801_10039349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1690Open in IMG/M
3300017933|Ga0187801_10256073Not Available704Open in IMG/M
3300017934|Ga0187803_10015820All Organisms → cellular organisms → Bacteria3007Open in IMG/M
3300017947|Ga0187785_10443691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300017955|Ga0187817_10070748All Organisms → cellular organisms → Bacteria2170Open in IMG/M
3300017955|Ga0187817_10301624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1021Open in IMG/M
3300017970|Ga0187783_10012778All Organisms → cellular organisms → Bacteria → Acidobacteria6179Open in IMG/M
3300017972|Ga0187781_10197681All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300017972|Ga0187781_10335544All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300017972|Ga0187781_10430894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium943Open in IMG/M
3300017972|Ga0187781_10592578Not Available799Open in IMG/M
3300017973|Ga0187780_11288144Not Available537Open in IMG/M
3300017974|Ga0187777_10505355All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300017975|Ga0187782_11547401All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300017995|Ga0187816_10233769All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300017995|Ga0187816_10393030All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300018006|Ga0187804_10009682All Organisms → cellular organisms → Bacteria → Acidobacteria3267Open in IMG/M
3300018007|Ga0187805_10014401All Organisms → cellular organisms → Bacteria3377Open in IMG/M
3300018008|Ga0187888_1166919All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
3300018020|Ga0187861_10341443All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300018030|Ga0187869_10206130All Organisms → cellular organisms → Bacteria → Acidobacteria961Open in IMG/M
3300018037|Ga0187883_10290532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300018042|Ga0187871_10332630Not Available840Open in IMG/M
3300018044|Ga0187890_10751601Not Available551Open in IMG/M
3300018057|Ga0187858_10677644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300018058|Ga0187766_11379566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300018060|Ga0187765_10232904All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium1078Open in IMG/M
3300018060|Ga0187765_11220119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300018062|Ga0187784_10551088All Organisms → cellular organisms → Bacteria → Acidobacteria928Open in IMG/M
3300018064|Ga0187773_10911364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300018064|Ga0187773_11122594Not Available523Open in IMG/M
3300018085|Ga0187772_10156767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1509Open in IMG/M
3300018085|Ga0187772_10185568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71391Open in IMG/M
3300018085|Ga0187772_10256042All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1190Open in IMG/M
3300018085|Ga0187772_10423744All Organisms → cellular organisms → Bacteria → Acidobacteria929Open in IMG/M
3300018085|Ga0187772_11260186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300018086|Ga0187769_11513754All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300018088|Ga0187771_10714973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium850Open in IMG/M
3300018088|Ga0187771_11203404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300018090|Ga0187770_10118476All Organisms → cellular organisms → Bacteria1993Open in IMG/M
3300019240|Ga0181510_1022615All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300019275|Ga0187798_1112747All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300019275|Ga0187798_1753383All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300020580|Ga0210403_10585263All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300020580|Ga0210403_10649877All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300020580|Ga0210403_11018760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300020581|Ga0210399_10816373All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300020583|Ga0210401_10250275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1631Open in IMG/M
3300020583|Ga0210401_10561544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1003Open in IMG/M
3300020583|Ga0210401_10562325All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1002Open in IMG/M
3300021088|Ga0210404_10814039Not Available534Open in IMG/M
3300021168|Ga0210406_10064218All Organisms → cellular organisms → Bacteria → Acidobacteria3174Open in IMG/M
3300021168|Ga0210406_10434174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300021178|Ga0210408_10974857Not Available657Open in IMG/M
3300021180|Ga0210396_10081781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2932Open in IMG/M
3300021180|Ga0210396_10159589Not Available2023Open in IMG/M
3300021180|Ga0210396_10475296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1095Open in IMG/M
3300021180|Ga0210396_11285049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300021402|Ga0210385_10151538All Organisms → cellular organisms → Bacteria → Acidobacteria1659Open in IMG/M
3300021402|Ga0210385_10416030All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300021405|Ga0210387_11042000All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300021405|Ga0210387_11588956Not Available557Open in IMG/M
3300021406|Ga0210386_10218310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1620Open in IMG/M
3300021406|Ga0210386_10710269Not Available866Open in IMG/M
3300021406|Ga0210386_11472094Not Available568Open in IMG/M
3300021420|Ga0210394_10415689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1184Open in IMG/M
3300021420|Ga0210394_11123251Not Available677Open in IMG/M
3300021432|Ga0210384_10268157All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300021433|Ga0210391_10489099All Organisms → cellular organisms → Bacteria → Acidobacteria966Open in IMG/M
3300021444|Ga0213878_10374906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300021474|Ga0210390_11577444All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300021477|Ga0210398_10224699Not Available1530Open in IMG/M
3300021477|Ga0210398_10493031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium998Open in IMG/M
3300021479|Ga0210410_10265822All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1539Open in IMG/M
3300021479|Ga0210410_10803971All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300021479|Ga0210410_11745424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300021559|Ga0210409_10000223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae113196Open in IMG/M
3300021559|Ga0210409_10987811All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300021559|Ga0210409_11357284Not Available587Open in IMG/M
3300021559|Ga0210409_11577639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300021560|Ga0126371_10122760All Organisms → cellular organisms → Bacteria2624Open in IMG/M
3300022502|Ga0242646_1006444All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300022503|Ga0242650_1003618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales960Open in IMG/M
3300022504|Ga0242642_1089156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300022529|Ga0242668_1131323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300022533|Ga0242662_10147346All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300022533|Ga0242662_10223952All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300022708|Ga0242670_1075315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300022709|Ga0222756_1013318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium975Open in IMG/M
3300022715|Ga0242678_1027098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300022717|Ga0242661_1055619All Organisms → cellular organisms → Bacteria → Acidobacteria749Open in IMG/M
3300022717|Ga0242661_1167443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300022718|Ga0242675_1123306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300022731|Ga0224563_1004607All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium982Open in IMG/M
3300023544|Ga0247542_105796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300024179|Ga0247695_1034009Not Available728Open in IMG/M
3300024220|Ga0224568_1026591All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300024271|Ga0224564_1054991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300025460|Ga0208562_1080978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300025898|Ga0207692_10144299All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1357Open in IMG/M
3300025907|Ga0207645_10271521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans1124Open in IMG/M
3300025910|Ga0207684_11428133All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300025911|Ga0207654_10472252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium882Open in IMG/M
3300025916|Ga0207663_10097950All Organisms → cellular organisms → Bacteria1962Open in IMG/M
3300025916|Ga0207663_10579143Not Available880Open in IMG/M
3300025917|Ga0207660_11055726Not Available662Open in IMG/M
3300025922|Ga0207646_11380829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300025928|Ga0207700_11906899Not Available520Open in IMG/M
3300025944|Ga0207661_10011936All Organisms → cellular organisms → Bacteria6310Open in IMG/M
3300026118|Ga0207675_100940947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium881Open in IMG/M
3300026304|Ga0209240_1239910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300027370|Ga0209010_1059758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300027497|Ga0208199_1090464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300027545|Ga0209008_1048275Not Available972Open in IMG/M
3300027591|Ga0209733_1056211All Organisms → cellular organisms → Bacteria1036Open in IMG/M
3300027652|Ga0209007_1106824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300027737|Ga0209038_10116267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300027824|Ga0209040_10216162All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium983Open in IMG/M
3300027842|Ga0209580_10135181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1208Open in IMG/M
3300027842|Ga0209580_10329475All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300027855|Ga0209693_10014716All Organisms → cellular organisms → Bacteria → Acidobacteria3703Open in IMG/M
3300027867|Ga0209167_10032002All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2530Open in IMG/M
3300027869|Ga0209579_10247993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium957Open in IMG/M
3300027889|Ga0209380_10098763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1686Open in IMG/M
3300027895|Ga0209624_10156530All Organisms → cellular organisms → Bacteria → Acidobacteria1507Open in IMG/M
3300027895|Ga0209624_10503328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300027898|Ga0209067_10018046All Organisms → cellular organisms → Bacteria → Acidobacteria3642Open in IMG/M
3300027898|Ga0209067_10714024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300027911|Ga0209698_10377880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1110Open in IMG/M
3300027911|Ga0209698_11064256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300027911|Ga0209698_11389751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300028015|Ga0265353_1018348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300028784|Ga0307282_10511162Not Available583Open in IMG/M
3300028906|Ga0308309_11248209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300028906|Ga0308309_11428611All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300029701|Ga0222748_1085701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300029701|Ga0222748_1128218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300029827|Ga0134606_10127664All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300029914|Ga0311359_10293012All Organisms → cellular organisms → Bacteria → Acidobacteria1350Open in IMG/M
3300029951|Ga0311371_10651272All Organisms → cellular organisms → Bacteria → Acidobacteria1338Open in IMG/M
3300030058|Ga0302179_10080280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1445Open in IMG/M
3300030399|Ga0311353_10252826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1633Open in IMG/M
3300030494|Ga0310037_10305178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300030577|Ga0210260_10373404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300030580|Ga0311355_11703918All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300030597|Ga0210286_1286712All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300030659|Ga0316363_10079382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1493Open in IMG/M
3300031010|Ga0265771_1015569All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300031047|Ga0073995_11235682All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300031128|Ga0170823_16414922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300031718|Ga0307474_10391909All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1080Open in IMG/M
3300031718|Ga0307474_10547439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300031747|Ga0318502_10438142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300031751|Ga0318494_10841360Not Available538Open in IMG/M
3300031777|Ga0318543_10147079Not Available1034Open in IMG/M
3300031781|Ga0318547_10942572Not Available539Open in IMG/M
3300031792|Ga0318529_10498071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300031797|Ga0318550_10346968Not Available719Open in IMG/M
3300031798|Ga0318523_10580616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300031820|Ga0307473_10339776Not Available961Open in IMG/M
3300031820|Ga0307473_11213069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300031823|Ga0307478_10974091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium709Open in IMG/M
3300031912|Ga0306921_10559533Not Available1326Open in IMG/M
3300031945|Ga0310913_10782015All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300031962|Ga0307479_10064490All Organisms → cellular organisms → Bacteria → Acidobacteria3531Open in IMG/M
3300032001|Ga0306922_11363200All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium714Open in IMG/M
3300032001|Ga0306922_11871891Not Available588Open in IMG/M
3300032039|Ga0318559_10295155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300032060|Ga0318505_10421328All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300032160|Ga0311301_10693942All Organisms → cellular organisms → Bacteria → Acidobacteria1433Open in IMG/M
3300032180|Ga0307471_102892206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300032783|Ga0335079_11090279All Organisms → cellular organisms → Bacteria → Acidobacteria809Open in IMG/M
3300032805|Ga0335078_11318671All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300032895|Ga0335074_10598173Not Available1102Open in IMG/M
3300032954|Ga0335083_10691340All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300033004|Ga0335084_11145030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300033158|Ga0335077_10225134All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300033158|Ga0335077_10434702Not Available1402Open in IMG/M
3300033158|Ga0335077_11311616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300033158|Ga0335077_11821132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300033402|Ga0326728_10705006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300033561|Ga0371490_1114892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil23.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland8.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.62%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.41%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.04%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.68%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.94%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.21%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.47%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.47%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.47%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.74%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.74%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.74%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.74%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.74%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.74%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.37%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.37%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.37%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.37%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.37%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.37%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.37%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.37%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.37%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.37%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.37%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.37%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459023Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)EnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000650Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1EnvironmentalOpen in IMG/M
3300001175Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022502Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022503Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022715Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300023544Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300024220Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028015Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029827Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030577Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO131-ARE010SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030597Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031010Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031047Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FA3_019568602170459023Grass SoilMASNFVNISSESEIKARLEAERARLRKIAGLDQPNHFHRPVERAFTAEQ
INPhiseqgaiiFebDRAFT_10129525113300000364SoilMATNLVQIENDAEIKARLEAERARLRKIAGLDQPTHFHRPIERP
F14TC_10205756723300000559SoilMATNLVQIAKEAEIRERLAAERARLRKIAGLDQPE
AP72_2010_repI_A1DRAFT_102016913300000650Forest SoilMATNFVQIENDAEIKQRLEAERARLRKIAGLDQPKHFHRPVERAFTAE
JGI12649J13570_100960223300001175Forest SoilMATQLVQIDNDEEIKQRLEAERSRLRKIAGLDQPTHF
JGI12649J13570_102824813300001175Forest SoilMATKYVQIKNDLDIRQRLEADRTRLRKIAGLDQSPHIHR
JGIcombinedJ26739_10014348913300002245Forest SoilMPSNFVQIATESEIRERLEAERARLRKIAGLDQANHFHRPVERA
JGIcombinedJ26739_10059908313300002245Forest SoilMPSNFVQIATESEIRERLEAERARLRKIAGLDQAN
JGIcombinedJ51221_1031901013300003505Forest SoilMATNLIQINTDEEIKQRLEAERARLRKIAGLDQPTHFHRPIERA
JGI25404J52841_1007451923300003659Tabebuia Heterophylla RhizosphereMATTLVQIEKDEEIKQRLEAERIRLRKIAGLDQPKHFHRPVERAFT
Ga0062595_10053315433300004479SoilMATNLIQIENDSEIKQRLQVERSRLRKIAGLDQPAHFHRPVERAFTADERSQVTIL
Ga0058861_1203651513300004800Host-AssociatedMATNFVQIEKDTEIKKRLEAERSRLRKVAGLGQPEHFRRPLERAFTAEQRAHT
Ga0065715_1097788813300005293Miscanthus RhizosphereMATNLTQIQNDAEIKQRLQAERARLRKIAGLDQPTHFHRPVERAFTA
Ga0070683_10007556233300005329Corn RhizosphereMATNFVQIENDTEIKKRLEAERVRLRKIAGLDQPEHFHRPIERAFTAEQRPHTT
Ga0066388_10360847213300005332Tropical Forest SoilMASNLVQIANDSEIKKRLEAERARLRKIAGLDQPKHFHRPVERA
Ga0066388_10730317633300005332Tropical Forest SoilMATNLVQIANDSEIKARLEAERARLRKIAGLDPPRHFQRPVER
Ga0070709_1060127023300005434Corn, Switchgrass And Miscanthus RhizosphereMATNLVQIKNDSEIKERLTAERARLRKIAGLDQPSHFHRPIERAFTAEQ
Ga0070714_10139170213300005435Agricultural SoilMATNFVQIENESEIKQRLEAERARLRKIAGLDRPEHFHRPV
Ga0070706_10003523663300005467Corn, Switchgrass And Miscanthus RhizosphereMATRLVQIEQDQELKQRLAAEGARLREKAGLTAPSHFHRPVERAFTAE
Ga0070684_10012119913300005535Corn RhizosphereMATNLIQIENDSEIKQRLQVERSRLRKIAGLDPPAHFHRPVER
Ga0066697_1076194713300005540SoilMATNLVQIENDSEIKQRLEAERARLRKIAGLDEPKHFHRPVERAFTADQ
Ga0070665_10208013123300005548Switchgrass RhizosphereMATNLTQIQNDAEIKQRLQAERARLRKIAGLDQPTHFHRPVERAFTAD
Ga0066701_1013669613300005552SoilMATRLVQIEQDQELQQRLAAERARLRQQAGLTAPSHFHRPVE
Ga0066661_1054937413300005554SoilMATTNFVQIENDAEIKQRLDAERARLRKIAGLDQPEHFH
Ga0066692_1018102723300005555SoilMATNFVQIENDSEIKQRLQAERARLRKVAGLDQPAH
Ga0068857_10133167823300005577Corn RhizosphereMSPNLIQIENDLEIKQRLEAERVRLRKIAGLDQPTHFHRPVERAFTAEE
Ga0070763_1024608613300005610SoilMATHLVNIENDSEIKERLAAERTRLRKIAGLDQPTHFHRPVERAFMA
Ga0070763_1026612923300005610SoilMATNLVQIDNDQEIKQRLEAERSRLRKIAGLDQPTHFHRP
Ga0068856_10064983413300005614Corn RhizosphereMATNFVQIENESEIKQRLEAERARLRKIAGLDRPEHFHRPVERA
Ga0066903_10498671613300005764Tropical Forest SoilMASDLVQIANDSEIKKRLEAERIRLRKIAGLDPPQ
Ga0066903_10552388613300005764Tropical Forest SoilMASTRLIQIEQDQEIRQRLNAERVRLRQLAGLDHSQHFHRPIERAF
Ga0070717_1117379113300006028Corn, Switchgrass And Miscanthus RhizosphereMATNFVQIENDSEIKKRLEAERMRLRKIAGLDQPTHFHR
Ga0075029_10000973733300006052WatershedsMATNLVQIENDSEIKQRLEAERARLRKIAGLDPPEHFHRPVERLNRDSTS*
Ga0075017_10098187333300006059WatershedsMATNLVRIENDSEIKERLEAERVRLRKIAGLDQPKHFHRPVERAFT
Ga0075017_10133487913300006059WatershedsMATTNFVQIENDAEIKQRLEAERARLRKIARLDRAEHFHRPVERAFT
Ga0075019_1073972323300006086WatershedsMSTNFVQIENDSEIKQRLEAERMRLRKIAGLDQPT
Ga0070715_1037670913300006163Corn, Switchgrass And Miscanthus RhizosphereMATTNFVQIENDAEIKQRLDAERARLRKIAGLDQPEHFHRPVERAFTA
Ga0070716_10148472723300006173Corn, Switchgrass And Miscanthus RhizosphereMATNLIQIQNDAEIKQRLQAERARLRKIAGLDQPTHF
Ga0070712_10111305313300006175Corn, Switchgrass And Miscanthus RhizosphereMATRLVQIEQDQELKQRLAAERARLREKAGLSAPSH
Ga0066660_1029393243300006800SoilMATNLVQIEKDEEIKQRLQAERARLRQIAGLDQPSHFHRPVERAFTAE
Ga0066660_1059137123300006800SoilMDTKLVQMDQDQEIQQRLSAERARLRRLAGLEQPKHFHRPIER
Ga0075433_1007483433300006852Populus RhizosphereMATNLVQIEKDEEIRQRLEAERARLRKIAGLDEPKHFHRP
Ga0097620_10224600413300006931Switchgrass RhizosphereMATNFVQIENDTEIKKRLEAERARLRKSAGLSQPDHFHRPL
Ga0099793_1046745123300007258Vadose Zone SoilMATRLVQIEQDQELPQRLAAERARLRQQAGLNSPSHFHRPVERAFKA
Ga0116220_1010065113300009525Peatlands SoilMATFVQINTDEEIKQRLEDERLRLRKIAGLDQPTHFHRPIERAFTA
Ga0105249_1216368923300009553Switchgrass RhizosphereMATNFVQIENDTEIKKRLEAERARPRKIAGLSQPDHFHR
Ga0116114_111319213300009630PeatlandMATNFVQIENDSEIKKRLEAERVRLRKIAGLDAPEHFHRPIERAFTA
Ga0116217_1097756213300009700Peatlands SoilMATKLVHIEDDVEIKQRLAAERSRLRRIAGLDQPNHFHRPVERA
Ga0116219_1067161613300009824Peatlands SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDQPEHFHRPVERAFTAEE
Ga0126384_1203764013300010046Tropical Forest SoilMATNLVQIENDSDIKQRLEAERARLRKIAGLDQPKHFHRP
Ga0126373_1027232023300010048Tropical Forest SoilMATNLVQIDTDAEIKQRLEAERARLRKLAGLDQAEHF
Ga0126373_1038072923300010048Tropical Forest SoilMATNLIQIENESEIKQRLDAERARLRKIAGLDRPNHFHRP
Ga0126373_1250965313300010048Tropical Forest SoilMATNLVQIRSDSEIKTRLEAERARLRKIAGLDAPKHFHRPVER
Ga0074046_1062787913300010339Bog Forest SoilMVTNFVQIADGSEIKKRLEAERVRLRKIAGLDPPEHFHRPVER
Ga0074044_1014204613300010343Bog Forest SoilMMAANFVQIENAQEIKQRLEAERMRLRKIAGLDRPDHFHRP
Ga0126370_1087038813300010358Tropical Forest SoilMASNLVQIANESEIRARLEAERARLRKIAGLDQARH
Ga0126370_1147007323300010358Tropical Forest SoilMATNLVQIDSDIEIKKRLEQERARLRQIAGLDQPKHF
Ga0126376_1035429013300010359Tropical Forest SoilMATNLVQIEKDEEIRKRLDAERARLRKIAGLDQPTHFHRPVERAFT
Ga0126376_1219980213300010359Tropical Forest SoilMATNLVQIENDSEIKARLEAERARLRKIAGLDQPTHFHRP
Ga0126372_1135807323300010360Tropical Forest SoilMATNLVHITSDSESKKKLEAERARLRKIAGLDAPKHFH
Ga0126378_1258600013300010361Tropical Forest SoilMATNLVQIDTDAEIKQRLEAERARLRKLAALDQAELFPLL*
Ga0126379_1174337623300010366Tropical Forest SoilMATNLVQIEKEDEIRQRLEAERARLRQIAGLDQPKHFHRPVER
Ga0126379_1266570013300010366Tropical Forest SoilMATNLIQIENESENKQRLEAERARLRKIAGLDRPN
Ga0126379_1384526623300010366Tropical Forest SoilMASNLVQIASDSEIKKRLEAERARLRKIAGLDQPEHFHRPIERSFKAEERGRV
Ga0126381_10109728213300010376Tropical Forest SoilMATNLVQIDTESEIKQRLEQERARLRKLHGLDRPTHF
Ga0126381_10121642923300010376Tropical Forest SoilMATNLVQIENDSDIQQRLEAERARLRKIAGLDQPKHF
Ga0134126_1229536013300010396Terrestrial SoilMATNFVQIENDTEIKKRLEAERARLRQIAGLSQPDHFHR
Ga0126383_1288603013300010398Tropical Forest SoilMATNFVQMENELEIKHRREAERARLRKIAGLDRPDHFHR
Ga0137776_166505713300010937SedimentMATNLIQIENDSEIKQRLEAERLRLRKIAGLDRPSHFHRPVERAFT
Ga0150983_1190197323300011120Forest SoilMATNLVRIEDDVEIKQRLAAERARLRKIAGLDAQDHFHRPVERAFTAE
Ga0137392_1156431123300011269Vadose Zone SoilMATNFVQIENDSEIKKRLQAERMRLRKIAGLDQPE
Ga0137365_1054850823300012201Vadose Zone SoilMATNFVQIENDSEIKQRLEAERARLRKIAGLDQPTHFHRPVERAFTADQRAR
Ga0137363_1052331023300012202Vadose Zone SoilMATRLVQIEQDQELKQRLAAERARLREKAGLSAPSHFH
Ga0137374_1006152513300012204Vadose Zone SoilMATNFVQIENDSEIKARLEAERARLRKIAGLDQPTHFHRPIERAF
Ga0137386_1109372823300012351Vadose Zone SoilMATNLVQIEKDDEIKQRLQAERARLRQIAGLDQPKHFHRPVERAFTAEE
Ga0137419_1171745113300012925Vadose Zone SoilMATNLVRIENNAEIKERLAAERARLRKIAGLDQPAHFHRPVERAFTAEQ
Ga0164300_1030630313300012951SoilMATNLVRIENDSEIKERLAAERARLRKIAGLDQPAHFHRPVERA
Ga0126369_1329016113300012971Tropical Forest SoilMATNFVQIESDTEIKKRLEMERTRLRKVAGLSQPEHFHRPIERAFT
Ga0164304_1140261813300012986SoilMATNLVRIENDSEIKERLAAERARLRKIAGLDQPAHFHRPVERAFTAEQRKH
Ga0157375_1184375913300013308Miscanthus RhizosphereMATNFVQIEKDTEIKKRLEAERSRLRKVAGLGQPEHFR
Ga0181523_1038684913300014165BogMMATNLVQIDNDREIKQRLEAERARLRKIAGLDQPTHFH
Ga0137418_1055834113300015241Vadose Zone SoilMATNLVRIENNSEIKERLAAERARLRKIAGLDQPAHFHRPVERAFTAEQ
Ga0132256_10085620033300015372Arabidopsis RhizosphereMASNFVQIENDSEIKQRLEAERARLRKIAGLDQPKHFQRPV
Ga0132256_10104424523300015372Arabidopsis RhizosphereMATNFVQIENESEIKQRLEAERARLRKIAGLDRPEHFHRPVERAF
Ga0182041_1086185323300016294SoilMATKFVQIEDDLEIRQRLDAERARLRKIAGLDQPTHFHRPVERAF
Ga0181505_1066274323300016750PeatlandMATNLINIENDQEIKQRLAAERARLRKIAGLDQPEHFHRPVERAFT
Ga0163161_1193634213300017792Switchgrass RhizosphereMATNLIQIENDSEIKQRLQVERSRLRKIAGLDQPAHFHRPVERAFTADERSQV
Ga0187806_132146213300017928Freshwater SedimentMATFVQINTDEEIKQRLEAERIRLRKIAGLDQPTHFHRPIERAFTADERGKVTIL
Ga0187849_136048513300017929PeatlandMATNLIQIENDSEIKKRLEAERARLRKIAGLDAPEHFHRP
Ga0187825_1023264113300017930Freshwater SedimentMATNFVKIENDAEIKQRLEAERMRLRKIAGLDRPDHFH
Ga0187801_1003934913300017933Freshwater SedimentMATFVQINTDEEIKQRLEAERIRLRKIAGLDQPTHFHRPIERAF
Ga0187801_1025607313300017933Freshwater SedimentMATNFVQIGNDSEIKKRLEAERARLRMIAGLDQPEHFHRP
Ga0187803_1001582043300017934Freshwater SedimentMATNFVQIENDSEIKQRLEAERLRLRRIAGLERPDHFHRPVERAFTAEQRAHT
Ga0187785_1044369113300017947Tropical PeatlandMATNLVQIEKDSEIKQRLEAERARLRKIAGLDKPDHFHRPV
Ga0187817_1007074843300017955Freshwater SedimentMTTNLVHIENEAEIKARLEAERTRLRKIAGLDQRTHFHRPVERAF
Ga0187817_1030162423300017955Freshwater SedimentMATNFVQIENDSEIKQRLEAERVRLRKIAGLERPDHFHRPV
Ga0187783_1001277883300017970Tropical PeatlandMATNLVRIKNDAEIKERLEAERARLRKIAGLDQPEHFHRPIERAF
Ga0187781_1019768133300017972Tropical PeatlandMATNLVNIESDQEIKQRLEAERIRLRRIAGLEPAEHFHRPVER
Ga0187781_1033554413300017972Tropical PeatlandMATNLVRIKNDAEIKQRLEAERARLRKIAGLDQPEHFHRPIERAFTA
Ga0187781_1043089413300017972Tropical PeatlandMATHLVNIENDSEIKQRLEAERIRLRKIAGLDQPKHFHRPVE
Ga0187781_1059257823300017972Tropical PeatlandMATKYVQIENDLDIQQRLEAERIRLRKIAGLDQPTHFHRPVERAFTAEE
Ga0187780_1128814413300017973Tropical PeatlandMATNLVKIHSDAEIQQRLEAERARLRKIAGLDQQPNHFHRPIERPFTAE
Ga0187777_1050535513300017974Tropical PeatlandMATNLVRIENDQEIQERLAAKRAQLRQIAGLDKPTH
Ga0187782_1154740113300017975Tropical PeatlandMATHLVNIENDSEIKQRLEAERARLRKIAGLDKPTHFHRPVERAF
Ga0187816_1023376913300017995Freshwater SedimentMATNLVQIEDDQEIKNRLEAERMRLRKIAGLDRPTHF
Ga0187816_1039303013300017995Freshwater SedimentMATKLVHIEDDVEIKQRLAAERARLRRIAGLDQPNHFHRPV
Ga0187804_1000968213300018006Freshwater SedimentMATFVQINTDEEIKQRLEAERIRLRKIAGLDQPTHFHRPIERAFTA
Ga0187805_1001440113300018007Freshwater SedimentMATNFVQIENDSEIKQRLEAERERLRKIAGLERPDHFHRP
Ga0187888_116691913300018008PeatlandMATYLVQIDNDEEIKQRLEAERSRLRKIAGLDQPTHF
Ga0187861_1034144323300018020PeatlandMATNFVPIENDSEIKKRLEAERARLRKIAGLDQPEHFHRPIER
Ga0187869_1020613033300018030PeatlandMATHLVRIDNDEEIKQRLEAERARLRKIAGLDQPTHFHRPVERAFKA
Ga0187883_1029053213300018037PeatlandMATNFVQIENDSEIKKRLEAERVRLRKIAGLDAPEHFHRPIERAF
Ga0187871_1033263013300018042PeatlandMATKFVQIENDVELQQRLEAERMRLRKIAGLDRPTH
Ga0187890_1075160113300018044PeatlandMATNFVQIENDTEIKKRLDAERMRLRKIAGLDQPE
Ga0187858_1067764413300018057PeatlandMATNFVPIENDSEIKKRLEAERARLRKIAGLDQPEH
Ga0187766_1137956613300018058Tropical PeatlandMATNLVQIENGSEIKQRLAAERVRLRKIAGLDQPTHFHRPIERAFTAEQR
Ga0187765_1023290423300018060Tropical PeatlandMPGLVQIEQDQEIQERLRAERIRLRQLAGLGQPQHFHRPVERAFTA
Ga0187765_1122011913300018060Tropical PeatlandMATNLVRIENDQEIKQRLEAERVRLRKIAGLDRPNHFQRPVERP
Ga0187784_1055108813300018062Tropical PeatlandMATHLVQIESEQEIKQRLEQERARLRKIAALDRPSHF
Ga0187773_1091136413300018064Tropical PeatlandMATNLIQIENDQEIRQRLEAERQRLRRIAGLDTPQHFHRPVERAFTAEE
Ga0187773_1112259413300018064Tropical PeatlandMATNLVQIESEAEIKQRLEAERKRLRRIAGLEPAEHFHRPIERAFTADE
Ga0187772_1015676723300018085Tropical PeatlandMATNFVQIENDSEIKQRLEAERARLRKIAGLDAPKHFHRPVERAFTAEQ
Ga0187772_1018556813300018085Tropical PeatlandMATNFVQIENDSEIKERLEAERARLRKIAGLDQPNHFHRPVERAFTA
Ga0187772_1025604223300018085Tropical PeatlandMATNFVQIENDAEIKQRLEAERVRLRKIAGLDAPKHFHRPVERAFTAEQRAHTTILF
Ga0187772_1042374413300018085Tropical PeatlandMATNLVQIEKDQEIRQRLEAERARLRKIAGLDRADHFHRPVERA
Ga0187772_1126018613300018085Tropical PeatlandMATHLVNIESDQEIKQRLEAERKRLRRIAGLEPAEHFHRPVERAFTA
Ga0187769_1151375413300018086Tropical PeatlandMMASTRFVQIQDPEIQQRLAAERMRLRKLAGLENH
Ga0187771_1071497313300018088Tropical PeatlandMATNLVQIENDTEIKERLAAERARLRKIAGLDRPTH
Ga0187771_1120340423300018088Tropical PeatlandMATHLVNIESDSELKQRLEAERARLRKIAGLDKPTHFHRPVE
Ga0187770_1011847613300018090Tropical PeatlandMATHLVQIESEQEIQQRLEEERARLRKIAGLDRPG
Ga0181510_102261513300019240PeatlandMATNLINIENDQEIKQRLAAERARLRKIAGLDQPEHFHRPVERAFTAEQRNKV
Ga0187798_111274723300019275PeatlandMATHLVNIESDSELKQRLEAERARLRKIAGLDKPTHFHRPIEH
Ga0187798_175338313300019275PeatlandMATHLVNIENDTEIKQRLEAARARLRKVAGLDRPKHFHRPVERAFT
Ga0210403_1058526323300020580SoilMATNLVQIGNDAEMEIKKRLETERARLRKVAGLDTPDHFHRPIERAFTAE
Ga0210403_1064987723300020580SoilMATNFVQIESDSEIKQRLEAERVRLRRIAGLDKPTHLHRPVER
Ga0210403_1101876023300020580SoilMATRLVQIEQDQDLQQRLAAERARLRQQAGLASPSHFHRPIERAFKAE
Ga0210399_1081637323300020581SoilMATHLVQIEDDVEIKQRLAAERARLRRIAGLDAPDHFHRPVERAFTAEE
Ga0210401_1025027513300020583SoilMATNFVQIENDSEIKQRLEAERMRLRKIAGLDQPTHFHRP
Ga0210401_1056154413300020583SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDRPEHFHRPVERAF
Ga0210401_1056232513300020583SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDQPTHFHRPVERAFTAEQRSKVT
Ga0210404_1081403913300021088SoilMATNLVQIGNDAEIEIKKRLEAERARLRKIAGLDKPE
Ga0210406_1006421843300021168SoilMATNLVQIGNDAEIEIKKRLEAERARLRKIAGLDKPEHFHRPVE
Ga0210406_1043417423300021168SoilMASNLVKIANDAEIRERLEAERARLRKIAGLDEPKHFHRPIERA
Ga0210408_1097485723300021178SoilMATNFVRIENDEEIKQRLAAERVRLRKIAGLDRPDH
Ga0210396_1008178133300021180SoilMSTNFVQIENDSEIKKRLEAERMRLRKIAGLDEPT
Ga0210396_1015958933300021180SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDRPEHF
Ga0210396_1047529623300021180SoilMATHLVNIENDSEIKERLAAERTRLRKIAGLDQPTHFHRPVERAFMAEERRRV
Ga0210396_1128504913300021180SoilMATNLVKISSETDIKARLEAERARLRKIAGLDQPDHFHRPVERA
Ga0210385_1015153813300021402SoilMATNLIQINTDEEIKQRLEAERARLRKIAGLDQPTHFHRPMARAFTA
Ga0210385_1041603013300021402SoilMATNLINIENDQEIKQRLAAERARLRKIAGLDQPEHFHR
Ga0210387_1104200023300021405SoilMATNLVQIGNDAEIEIKKRLEAERARLRKIAGLDKPEHFHRPV
Ga0210387_1158895613300021405SoilMATKFVQIENDLEIRQRLEAERMRLRKIAGLDQPT
Ga0210386_1021831013300021406SoilMATNLVQIENDSEIKQRLETERMRLRKIAGLDQPKHFHR
Ga0210386_1071026913300021406SoilMPSNFVQIATESEIRERLEAERTRLRKIAGLDQANHFH
Ga0210386_1147209413300021406SoilMASNLVQIANESEIKARLEAERARLRKVAGLDQPKHF
Ga0210394_1041568933300021420SoilMATNFVQIENDSEIKKRLETERMRLRKIAGLDQPSHF
Ga0210394_1112325113300021420SoilMATNLVQIGNDAEIEIKKRLEAERARLRKIAGLDTPEHF
Ga0210384_1026815723300021432SoilMATNFVQIENDSEIKQRLEAERARLRKIAGLDKPTHFHRPVERAFT
Ga0210391_1048909933300021433SoilMPTNFVQIENDQEIKQRLEAERIRLRKIAGLDEPKHFHRPVERAF
Ga0213878_1037490613300021444Bulk SoilMPTKYIQIEDDAEIKRRLEAERIRLRKIAGLDQPPHFHRPVERAFTAEQR
Ga0210390_1157744413300021474SoilMATNLIQINTDEEIKQRLEAERARLRKIAGLDQPTHFHRPMER
Ga0210398_1022469913300021477SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDQPT
Ga0210398_1049303123300021477SoilMATNFVQIENDSEIKQRLEAERMRLRKIAGLDEPKHFHR
Ga0210410_1026582243300021479SoilMATNLIQINTDEEIKQRLEAERIRLRKIAGLDQPTHFHRPIERAFTADERS
Ga0210410_1080397123300021479SoilMATNLVQIGNDAEMEIKKRLEAERARLRKVAGLDTPD
Ga0210410_1174542413300021479SoilMATNFVQIENDSEIKKRLETERMRLRKIAGLDQPS
Ga0210409_100002231013300021559SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDRPE
Ga0210409_1098781133300021559SoilMATHLVQIEDDVEIKQRLAAERARLRKVAGLDAPDHFHRPVERA
Ga0210409_1135728413300021559SoilMPSNFVQIATESEIRERLEAERARLRKIAGLDQAKHFH
Ga0210409_1157763913300021559SoilMATHLVRIEDDVEIKQRLAAERARLRKIAGLDAQDHF
Ga0126371_1012276013300021560Tropical Forest SoilMATNLVHIENDAEIKQRLEAERARLRKIAGLDQPKHFHRPVER
Ga0242646_100644423300022502SoilMATHLVQIEDDVEIKQRLAAERARLRKIAGLDAPDHFH
Ga0242650_100361813300022503SoilMATNLVQIKNDSEIKERLAAERARLRKIAGLDHPTHFHRPVERAFTAEQRKQVT
Ga0242642_108915613300022504SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDQPTHFHRPVERAFTAEQRS
Ga0242668_113132313300022529SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTHFHRPVERAFT
Ga0242662_1014734613300022533SoilMATTNFVQIENDAEIKQRLDAERARLRKIAGLDQPEHFHRPVERAF
Ga0242662_1022395213300022533SoilMATNLINIENDQEIKQRLAAERARLRKIAGLDQPDHFHRP
Ga0242670_107531513300022708SoilMATNLVQIDNDQEIKQRLEAERSRLRKIAGLDQPTHFHRPVERAFTA
Ga0222756_101331813300022709SoilMATNFVQIENDSEIKKRLETERMRLRKIAGLDQPSHFHRPV
Ga0242678_102709813300022715SoilMATNFVQIENDSEIKKRLETERMRLRKIAGLDQPSHFHRP
Ga0242661_105561923300022717SoilMATHLVRIEDDVEIKQRLAAERARLRKIAGLDAQDHFHRPVER
Ga0242661_116744313300022717SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDQLTHFHRPVERAFTAEQRSKV
Ga0242675_112330613300022718SoilMATNFVQIENDQEIKQRLDAERARLRKIAGLDRPSHFHRPVER
Ga0224563_100460713300022731SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTHFHRPVERAF
Ga0247542_10579613300023544SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTHFHRPVER
Ga0247695_103400913300024179SoilMATNFVQIENESEIKQRLEAERARLRKIAGLDRPEHF
Ga0224568_102659123300024220Plant LitterMATNLVHIENDAEIKQRLETERARLRQIAGLDRPTHFHRPVER
Ga0224564_105499113300024271SoilMATNLINIENDQEIKQRLAAERARLRKIAGLDQPEHFHRPV
Ga0208562_108097813300025460PeatlandMATNFVPIENDSEIKKRLEAERARLRKIAGLDQPEHFHRPIERGF
Ga0207692_1014429923300025898Corn, Switchgrass And Miscanthus RhizosphereMATNFVQIENDAEIKARLEAERARLRKIAGLDQPAHFHRPVERA
Ga0207645_1027152113300025907Miscanthus RhizosphereMATNLIQIENDSEIKQRLQVERSRLRKIAGLDQPAHFHRP
Ga0207684_1142813323300025910Corn, Switchgrass And Miscanthus RhizosphereMATNLVQIEKDDEIKQRLQAERARLRQIAGLDQPKHFHRPVERAFTAE
Ga0207654_1047225213300025911Corn RhizosphereMATNFVQIENDTEIKKRLEAERVRLRKIAGLDQPEHFHRP
Ga0207663_1009795043300025916Corn, Switchgrass And Miscanthus RhizosphereMATNLVRIENDSEIKDRLAAERARLRKIAGLDQPTHF
Ga0207663_1057914323300025916Corn, Switchgrass And Miscanthus RhizosphereMSSNFVQIATESEIRERLEAERARLRKIAGLDQAKHFHRPV
Ga0207660_1105572623300025917Corn RhizosphereMATNFVQIEKDTEIKKRLEAERSRLRKVAGLGQPEHFRRPLERAFTAEQRAHTT
Ga0207646_1138082913300025922Corn, Switchgrass And Miscanthus RhizosphereMATNLVQIEKDDEIKQRLQAERARLRQIAGLDQPKHFHRP
Ga0207700_1190689913300025928Corn, Switchgrass And Miscanthus RhizosphereMATNFVQIENDSEIKQRLEAERARLRKIAGLDKPNHF
Ga0207661_1001193613300025944Corn RhizosphereMATNFVQIENDTEIKKRLEAERARLRKSAGLSQPDHF
Ga0207675_10094094713300026118Switchgrass RhizosphereMATNFVQIENDTEIKKRLEAERVRLRKIAGLDQPEHFHRPIERAFTAEQRPH
Ga0209240_123991023300026304Grasslands SoilMATRLVQIEQDQELQQRLAAERARLRQQAGLNSPSHFHRPVERAFKAEERNR
Ga0209010_105975813300027370Forest SoilMATNFVQIENDSEIKKRLEAERIRLRKIAGLDQSDHFHRP
Ga0208199_109046423300027497Peatlands SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDQPEHFHR
Ga0209008_104827533300027545Forest SoilMATNLVQIDNDQEIKQRLEAERSRLRKIAGLDQPTHFHRPVE
Ga0209733_105621113300027591Forest SoilMATNLVQIDNDQEIKQRLEAERARLRKIAGLDQPTHFH
Ga0209007_110682413300027652Forest SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTHFHRPV
Ga0209038_1011626713300027737Bog Forest SoilMAANFVKIASDSEIRERLAAERARLRKIAGLDEPEHFHRPIERAFTAEE
Ga0209040_1021616213300027824Bog Forest SoilMATNLVQIENDSEIKQRLAAERARLRKIAGLDQSTHFHRPI
Ga0209580_1013518123300027842Surface SoilMATNFVQIESDVEIKKRLDAERVRLRKIAGLDRPEHFHRPV
Ga0209580_1032947513300027842Surface SoilMATNLVQIKNDSEIKERLAAERARLRKIAGLDHPTHFHRPVER
Ga0209693_1001471613300027855SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTH
Ga0209167_1003200223300027867Surface SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDQPEHFHRPVERAFTAE
Ga0209579_1024799313300027869Surface SoilMTTKLVQIEDDVEIKQRLEAERVRLRKIAGLDRPTHFHRPVER
Ga0209380_1009876313300027889SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTHFHRPVERAFTAEQRNQVTIL
Ga0209624_1015653033300027895Forest SoilMSTNLVNISSEAEIRARLEAERARLRKIAGLDQPDHFHRPVERAFTA
Ga0209624_1050332813300027895Forest SoilMATNLVQIDNDQEIKQRLEAERSRLRKIAGLDQPEHFHRPVERAFTAE
Ga0209067_1001804673300027898WatershedsMATNLVQIENDSEIKQRLEAERARLRKIAGLDPPEHFHRPVERLNRDSTS
Ga0209067_1071402413300027898WatershedsMATNLVQIDKSNDQEIQQRLEAERIRLRKIAGLDQPTHFHRPVERAFT
Ga0209698_1037788013300027911WatershedsMATNLVQIESDQEIKQRLEAERLRLRKIAGLDRPDHFHRPVE
Ga0209698_1106425613300027911WatershedsMATTNFVQIENDAEIKQRLEAERARLRKIAGLDRPEHFH
Ga0209698_1138975113300027911WatershedsMATNLVNIENDSEIKARLEAERARLRKIAGLDQPTHFHRPVER
Ga0265353_101834823300028015SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTHFHRPVE
Ga0307282_1051116213300028784SoilMATNFVQIKNDSDIKQHLEAERARLRKIAGLDQPT
Ga0308309_1124820913300028906SoilMSSNFVQIATEPEIRERLEAERVRLRKIAGLDQANHFHRPVERAFTADERSRVK
Ga0308309_1142861123300028906SoilMATNLIHIENDQEIKQRLAAERARLRKIAGLDRPEHFHRPVERAFTAE
Ga0222748_108570113300029701SoilMATHLVQIDNDEEIKQRLEAERGRLRKIAGLDQPTHFHRPVERAFKAE
Ga0222748_112821813300029701SoilMATNLINIENDQEIKQRLAAERARLRKIAGLDQPEHFHRPVERAFTAKEPSL
Ga0134606_1012766413300029827Marine SedimentMAMNLLQIETESEIKNRLEAERSRLRKIAGLDRPEHFHRPMERAFTAE
Ga0311359_1029301223300029914BogMATHLVQIDSDEEIKQRLEAERSRLRKIAGLDRPTHFHRPIERAFKAEERD
Ga0311371_1065127233300029951PalsaMATNLVQIDSRNDEEIKQRLEAERARLRKIAGLDQP
Ga0302179_1008028013300030058PalsaMATKYVQIENDLDIQQRLEAERMRLRKIAGLDRPT
Ga0311353_1025282613300030399PalsaMATKYVQIENDLDIQQRLEAERMRLRKIAGLDRPSHF
Ga0310037_1030517813300030494Peatlands SoilMATFVQINTDEEIKQRLEDERLRLRKIAGLDQPTHFHRPLERAFTADERSKVTI
Ga0210260_1037340423300030577SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTHFHRPVERAFTAE
Ga0311355_1170391813300030580PalsaMATNLVQIDNDEEIKERLEGERARLRKIAGLDQPTHFHRPVERAF
Ga0210286_128671213300030597SoilMATTLVQIHNDQEIKQRLDAERARLRKIAGLDQPDHFHRPV
Ga0316363_1007938223300030659Peatlands SoilMATFVQINTDEEIKQCLEDERLRLRKIAGLDQPTHFHRPLERAFTA
Ga0265771_101556913300031010SoilMATNLVQIDNDEEIKQRLEAERNRLRKIAGLDQPTHFHR
Ga0073995_1123568213300031047SoilMATLVRIENDSEIKDRLAAERTRLRKIAGLDQPTHFHRPVERAFKGEE
Ga0170823_1641492213300031128Forest SoilMATNFVQIDNDAEIKQRLEAERARLRKIAGLDQPTHFHRPIERA
Ga0307474_1039190923300031718Hardwood Forest SoilMATRLVQIEQDQELQQRLAAERARLRQQAGLTSPSHFHRPVERAFKA
Ga0307474_1054743923300031718Hardwood Forest SoilMATNLIQINTDEEIKERLQAERVRLRKIAGLDQPTHFHRPIERAFTAEE
Ga0318502_1043814213300031747SoilMATNLVQIENDAEIKERLAAERARLRKIAGLDQPTHFHRPVERAFTAEQRKHV
Ga0318494_1084136013300031751SoilMATDLVQIGNDSEIRKRLEQERARLRKIAGLDRANHFHRP
Ga0318543_1014707913300031777SoilMATNLVQIENDAEIKERLAAERARLRKIAGLDQPTHFHRPVERA
Ga0318547_1094257213300031781SoilMATNLIQIANDSEIKARLEAERARLRKIAGLDPPRHFHRPVERAF
Ga0318529_1049807113300031792SoilMATNLVQIENDAEIKERLAAERARLRKIAGLDQPTH
Ga0318550_1034696813300031797SoilMATNLIQIANDSEIKARLEAERARLRKIAGLDPPRHF
Ga0318523_1058061613300031798SoilMATNLVQIENDAEIKERLAAERARLRKIAGLDQPTHFH
Ga0307473_1033977613300031820Hardwood Forest SoilMATNFVQIENDSEIKARLAAERARLRKIAGLDQSPHFH
Ga0307473_1121306913300031820Hardwood Forest SoilMATTNFVQIENDAEIKQRLDAERARLRKIAGLDQPEHFHRPVERAFTAE
Ga0307478_1097409113300031823Hardwood Forest SoilMATNLVQIGNDAEIEIKKRLEAERARLRKIAGLDKPEHFHRP
Ga0306921_1055953323300031912SoilMATNFVQIENDAEIKQRLEAERARLRKIAGLDQPKHFHRPVER
Ga0310913_1078201523300031945SoilMASDLVQIANDSEIKKRLEAERIRLRKIAGLDPPQHFH
Ga0307479_1006449043300031962Hardwood Forest SoilMATNFVQIENDSEIKKRLEAERMRLRKIAGLDQPTHF
Ga0306922_1136320013300032001SoilMATNLVHIENDAEIKQRLEAERARLRKIAGLDQPKHFHRPVERAFTAE
Ga0306922_1187189113300032001SoilMATNLVQIGNDAELEIKKRLEAERARLRKIAGLDKPDHF
Ga0318559_1029515523300032039SoilMASDLVQIANDSEIKKRLEAERIRLRKIAGLDPPQHFHRPVERAFTAEE
Ga0318505_1042132823300032060SoilMATDLVQIGNDSEIRKRLEQERARLRKIAGLDRANHFHRPVERAFT
Ga0311301_1069394213300032160Peatlands SoilMATNLIQIDNDAEIKKRLDRERARLRKIAGLDQSAHF
Ga0307471_10289220613300032180Hardwood Forest SoilMATTNFVQIENDAEIKQRLDAERARLRKIAGLDQPEHFHR
Ga0335079_1109027913300032783SoilMATHLVQIESEQEIKQRLEQERARLRKIAGLDRPSH
Ga0335078_1131867123300032805SoilMATNLVQIENEHEIQQRLAEKRAQLRKIAGLDQPQHFHRPV
Ga0335074_1059817323300032895SoilMAPNLLQIETESEIKQRLEAERARLRKIAGLDRPEHFHRPVERAFKA
Ga0335083_1069134013300032954SoilMATNLVRIENDTEIKERLAAERIRLRKIAGLDTAEHFHRPVE
Ga0335084_1114503023300033004SoilMATNLVHIEKDEEIKQRLDAERARLRKIAGLDQPTHFHRPVERAFT
Ga0335077_1022513443300033158SoilMATNLVRIENDSEIKERLAAERARLRKIAGLDNPKHFHRPVERAFTAEQ
Ga0335077_1043470223300033158SoilMAFVQIENESEIKQRLEAERARLRKIAGLDKPEHFHRPVERAF
Ga0335077_1131161613300033158SoilMATNLVHIENDSEIKERLAAERARLRKIAGLDNPKHFHRPVERAFTAEQ
Ga0335077_1182113213300033158SoilMAVNLVQIERDAEIKERLAAERVRLRRIAGLDQPNHFHRPVELAFTAE
Ga0326728_1070500613300033402Peat SoilMATNLVQIANDSEIKKRLEAERVRLRKIAGLDPPEHFHRPVERAFTAEQRNLVTIL
Ga0371490_111489223300033561Peat SoilMATNLVQIENDSEIKQRLAAERARLRKIAGLDEPTHFHRPIERTFTAEQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.