Metagenome / Metatranscriptome Family F014817

Basic Information
Family ID	F014817
Family Type	Metagenome / Metatranscriptome
Number of Sequences	259
Average Sequence Length	37 residues
Representative Sequence	FGASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVP
Number of Associated Samples	114
Number of Associated Scaffolds	259

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.84 %
% of genes from short scaffolds (< 2000 bps)	98.46 %
Associated GOLD sequencing projects	113
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Unclassified (98.842 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (51.351 % of family members)
Environment Ontology (ENVO)	Unclassified (88.417 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (86.486 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00%
Feature Viewer

Powered by Feature Viewer

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.84 %
All Organisms	root	All Organisms	1.16 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.84 %
Viruses	superkingdom	All Organisms → Viruses	1.16 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	98.84 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.16 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005355\|Ga0070671_100795030	Not Available	823	Open in IMG/M
3300005468\|Ga0070707_101724111	Not Available	594	Open in IMG/M
3300005548\|Ga0070665_100896557	Not Available	899	Open in IMG/M
3300005617\|Ga0068859_100988963	Not Available	924	Open in IMG/M
3300005617\|Ga0068859_101293280	Not Available	804	Open in IMG/M
3300005617\|Ga0068859_101779535	Not Available	680	Open in IMG/M
3300005617\|Ga0068859_101824854	Not Available	671	Open in IMG/M
3300005617\|Ga0068859_102186996	Not Available	610	Open in IMG/M
3300005617\|Ga0068859_102948943	Not Available	520	Open in IMG/M
3300005618\|Ga0068864_101019314	Not Available	821	Open in IMG/M
3300005618\|Ga0068864_101434415	Not Available	692	Open in IMG/M
3300005841\|Ga0068863_100265182	Not Available	1661	Open in IMG/M
3300005841\|Ga0068863_102006723	Not Available	588	Open in IMG/M
3300005841\|Ga0068863_102215461	Not Available	559	Open in IMG/M
3300005842\|Ga0068858_100997531	Not Available	820	Open in IMG/M
3300005843\|Ga0068860_100388639	Not Available	1378	Open in IMG/M
3300005843\|Ga0068860_101154361	Not Available	794	Open in IMG/M
3300005843\|Ga0068860_102083847	Not Available	588	Open in IMG/M
3300009092\|Ga0105250_10100480	Not Available	1180	Open in IMG/M
3300009976\|Ga0105128_108255	Not Available	680	Open in IMG/M
3300009980\|Ga0105135_129966	Not Available	510	Open in IMG/M
3300009981\|Ga0105133_112519	Not Available	668	Open in IMG/M
3300009981\|Ga0105133_114215	Not Available	645	Open in IMG/M
3300009981\|Ga0105133_131372	Not Available	507	Open in IMG/M
3300009985\|Ga0105036_123974	Not Available	551	Open in IMG/M
3300009989\|Ga0105131_116211	Not Available	697	Open in IMG/M
3300009994\|Ga0105126_1004550	Not Available	1141	Open in IMG/M
3300009994\|Ga0105126_1015143	Not Available	786	Open in IMG/M
3300009994\|Ga0105126_1028437	Not Available	647	Open in IMG/M
3300009994\|Ga0105126_1056032	Not Available	505	Open in IMG/M
3300009995\|Ga0105139_1014785	Not Available	1083	Open in IMG/M
3300009995\|Ga0105139_1072095	Not Available	642	Open in IMG/M
3300009995\|Ga0105139_1075260	Not Available	631	Open in IMG/M
3300010276\|Ga0134104_1089960	Not Available	533	Open in IMG/M
3300010287\|Ga0134094_1080683	Not Available	651	Open in IMG/M
3300010371\|Ga0134125_12495233	Not Available	562	Open in IMG/M
3300010396\|Ga0134126_10806997	Not Available	1060	Open in IMG/M
3300010399\|Ga0134127_12054126	Not Available	650	Open in IMG/M
3300010399\|Ga0134127_12561441	Not Available	590	Open in IMG/M
3300014325\|Ga0163163_11759978	Not Available	680	Open in IMG/M
3300014325\|Ga0163163_11768636	Not Available	678	Open in IMG/M
3300014968\|Ga0157379_10936496	Not Available	823	Open in IMG/M
3300014968\|Ga0157379_10968371	Not Available	810	Open in IMG/M
3300014968\|Ga0157379_11769867	Not Available	606	Open in IMG/M
3300015270\|Ga0182183_1008244	Not Available	1016	Open in IMG/M
3300015270\|Ga0182183_1015324	Not Available	867	Open in IMG/M
3300015270\|Ga0182183_1017778	Not Available	833	Open in IMG/M
3300015273\|Ga0182102_1020304	Not Available	630	Open in IMG/M
3300015280\|Ga0182100_1019282	Not Available	856	Open in IMG/M
3300015280\|Ga0182100_1027145	Not Available	773	Open in IMG/M
3300015280\|Ga0182100_1079075	Not Available	547	Open in IMG/M
3300015284\|Ga0182101_1026904	Not Available	773	Open in IMG/M
3300015293\|Ga0182103_1004362	Not Available	1264	Open in IMG/M
3300015293\|Ga0182103_1007102	Not Available	1109	Open in IMG/M
3300015297\|Ga0182104_1084967	Not Available	572	Open in IMG/M
3300015297\|Ga0182104_1112072	Not Available	517	Open in IMG/M
3300015301\|Ga0182184_1052875	Not Available	628	Open in IMG/M
3300015301\|Ga0182184_1091789	Not Available	520	Open in IMG/M
3300015306\|Ga0182180_1062986	Not Available	583	Open in IMG/M
3300015309\|Ga0182098_1098847	Not Available	553	Open in IMG/M
3300015310\|Ga0182162_1114418	Not Available	528	Open in IMG/M
3300015311\|Ga0182182_1082625	Not Available	581	Open in IMG/M
3300015312\|Ga0182168_1058349	Not Available	695	Open in IMG/M
3300015313\|Ga0182164_1061182	Not Available	683	Open in IMG/M
3300015313\|Ga0182164_1112788	Not Available	544	Open in IMG/M
3300015315\|Ga0182120_1104405	Not Available	564	Open in IMG/M
3300015318\|Ga0182181_1046733	Not Available	686	Open in IMG/M
3300015318\|Ga0182181_1052863	Not Available	659	Open in IMG/M
3300015318\|Ga0182181_1073321	Not Available	590	Open in IMG/M
3300015319\|Ga0182130_1044468	Not Available	750	Open in IMG/M
3300015319\|Ga0182130_1070621	Not Available	642	Open in IMG/M
3300015320\|Ga0182165_1024076	Not Available	967	Open in IMG/M
3300015320\|Ga0182165_1082590	Not Available	632	Open in IMG/M
3300015324\|Ga0182134_1078411	Not Available	644	Open in IMG/M
3300015324\|Ga0182134_1106420	Not Available	573	Open in IMG/M
3300015325\|Ga0182148_1049238	Not Available	748	Open in IMG/M
3300015325\|Ga0182148_1050694	Not Available	741	Open in IMG/M
3300015325\|Ga0182148_1088361	Not Available	610	Open in IMG/M
3300015325\|Ga0182148_1104769	Not Available	573	Open in IMG/M
3300015325\|Ga0182148_1128625	Not Available	529	Open in IMG/M
3300015326\|Ga0182166_1110152	Not Available	560	Open in IMG/M
3300015327\|Ga0182114_1011792	Not Available	1256	Open in IMG/M
3300015327\|Ga0182114_1025677	Not Available	996	Open in IMG/M
3300015327\|Ga0182114_1064614	Not Available	726	Open in IMG/M
3300015327\|Ga0182114_1096329	Not Available	624	Open in IMG/M
3300015327\|Ga0182114_1115914	Not Available	579	Open in IMG/M
3300015328\|Ga0182153_1026825	Not Available	933	Open in IMG/M
3300015328\|Ga0182153_1091331	Not Available	616	Open in IMG/M
3300015329\|Ga0182135_1071655	Not Available	679	Open in IMG/M
3300015329\|Ga0182135_1094165	Not Available	613	Open in IMG/M
3300015329\|Ga0182135_1133439	Not Available	535	Open in IMG/M
3300015329\|Ga0182135_1151409	Not Available	507	Open in IMG/M
3300015330\|Ga0182152_1085306	Not Available	637	Open in IMG/M
3300015330\|Ga0182152_1093585	Not Available	615	Open in IMG/M
3300015331\|Ga0182131_1116717	Not Available	566	Open in IMG/M
3300015332\|Ga0182117_1076796	Not Available	702	Open in IMG/M
3300015332\|Ga0182117_1080428	Not Available	689	Open in IMG/M
3300015332\|Ga0182117_1108591	Not Available	610	Open in IMG/M
3300015333\|Ga0182147_1059096	Not Available	763	Open in IMG/M
3300015333\|Ga0182147_1070755	Not Available	715	Open in IMG/M
3300015333\|Ga0182147_1108959	Not Available	605	Open in IMG/M
3300015334\|Ga0182132_1052039	Not Available	802	Open in IMG/M
3300015334\|Ga0182132_1100645	Not Available	626	Open in IMG/M
3300015334\|Ga0182132_1133736	Not Available	556	Open in IMG/M
3300015334\|Ga0182132_1141038	Not Available	544	Open in IMG/M
3300015334\|Ga0182132_1170486	Not Available	501	Open in IMG/M
3300015335\|Ga0182116_1092238	Not Available	669	Open in IMG/M
3300015335\|Ga0182116_1133677	Not Available	573	Open in IMG/M
3300015335\|Ga0182116_1161344	Not Available	528	Open in IMG/M
3300015337\|Ga0182151_1021294	Not Available	1049	Open in IMG/M
3300015337\|Ga0182151_1071398	Not Available	701	Open in IMG/M
3300015337\|Ga0182151_1082518	Not Available	665	Open in IMG/M
3300015338\|Ga0182137_1024901	Not Available	1068	Open in IMG/M
3300015338\|Ga0182137_1094687	Not Available	661	Open in IMG/M
3300015338\|Ga0182137_1129298	Not Available	580	Open in IMG/M
3300015339\|Ga0182149_1128936	Not Available	571	Open in IMG/M
3300015339\|Ga0182149_1151277	Not Available	533	Open in IMG/M
3300015340\|Ga0182133_1016040	Not Available	1251	Open in IMG/M
3300015340\|Ga0182133_1115884	Not Available	626	Open in IMG/M
3300015340\|Ga0182133_1182626	Not Available	514	Open in IMG/M
3300015348\|Ga0182115_1097383	Not Available	921	Open in IMG/M
3300015348\|Ga0182115_1195253	Not Available	649	Open in IMG/M
3300015348\|Ga0182115_1303850	Not Available	503	Open in IMG/M
3300015349\|Ga0182185_1059274	Not Available	1028	Open in IMG/M
3300015349\|Ga0182185_1075208	Not Available	936	Open in IMG/M
3300015349\|Ga0182185_1189662	Not Available	620	Open in IMG/M
3300015349\|Ga0182185_1234415	Not Available	558	Open in IMG/M
3300015350\|Ga0182163_1106049	Not Available	856	Open in IMG/M
3300015350\|Ga0182163_1122329	Not Available	800	Open in IMG/M
3300015350\|Ga0182163_1123770	Not Available	796	Open in IMG/M
3300015350\|Ga0182163_1177305	Not Available	666	Open in IMG/M
3300015350\|Ga0182163_1211508	Not Available	608	Open in IMG/M
3300015350\|Ga0182163_1235310	Not Available	574	Open in IMG/M
3300015350\|Ga0182163_1239077	Not Available	569	Open in IMG/M
3300015350\|Ga0182163_1240742	Not Available	567	Open in IMG/M
3300015350\|Ga0182163_1270178	Not Available	533	Open in IMG/M
3300015352\|Ga0182169_1222696	Not Available	615	Open in IMG/M
3300015353\|Ga0182179_1161528	Not Available	702	Open in IMG/M
3300015353\|Ga0182179_1166152	Not Available	693	Open in IMG/M
3300015353\|Ga0182179_1168687	Not Available	688	Open in IMG/M
3300015353\|Ga0182179_1258113	Not Available	563	Open in IMG/M
3300015353\|Ga0182179_1258165	Not Available	563	Open in IMG/M
3300015353\|Ga0182179_1275072	Not Available	545	Open in IMG/M
3300015353\|Ga0182179_1307517	Not Available	516	Open in IMG/M
3300015354\|Ga0182167_1056536	Not Available	1363	Open in IMG/M
3300015354\|Ga0182167_1281962	Not Available	593	Open in IMG/M
3300015354\|Ga0182167_1284492	Not Available	590	Open in IMG/M
3300015354\|Ga0182167_1306685	Not Available	562	Open in IMG/M
3300015354\|Ga0182167_1332436	Not Available	534	Open in IMG/M
3300015354\|Ga0182167_1340587	Not Available	526	Open in IMG/M
3300017412\|Ga0182199_1013161	Not Available	1306	Open in IMG/M
3300017412\|Ga0182199_1070432	Not Available	757	Open in IMG/M
3300017412\|Ga0182199_1143215	Not Available	580	Open in IMG/M
3300017412\|Ga0182199_1192370	Not Available	516	Open in IMG/M
3300017414\|Ga0182195_1175606	Not Available	554	Open in IMG/M
3300017414\|Ga0182195_1188992	Not Available	537	Open in IMG/M
3300017432\|Ga0182196_1010217	Not Available	1241	Open in IMG/M
3300017432\|Ga0182196_1021799	Not Available	971	Open in IMG/M
3300017432\|Ga0182196_1072845	Not Available	655	Open in IMG/M
3300017432\|Ga0182196_1111960	Not Available	565	Open in IMG/M
3300017432\|Ga0182196_1152793	Not Available	506	Open in IMG/M
3300017435\|Ga0182194_1048490	Not Available	771	Open in IMG/M
3300017435\|Ga0182194_1050564	Not Available	759	Open in IMG/M
3300017439\|Ga0182200_1050415	Not Available	756	Open in IMG/M
3300017439\|Ga0182200_1065830	Not Available	692	Open in IMG/M
3300017440\|Ga0182214_1126370	Not Available	558	Open in IMG/M
3300017447\|Ga0182215_1053924	Not Available	858	Open in IMG/M
3300017691\|Ga0182212_1124625	Not Available	584	Open in IMG/M
3300017693\|Ga0182216_1110856	Not Available	666	Open in IMG/M
3300017693\|Ga0182216_1139550	Not Available	609	Open in IMG/M
3300020023\|Ga0182178_1010691	Not Available	652	Open in IMG/M
3300020033\|Ga0182146_105285	Not Available	545	Open in IMG/M
3300025925\|Ga0207650_10455351	Not Available	1065	Open in IMG/M
3300026088\|Ga0207641_11339803	Not Available	716	Open in IMG/M
3300028049\|Ga0268322_1000521	Not Available	1842	Open in IMG/M
3300028050\|Ga0268328_1001511	Not Available	1650	Open in IMG/M
3300028050\|Ga0268328_1004414	All Organisms → Viruses → Predicted Viral	1222	Open in IMG/M
3300028050\|Ga0268328_1007469	Not Available	1049	Open in IMG/M
3300028050\|Ga0268328_1017970	Not Available	808	Open in IMG/M
3300028050\|Ga0268328_1032822	Not Available	666	Open in IMG/M
3300028050\|Ga0268328_1051539	Not Available	569	Open in IMG/M
3300028053\|Ga0268346_1004027	Not Available	1021	Open in IMG/M
3300028053\|Ga0268346_1004992	Not Available	962	Open in IMG/M
3300028054\|Ga0268306_1035556	Not Available	500	Open in IMG/M
3300028055\|Ga0268338_1043448	Not Available	507	Open in IMG/M
3300028056\|Ga0268330_1005973	Not Available	1083	Open in IMG/M
3300028056\|Ga0268330_1007642	Not Available	1009	Open in IMG/M
3300028056\|Ga0268330_1031731	Not Available	642	Open in IMG/M
3300028056\|Ga0268330_1032079	Not Available	640	Open in IMG/M
3300028061\|Ga0268314_1004335	Not Available	1166	Open in IMG/M
3300028061\|Ga0268314_1024585	Not Available	667	Open in IMG/M
3300028062\|Ga0268342_1024207	Not Available	620	Open in IMG/M
3300028062\|Ga0268342_1029797	Not Available	579	Open in IMG/M
3300028062\|Ga0268342_1034256	Not Available	552	Open in IMG/M
3300028063\|Ga0268350_1025607	Not Available	845	Open in IMG/M
3300028063\|Ga0268350_1028545	Not Available	803	Open in IMG/M
3300028064\|Ga0268340_1000420	Not Available	2357	Open in IMG/M
3300028064\|Ga0268340_1013917	Not Available	928	Open in IMG/M
3300028064\|Ga0268340_1030013	Not Available	733	Open in IMG/M
3300028140\|Ga0268334_1004222	Not Available	823	Open in IMG/M
3300028141\|Ga0268326_1000291	Not Available	1617	Open in IMG/M
3300028141\|Ga0268326_1003242	Not Available	768	Open in IMG/M
3300028142\|Ga0268347_1022434	Not Available	578	Open in IMG/M
3300028142\|Ga0268347_1026194	Not Available	551	Open in IMG/M
3300028147\|Ga0268303_103018	Not Available	689	Open in IMG/M
3300028147\|Ga0268303_107162	Not Available	501	Open in IMG/M
3300028148\|Ga0268354_1008188	Not Available	841	Open in IMG/M
3300028149\|Ga0268353_111411	Not Available	644	Open in IMG/M
3300028150\|Ga0268343_1001312	Not Available	1271	Open in IMG/M
3300028150\|Ga0268343_1015274	Not Available	552	Open in IMG/M
3300028150\|Ga0268343_1015883	Not Available	544	Open in IMG/M
3300028151\|Ga0268308_1002212	Not Available	1188	Open in IMG/M
3300028151\|Ga0268308_1002377	Not Available	1162	Open in IMG/M
3300028151\|Ga0268308_1005872	Not Available	876	Open in IMG/M
3300028151\|Ga0268308_1020027	Not Available	597	Open in IMG/M
3300028151\|Ga0268308_1022354	Not Available	576	Open in IMG/M
3300028151\|Ga0268308_1026921	Not Available	543	Open in IMG/M
3300028152\|Ga0268336_1022682	Not Available	556	Open in IMG/M
3300028153\|Ga0268320_1002293	All Organisms → Viruses → Predicted Viral	1035	Open in IMG/M
3300028153\|Ga0268320_1006928	Not Available	770	Open in IMG/M
3300028153\|Ga0268320_1020571	Not Available	567	Open in IMG/M
3300028154\|Ga0268341_1014560	Not Available	641	Open in IMG/M
3300028154\|Ga0268341_1023676	Not Available	553	Open in IMG/M
3300028246\|Ga0268351_1016991	Not Available	723	Open in IMG/M
3300028248\|Ga0268312_1000805	Not Available	1517	Open in IMG/M
3300028248\|Ga0268312_1014562	Not Available	683	Open in IMG/M
3300028253\|Ga0268316_1004260	Not Available	841	Open in IMG/M
3300028253\|Ga0268316_1011145	Not Available	643	Open in IMG/M
3300028253\|Ga0268316_1021377	Not Available	528	Open in IMG/M
3300028262\|Ga0268310_1003873	All Organisms → Viruses → Predicted Viral	1132	Open in IMG/M
3300028262\|Ga0268310_1035615	Not Available	574	Open in IMG/M
3300028262\|Ga0268310_1048790	Not Available	515	Open in IMG/M
3300028466\|Ga0268321_105999	Not Available	609	Open in IMG/M
3300028466\|Ga0268321_108259	Not Available	555	Open in IMG/M
3300028467\|Ga0268333_1001760	Not Available	915	Open in IMG/M
3300028467\|Ga0268333_1002386	Not Available	839	Open in IMG/M
3300028467\|Ga0268333_1005874	Not Available	652	Open in IMG/M
3300028468\|Ga0268317_1003514	Not Available	736	Open in IMG/M
3300028470\|Ga0268307_1017065	Not Available	566	Open in IMG/M
3300028471\|Ga0268323_1014477	Not Available	572	Open in IMG/M
3300028471\|Ga0268323_1019963	Not Available	519	Open in IMG/M
3300028471\|Ga0268323_1020097	Not Available	518	Open in IMG/M
3300028472\|Ga0268315_1000508	Not Available	1603	Open in IMG/M
3300028472\|Ga0268315_1028276	Not Available	501	Open in IMG/M
3300028473\|Ga0268319_1005607	Not Available	779	Open in IMG/M
3300028474\|Ga0268331_1026383	Not Available	515	Open in IMG/M
3300028475\|Ga0268327_1002790	Not Available	956	Open in IMG/M
3300028475\|Ga0268327_1008122	Not Available	719	Open in IMG/M
3300028475\|Ga0268327_1016512	Not Available	588	Open in IMG/M
3300028475\|Ga0268327_1025611	Not Available	514	Open in IMG/M
3300028526\|Ga0268339_1012339	Not Available	588	Open in IMG/M
3300028529\|Ga0268311_1017679	Not Available	594	Open in IMG/M
3300028529\|Ga0268311_1021391	Not Available	560	Open in IMG/M
3300032689\|Ga0214497_1049485	Not Available	930	Open in IMG/M
3300032699\|Ga0214494_1067686	Not Available	683	Open in IMG/M
3300033530\|Ga0314760_1115638	Not Available	660	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.30%
Environmental	Environmental	1.93%
Engineered	Engineered	0.77%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	97.30%
Terrestrial	Environmental → Terrestrial	1.93%
Bioreactor	Engineered → Bioreactor	0.77%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	82.24%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.18%
Unclassified	Host-Associated → Plants → Unclassified	5.02%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.70%
Soil	Environmental → Terrestrial → Soil	1.93%
Roots	Host-Associated → Plants → Roots	0.77%
Unclassified	Engineered → Bioreactor → Unclassified	0.77%
Phylloplane	Host-Associated → Plants → Phylloplane	0.39%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	82.24%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.18%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	5.02%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.54%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.16%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.77%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.77%
Loam	Environmental → Terrestrial → Soil → Loam	0.39%
Endophytes	Host-Associated → Plants → Phylloplane → Endophytes	0.39%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	82.24%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.18%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	5.02%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.16%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.77%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.77%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.39%
Unclassified	Host-Associated → Plants → Phylloplane → Endophytes → Unclassified	0.39%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	51.35%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	30.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	6.18%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	5.02%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.54%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.16%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.16%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.77%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.77%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.39%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.39%
Switchgrass Leaf	Host-Associated → Plants → Phylloplane → Endophytes → Unclassified → Switchgrass Leaf	0.39%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009985	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_101 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010276	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 15_59_3.3_214_A2 metaG	Engineered	Open in IMG/M
3300010287	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 5_19_20_110_A1 metaG	Engineered	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300020033	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12JUL2016_LD2 MG	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028063	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028147	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028148	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028149	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028150	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028246	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028466	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028467	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028468	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028471	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028526	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070671_1007950302	3300005355	Switchgrass Rhizosphere	WTLKSCFGVSRSIWVHLAMFRYYTKLGAKRVELVQLMQKFVP*
Ga0070707_1017241111	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	LNSYFGASHSVWVHLAMFHYYTKLVAKPVELVQLMHKFVP*
Ga0070665_1008965572	3300005548	Switchgrass Rhizosphere	THVLVRFRSVWVHLSMFRYYMKLGAKQVELVQLMHKFVP*
Ga0068859_1009889631	3300005617	Switchgrass Rhizosphere	NSCFGVSRSVWVHLAIFHYNTKLGVKQIEVVQLMHKFVP*
Ga0068859_1012932801	3300005617	Switchgrass Rhizosphere	VFGVSRSVWMHLAIFRYNTKLGAKRVELVQLMHKFV
Ga0068859_1017795351	3300005617	Switchgrass Rhizosphere	NSCFGASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVS*
Ga0068859_1018248541	3300005617	Switchgrass Rhizosphere	TLNSCFGASRSIWVHLAMFRYYTKLGAKRVELVQLMQNFVA*
Ga0068859_1021869961	3300005617	Switchgrass Rhizosphere	CASRCVWVHLAIFRYYMKLGAKRVELVQLMHKFAS*
Ga0068859_1029489431	3300005617	Switchgrass Rhizosphere	SCFGASRSIWVHLAMFRYYTKLGAKRVELVQLMQKFMP*
Ga0068864_1010193142	3300005618	Switchgrass Rhizosphere	WTLKSCFGASRSIWVHLAMFRYYTKLGAKRVELVQ*
Ga0068864_1014344152	3300005618	Switchgrass Rhizosphere	FGASRNVWVHLAMFHYYTKLVTKRVELVQLMHNFVP*
Ga0068863_1002651824	3300005841	Switchgrass Rhizosphere	FGASRSVWVHLAMFHYYTKLGTKWVELVQLMHKFVP*
Ga0068863_1020067231	3300005841	Switchgrass Rhizosphere	VLVRFLSVWVHLSMYRYYIKLGAKRVELVQLMHKFVP*
Ga0068863_1022154611	3300005841	Switchgrass Rhizosphere	CLCASRSIWVHLAMFHYYTKLVAKWVEQVQLMHKFVL*
Ga0068858_1009975311	3300005842	Switchgrass Rhizosphere	FGASRSVWVHLAMFRYYTKLGAKRVEQVQLMQKFVL*
Ga0068860_1003886392	3300005843	Switchgrass Rhizosphere	WTINSCFGASRSVWVHLAMFHYYTKLGAKRVELVQLMQMFVP*
Ga0068860_1011543611	3300005843	Switchgrass Rhizosphere	GASRSVWVHLAKFHYYTKLGAKRVELVQLMHKFVP*
Ga0068860_1020838471	3300005843	Switchgrass Rhizosphere	GAFRSVWVHLSMFCYYMKLGAKRVELVQLMHKFVP*
Ga0105250_101004801	3300009092	Switchgrass Rhizosphere	NSCFGASRSVGMHLAMFCYYTKLGAKRVELVQLMQKFVP*
Ga0105128_1082552	3300009976	Switchgrass Associated	GALRSVWMHLGSFRNCMKLDAKQVELVQLMQKFVP*
Ga0105135_1299661	3300009980	Switchgrass Associated	RFHSVWVHLSMFRYDMNLGAKRVELVQLMHKFVP*
Ga0105133_1125191	3300009981	Switchgrass Associated	GPSRRIWVYLAMFRYYTKLGAKRVELVQLMQKFVP*
Ga0105133_1142152	3300009981	Switchgrass Associated	FGASRSVWVHLAKFHYYTKLGAERVELVQLMHKFVP*
Ga0105133_1313721	3300009981	Switchgrass Associated	VLVRFRSVWVHLSMFRYYMKLGAKWVELVQLMHKIVS*
Ga0105036_1239742	3300009985	Switchgrass Leaf	LVRFRSVWVHLSMFRYYMKLVAKWVELVQLMHKYVP*
Ga0105131_1162111	3300009989	Switchgrass Associated	SCIAAFRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVP*
Ga0105126_10045502	3300009994	Switchgrass Associated	LCASHSVWVHLAILRYYTKLGAKRVELVQLKQKFVP*
Ga0105126_10151431	3300009994	Switchgrass Associated	LCASPSIWVYLSIFRYYTKLGAKRVELVQLMHKFVP*
Ga0105126_10284371	3300009994	Switchgrass Associated	CFGASHSIWVHLAMFRYYTKLGAKRVELVQLMQKFGP*
Ga0105126_10560321	3300009994	Switchgrass Associated	GASRSVWVHLAMFHYYTKLGAKWVELVQLMHKFVP*
Ga0105139_10147851	3300009995	Switchgrass Associated	ASRSVWVHLAMFHYYTKLGAERFELVQLMHKFVP*
Ga0105139_10720951	3300009995	Switchgrass Associated	GASRSIWVHLAMFRYYTKLGAKRVELVQLMQKIVP*
Ga0105139_10752602	3300009995	Switchgrass Associated	GVSRSIWVHLAMFHHYTKLGAKRVELVQLMQKFVP*
Ga0134104_10899601	3300010276	Switchgrass Degrading	CIAAFHSVWVYLAIFCYYTKLSAKQVELVQLMHKFVS*
Ga0134094_10806831	3300010287	Switchgrass Degrading	LDSCFGASRSIWVHLAMFHYNTKLGAKCVELVQLMHKFVP*
Ga0134125_124952331	3300010371	Terrestrial Soil	FRASRCIWVHLAMFHYYTKLGAKLVELVQLMQKFVP*
Ga0134126_108069971	3300010396	Terrestrial Soil	PPNLTLNSCFGVFRSVWVHLAKFRYYMKLGAKRVEPVQLMLKFVP*
Ga0134127_120541262	3300010399	Terrestrial Soil	SCSRAFRTVSVHLAMFHYYTELDAKWVELVQLRHKFVP*
Ga0134127_125614411	3300010399	Terrestrial Soil	ASRSVWVYLAIFRYYTKLGAKRVELVQLMHKFVP*
Ga0163163_117599781	3300014325	Switchgrass Rhizosphere	FGASRSVWVYLAIFCYYTKLGAKGVELVQLMQKFVP*
Ga0163163_117686361	3300014325	Switchgrass Rhizosphere	VFRSVWVHLAKFCYYMKLGAKRVEPVQLMLKFVP*
Ga0157379_109364961	3300014968	Switchgrass Rhizosphere	GASRSVWVHLAMFRYYMKLGAKWDELVQLMHKFVP*
Ga0157379_109683712	3300014968	Switchgrass Rhizosphere	CFGASRSVWVHLAMFHYYTKLGAKWVELVQLMHKFVS*
Ga0157379_117698671	3300014968	Switchgrass Rhizosphere	VLVRFRSVWVHLSMFRYYMKLGAKRVELAQLMHKFVP*
Ga0182183_10082441	3300015270	Switchgrass Phyllosphere	CFGASHSIWVHLAMFLYNPKLGAKRVELVQLMQNFVP*
Ga0182183_10153241	3300015270	Switchgrass Phyllosphere	DPNSCSGAFRSVSVHLAMFHYYTELGAKWVELVQLMHKFVP*
Ga0182183_10177781	3300015270	Switchgrass Phyllosphere	ASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVP*
Ga0182102_10203041	3300015273	Switchgrass Phyllosphere	FGASRSVWVHLAMFHYYTKLSAKRVELVQLMHKFEP*
Ga0182100_10192821	3300015280	Switchgrass Phyllosphere	LTINSCFGASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVP*
Ga0182100_10271451	3300015280	Switchgrass Phyllosphere	TINSCFGASRSVWVHLAMFRYYTKLGARRVEHVQLMDKFVP*
Ga0182100_10790751	3300015280	Switchgrass Phyllosphere	ASRSIWVHLAMFRYYTKLGAKRVELVQLMQKFVP*
Ga0182101_10269041	3300015284	Switchgrass Phyllosphere	CFGASRSVWVHLAIFHYYTKLGAKRVELVQLMHKFVS*
Ga0182103_10043622	3300015293	Switchgrass Phyllosphere	LNSCFGASRSIWVHLAMFHYYTKLGAKRVELVKLMQKFVP*
Ga0182103_10071023	3300015293	Switchgrass Phyllosphere	LVRFRSVWVHLSMFRYYMKLGAKWVELAQLMHKFVP*
Ga0182104_10849671	3300015297	Switchgrass Phyllosphere	FGASRSVWVHLAMFHYYTKLGAERFELVQLMHKFVP*
Ga0182104_11120722	3300015297	Switchgrass Phyllosphere	ASRSVWVHLAKFRYYTKLGAKRVEQVQLMQKFVL*
Ga0182184_10528751	3300015301	Switchgrass Phyllosphere	FGASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVP*
Ga0182184_10917891	3300015301	Switchgrass Phyllosphere	SCFGASRSVWVHLAMFHYYTKLVSKLVELVQLMHKFVP*
Ga0182180_10629861	3300015306	Switchgrass Phyllosphere	GASPSFWVHLAMFHYYTKLGAQRVELVQLMHKFVP*
Ga0182098_10988472	3300015309	Switchgrass Phyllosphere	CFVAARNIWVHSAMFRYYTKLGAKRVELVQLMHKFVP*
Ga0182162_11144181	3300015310	Switchgrass Phyllosphere	VLVRFHSVWVHLSMFCYYMKLGAKRVELVQLMHKFEL*
Ga0182182_10826251	3300015311	Switchgrass Phyllosphere	SYFGASRSVWVHLAMFHYYTKLVAKRVELVQLMHKFVP*
Ga0182168_10583491	3300015312	Switchgrass Phyllosphere	WTLNSCFGASRSIWVHLAMFCYYTKLGAKRVELVQLMQKFVP*
Ga0182164_10611821	3300015313	Switchgrass Phyllosphere	CASRSVWVYLAIFRYYTKLGAKRVELVQLMHKFVS*
Ga0182164_11127881	3300015313	Switchgrass Phyllosphere	SCFGASHSVWVHLAMFHYYMKLGAKRVEVVQLMHKFVP*
Ga0182120_11044051	3300015315	Switchgrass Phyllosphere	CLCASRSVRVYLAIFHYYTKLGAKRVEPVQLMHKFVP*
Ga0182181_10467331	3300015318	Switchgrass Phyllosphere	PPHWTINSCFGASRSVWVHLAMFRYYMKLGAKWDELVQLMHKFVP*
Ga0182181_10528631	3300015318	Switchgrass Phyllosphere	SCFGVSRSIWVHLAMFRYYTKLGAKRVELVQLIQKFVP*
Ga0182181_10733211	3300015318	Switchgrass Phyllosphere	VFCSISVHLAMFRYYTEFGANWVELVQLMHKFVS*
Ga0182130_10444681	3300015319	Switchgrass Phyllosphere	CFGASHSVWVHLAMFHYYTKLGTKQVELVQLMHKFVP*
Ga0182130_10706211	3300015319	Switchgrass Phyllosphere	ASCSVWEHLAMFCYYTKLGAKWVELVQVMHKFVP*
Ga0182165_10240761	3300015320	Switchgrass Phyllosphere	KSCFGASRCIWVHLAMFRYYTKLGAKRVELVQLML*
Ga0182165_10825901	3300015320	Switchgrass Phyllosphere	FGASRSGWVHLAMFHYYSKLVAKRVELVQLMHKFVP*
Ga0182134_10784111	3300015324	Switchgrass Phyllosphere	FGASRSVWVHLAMFHYDTKLGTKQVELVQLMHMFVP*
Ga0182134_11064201	3300015324	Switchgrass Phyllosphere	CFGASRSVWLHLAMFHYYTKLVAKQVELVQLMHKFVL*
Ga0182148_10492381	3300015325	Switchgrass Phyllosphere	FGASRSVWVHLAIFHYYTKLVAKRVELVQLMYKFVP*
Ga0182148_10506942	3300015325	Switchgrass Phyllosphere	LVRFLSVWVHLSMFRYYMKLGTKRVELVQLMHKFLP*
Ga0182148_10883611	3300015325	Switchgrass Phyllosphere	LNSCFSASRSDWVHLAMFHYYTKLGAKWVELVQLMQKFVP*
Ga0182148_11047691	3300015325	Switchgrass Phyllosphere	CFRSVWVHLSMFHYYMKLCAKRVELVQLIYKFVP*
Ga0182148_11286251	3300015325	Switchgrass Phyllosphere	SCFRASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVL*
Ga0182166_11101521	3300015326	Switchgrass Phyllosphere	SCIAAFRSVWVHLAMFHYYTKLGAKRVELVQLVQKFVL*
Ga0182114_10117921	3300015327	Switchgrass Phyllosphere	GTSCSIWVHLAMFCYYTKLGAKRGELVQLMQKFVP*
Ga0182114_10256771	3300015327	Switchgrass Phyllosphere	FGASHSVWVHFAMFRYYTKLGAKRFEQVQFMHKFVP*
Ga0182114_10646141	3300015327	Switchgrass Phyllosphere	INSCFGASRSVWVHLAMFRYYTKLGARRVEHVQLMDKFVP*
Ga0182114_10963291	3300015327	Switchgrass Phyllosphere	ASHSVCVYLAIFCYYTKLGAKWLEVVQLMHKFLP*
Ga0182114_11159141	3300015327	Switchgrass Phyllosphere	FGVSCSICVHLAMFCYYTKLSAKRVELVQLMKKFVP*
Ga0182153_10268251	3300015328	Switchgrass Phyllosphere	ATQSVWVYLAIFRYYTKLGAKWVALVQLMHKFVP*
Ga0182153_10913311	3300015328	Switchgrass Phyllosphere	LNSCFGASRSVWVHFAIFRYYTKLGAKRVELVQLMHKFVP*
Ga0182135_10219451	3300015329	Switchgrass Phyllosphere	FGASRSVWAHLAMFQYCTKLDAKLAELVQLMKKFVP*
Ga0182135_10716551	3300015329	Switchgrass Phyllosphere	FGASRSVWVHLAMFHYYTKLGAKQVQLVQLMHKFVP*
Ga0182135_10941651	3300015329	Switchgrass Phyllosphere	NTCFGVSRSIWVHLAMFRYYTKLGAKRVEQVQLMQKFVP*
Ga0182135_11334391	3300015329	Switchgrass Phyllosphere	MNSCFGASRSFWVHLAIFHYNTKLGAKRVELVQLMQKF
Ga0182135_11514091	3300015329	Switchgrass Phyllosphere	VSRSVWVHLAMFRYYTKLGAKWVELMQLKEKFVP*
Ga0182152_10853061	3300015330	Switchgrass Phyllosphere	SSLCASRSVWVHLAMFHYYTKLIAKRVELVQLMHKFVP*
Ga0182152_10935851	3300015330	Switchgrass Phyllosphere	LCASRSVCVYLAIFRYYTKLVAKRVELVQLMHKFMP*
Ga0182131_11167171	3300015331	Switchgrass Phyllosphere	GASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVL*
Ga0182117_10767961	3300015332	Switchgrass Phyllosphere	NSCFGASRSVWVHLAIFHYYTKLSAKRVELVQLMLKFVP*
Ga0182117_10804281	3300015332	Switchgrass Phyllosphere	SCFGAFRSVWVHLSIFRYYMKLGAKPVELVQLIHKYVP*
Ga0182117_11085911	3300015332	Switchgrass Phyllosphere	CFGASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVP*
Ga0182147_10590961	3300015333	Switchgrass Phyllosphere	NSCFGVFRSVSVHLAMSNYYTKLGAKWVELVQLMH*
Ga0182147_10707551	3300015333	Switchgrass Phyllosphere	FGASCSVWVHLAMFHYYTKLGAKRVELVQLMHKFVS*
Ga0182147_11089591	3300015333	Switchgrass Phyllosphere	SCFGASRSIWVHLAMFCYYTKLGAKRVELVQLMQKFVP*
Ga0182132_10520391	3300015334	Switchgrass Phyllosphere	ASRSVWVYLVIFRYYTKLGAKQVELLQLMHKFVP*
Ga0182132_11006451	3300015334	Switchgrass Phyllosphere	NSCSGAFRSVSVHLAMFRYYTKLGAKWVELVQLTNKFMP*
Ga0182132_11337361	3300015334	Switchgrass Phyllosphere	NSCFGASRSVWVHLAIFRYYTKLGAKLVELVQLMHNFVP*
Ga0182132_11410381	3300015334	Switchgrass Phyllosphere	FGTSRSVWVHLAMFHYYTKLVTKWVELVQLMHKFVP*
Ga0182132_11704861	3300015334	Switchgrass Phyllosphere	ASRSICVHFANFRYYTRLGAKRVELVQLMQKFVP*
Ga0182116_10922381	3300015335	Switchgrass Phyllosphere	LVRFLSVWVYLSMYRYYIKLGAKRVELVQLMHKFLP*
Ga0182116_11336771	3300015335	Switchgrass Phyllosphere	NSCFGASRSIWVHLAMFHYNTKLSAKRVELVQLLHKFVP*
Ga0182116_11613441	3300015335	Switchgrass Phyllosphere	ASRSVWVYLAIFRYYTKLGAKRVELVQLMHKFVS*
Ga0182151_10212941	3300015337	Switchgrass Phyllosphere	ASRSVWVHLAMFHYYTKLGAKRVELVQLMLKFVP*
Ga0182151_10713982	3300015337	Switchgrass Phyllosphere	CASRSVWVYLAIFRYYTKLGAKRVELVQLMHKFVP*
Ga0182151_10825181	3300015337	Switchgrass Phyllosphere	CMYASRIVLVHLAIFCNYTKLGAKRVELVQLMHKFMP*
Ga0182137_10249012	3300015338	Switchgrass Phyllosphere	VSRSVWVYLAIFRYSTKLSAKRVEPVQLMHKLVP*
Ga0182137_10946871	3300015338	Switchgrass Phyllosphere	FGASRSIWVHLAMFRYYTKLDAKWVELVQLMHKFVP*
Ga0182137_11292981	3300015338	Switchgrass Phyllosphere	CFGASRSVWVHLAMFHYYTKLIAKWFELVQLMHKFVP*
Ga0182149_11289362	3300015339	Switchgrass Phyllosphere	FGASRSVWVHLAMFRYYTKLGARRVEHEQLMHKFVP*
Ga0182149_11512771	3300015339	Switchgrass Phyllosphere	LLRFCSVYVHLSLFRYYMKLGAKRVELGQLMHKFVP*
Ga0182133_10160401	3300015340	Switchgrass Phyllosphere	CASHSVSVYLAIFCDYTKLGAKRVELVQLMHNFVPRSDF*
Ga0182133_11158841	3300015340	Switchgrass Phyllosphere	NSCFGASRSVWVHLAMFHYYTKLGAKRVEQVQLMQKFLL*
Ga0182133_11826261	3300015340	Switchgrass Phyllosphere	SCFGASHSIWVHLAMFCYYTKLGAKLGELVQLMQKFVP*
Ga0182115_10973831	3300015348	Switchgrass Phyllosphere	FAAFRSISVHLAMFRYYTELGEKWVELVQLMHKFVP*
Ga0182115_11952531	3300015348	Switchgrass Phyllosphere	LCASRSVWVYLAIFHYYTKLGARRVELVQLMHKFVP*
Ga0182115_13038501	3300015348	Switchgrass Phyllosphere	GASRSVWVHLAMFHYYTKLGAKWVELVQLMHKFVS*
Ga0182185_10592741	3300015349	Switchgrass Phyllosphere	NSYFGASRSVWVHLAMFHYYTKLVAKRVELVQLMHKFVP*
Ga0182185_10752082	3300015349	Switchgrass Phyllosphere	LCASRSVCVYLAIFRYYTKLGAKWVELVQLMNKLVP*
Ga0182185_11896621	3300015349	Switchgrass Phyllosphere	LCASRCVWVHLAIFRYYMKLGAKRVELVQLMHKFAP*
Ga0182185_12344151	3300015349	Switchgrass Phyllosphere	TPNSCLGVSRSIWVHLAMFRYYTKLGAKQVELVQLMHKFVP*
Ga0182163_11060491	3300015350	Switchgrass Phyllosphere	TLNSCFGVFRSVWVHLAKFRYYMKLGAKRVEPVQLMLKFVP*
Ga0182163_11223291	3300015350	Switchgrass Phyllosphere	SCFCASLSVWVHLAMFHYYTKLGAKRVELVQLKHKFVP*
Ga0182163_11237701	3300015350	Switchgrass Phyllosphere	FGASRSVWVHLAMFHYYTKLVAKRVELVQLMQKFVP*
Ga0182163_11773051	3300015350	Switchgrass Phyllosphere	HGLVRLRSVWVHLSMFRYYMKLGAKWVELAQLMHRFVP*
Ga0182163_12115081	3300015350	Switchgrass Phyllosphere	TLNSCLYASRSVWVYLAIFRYYTKLGANRVELVQLMHKFVP*
Ga0182163_12353101	3300015350	Switchgrass Phyllosphere	THLIHPDWTLNSCFGVSRSIWVHLAMFRYYTKLGAKRVELVQLIQKFVP*
Ga0182163_12390771	3300015350	Switchgrass Phyllosphere	SCFGASRSVWVHLAMFHYYTKLVAKQVELVQLMHKCVP*
Ga0182163_12407421	3300015350	Switchgrass Phyllosphere	CASRSVWVYFAMFRYYTKLGAKRFELVQLMHKFIP*
Ga0182163_12701781	3300015350	Switchgrass Phyllosphere	LCVSRSVWVYLAIFRYYTKLGAKRVKLVQLMHKFVP*
Ga0182169_12226962	3300015352	Switchgrass Phyllosphere	FGASRSVWVHLAMFHYYTKLDAKRVELVQLMHKFVP*
Ga0182179_11615281	3300015353	Switchgrass Phyllosphere	NSCFGASHSVWVHLAMLHYYTKLGAKQVELVQLMHKFVP*
Ga0182179_11661521	3300015353	Switchgrass Phyllosphere	SYFGASRSVCVHLAKFHYYTKLIAKQVELVQLMQKFVP*
Ga0182179_11686871	3300015353	Switchgrass Phyllosphere	LNSCFGASRSVWVHLAIFRYYTKLGAKRVELVQLMHKFVQ*
Ga0182179_12581131	3300015353	Switchgrass Phyllosphere	PPHWTINSCFGASRSFWVHFGLFHYNTKLGEKWVELVQLMHKFVP*
Ga0182179_12581651	3300015353	Switchgrass Phyllosphere	GASRSISVHLAMFRYYTKLGAKQVELVQLMQKFVP*
Ga0182179_12750721	3300015353	Switchgrass Phyllosphere	NSCFGASCSIWVHLAMFCYYTELGAKRVELVQLMQKFMP*
Ga0182179_13075171	3300015353	Switchgrass Phyllosphere	FGASRSIWVHLAMFRYYTKLGAKRVELVQLMQKIVP*
Ga0182167_10565361	3300015354	Switchgrass Phyllosphere	CFGASHSIWVHLAMCRYYTKLGAKRVELVQLMQKFVP*
Ga0182167_12819621	3300015354	Switchgrass Phyllosphere	MSRSVWVHFGLFHYCTKLVAKRVEQVQLVRKFVPRSR
Ga0182167_12844921	3300015354	Switchgrass Phyllosphere	LCASRSVWVHLAMFHYYTKLVAKRVEQVQLMHKFVP*
Ga0182167_13066851	3300015354	Switchgrass Phyllosphere	VSRSVWVYLAIFRYYTKLGAKWVELVQLMHKFVP*
Ga0182167_13324361	3300015354	Switchgrass Phyllosphere	CASRSVWVYLAIFRYYTKLGAKWAELVQLMHKFVL*
Ga0182167_13405871	3300015354	Switchgrass Phyllosphere	FGASHSIWVHLAMFRYYTKLGAKRVELVQLMQKIVP*
Ga0182199_10131611	3300017412	Switchgrass Phyllosphere	GASPSFWVHLAMFHYYTKLGAQRVELVQLMHKFVP
Ga0182199_10704321	3300017412	Switchgrass Phyllosphere	SCFGASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVP
Ga0182199_11432151	3300017412	Switchgrass Phyllosphere	FGASCSICVHLAMFRYYTILGAKRVELVQLIQKFMP
Ga0182199_11775031	3300017412	Switchgrass Phyllosphere	FGASRSVWVHLAMFQYYTKLGAKLVKLVQLMQKFVP
Ga0182199_11923701	3300017412	Switchgrass Phyllosphere	NSCFGVFHSVWVHLEIFRYYTKLGAKLVEPVQLMLKFVP
Ga0182195_11756061	3300017414	Switchgrass Phyllosphere	GASRSVWVHMAMFHYYTKLGAKRVELVQLINKFVP
Ga0182195_11889922	3300017414	Switchgrass Phyllosphere	LNSCFGASRSIWVHLAMFRYYTKLGAKRVELVQLMQKFVL
Ga0182196_10102171	3300017432	Switchgrass Phyllosphere	FGTSCSIWVHLAMFCYYTKLGAKRGELVQLMQKFVP
Ga0182196_10217992	3300017432	Switchgrass Phyllosphere	LVRFHSVWVHLSMFRYFMKLGAKQVKLVQLMHKFVP
Ga0182196_10728451	3300017432	Switchgrass Phyllosphere	CFGASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVP
Ga0182196_11119601	3300017432	Switchgrass Phyllosphere	NSCSGAFRSVSVHLAMFRYYTKLGAKWVELVQLTNKFMP
Ga0182196_11527931	3300017432	Switchgrass Phyllosphere	VLVRFHSVWVHLSMFCYYMKLGAKRVELVQLMHKFEL
Ga0182194_10484901	3300017435	Switchgrass Phyllosphere	GASRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVL
Ga0182194_10505641	3300017435	Switchgrass Phyllosphere	PHWTINSCFGASRSVWVHLAMFRYYTKLGARRVEHVQLMHKFVP
Ga0182200_10504151	3300017439	Switchgrass Phyllosphere	CASRSACVYLAIFRYYTKLGAKWVELVQFMHKIVP
Ga0182200_10658301	3300017439	Switchgrass Phyllosphere	WTLNLCFGVSHSIWVHLAMFHYYTKLGAKQVELVQLMQKFVP
Ga0182214_11263701	3300017440	Switchgrass Phyllosphere	CFGASHSVWVHLTMFSYYMKLGAKQIELVQLMHKFVP
Ga0182215_10539241	3300017447	Switchgrass Phyllosphere	HGTLNSCFGASRSVWVQLAMFCYYTKLGAKWVELVLLMQKLVP
Ga0182212_11246251	3300017691	Switchgrass Phyllosphere	FGASRSVWVHLAIFHYYTKLGAKRVELVQLMLKFVP
Ga0182216_11108561	3300017693	Switchgrass Phyllosphere	SCFGASRSIWVHLAMFCYYTKLGAKRVELVQLMQKFVP
Ga0182216_11395501	3300017693	Switchgrass Phyllosphere	FGASRSVWVHLAMFHYYTKLVTKCVEKVQLMHKFVQ
Ga0182178_10106911	3300020023	Switchgrass Phyllosphere	VRFRSVWVHLSMFRYYMKLGAKRVELVQLMHKFVP
Ga0182146_1052851	3300020033	Switchgrass Phyllosphere	GVFRSVWMYFGLFRYCTNLNTKRVELVQLMHKFVP
Ga0207650_104553511	3300025925	Switchgrass Rhizosphere	FGASRSVWVHLAMFHYYTKLVAKRVELVQLMHKFVP
Ga0207641_113398031	3300026088	Switchgrass Rhizosphere	SCFGVSRSIWVHLAMFRYYTKLGAKRVELVQLMQKFVP
Ga0268322_10005211	3300028049	Phyllosphere	CASPSIWVYLSIFRYYTKLGAKRVELVQLMHKFVP
Ga0268328_10015111	3300028050	Phyllosphere	EMFLPQNSCMYASRSVLVHLAIFRNYTKLGAKRVELVQLMHKFMP
Ga0268328_10044141	3300028050	Phyllosphere	SCFGVSRSIWVHLAMSRYYTKLGAKRVELVQLMQKIVP
Ga0268328_10074691	3300028050	Phyllosphere	TQNSYFGASHSVWVHLAMFHYYTKLGAKRVELVQLMHKLVL
Ga0268328_10179701	3300028050	Phyllosphere	TLNSYFGTSRSVWVYLEIFHYYTKLDAKWVELVQLM
Ga0268328_10328221	3300028050	Phyllosphere	LNSCFGASHSVWVYLAIFRYYTKVGAKWVELVQLMHKFVP
Ga0268328_10515391	3300028050	Phyllosphere	FGVFRSVWVHLAKFHYYIKLVAKQVELVQLMHKFVP
Ga0268346_10040271	3300028053	Phyllosphere	FGASRSVWVHLAMYRCYTKLGANCVELVQLMQKFMP
Ga0268346_10049921	3300028053	Phyllosphere	CFGASRSIWVHLAMFCYYTKLGAKRVELVQLMQKFVP
Ga0268306_10008181	3300028054	Phyllosphere	FGASRSVWVHLEMFHYYTKLGAERFELVKLMHKFVP
Ga0268306_10355561	3300028054	Phyllosphere	CASRSVLVYLAIFRYYTKLGAKRAELVQLMHKFVP
Ga0268338_10434481	3300028055	Phyllosphere	GVSRTVWVHLAIFHYNTKLGVKQIEVVQLMHKFVP
Ga0268330_10059732	3300028056	Phyllosphere	WIVNSCFGASRSIWVHLAMFHYYTKLGAKRVELVQLMQKFMP
Ga0268330_10076422	3300028056	Phyllosphere	LCVSHSVWVHLAILRYYKKLGAKRVELVQLMHKFVP
Ga0268330_10317311	3300028056	Phyllosphere	NSYFGASRSVWVHLAMFHYYTKLVAKWVELVQLMHKFVP
Ga0268330_10320792	3300028056	Phyllosphere	CFGASRSIWVHLAMFRYYTKLAAKRVELVQLMQKIVP
Ga0268314_10043351	3300028061	Phyllosphere	HWTLNSCFGASRSIWVHLAMFRYYTKLGAKRVELVQLMQKIVP
Ga0268314_10245852	3300028061	Phyllosphere	FGAPHSIWVHLAMFRYYTKLGAKRVELVQLMQKFMP
Ga0268342_10242071	3300028062	Phyllosphere	LCAFHSVWVYLAIFRYYTKLGAIRVELVQLMHKFVP
Ga0268342_10297971	3300028062	Phyllosphere	VCFRSFWVHLSMFRYYMKLSAKRVELVQLMHKFVP
Ga0268342_10342561	3300028062	Phyllosphere	FGASRCVWVHLAMFHYYTILGAKRVELVQLMHKFVP
Ga0268350_10256071	3300028063	Phyllosphere	DPPHWILNYCFGASRSIWVHLAMFRYYTKLGAKRVELVQLMLKFVP
Ga0268350_10285451	3300028063	Phyllosphere	GASRSVWVHLAMLHYYTKLGAKRVVLVQLMHKFVP
Ga0268340_10004201	3300028064	Phyllosphere	SFVAFRSIWVYLGPFRYYMKLGAKWAELVQLMQKFMP
Ga0268340_10139171	3300028064	Phyllosphere	SVRFRSVWVHLSTFRYFIKLDAKRVELVQLMHKFVP
Ga0268340_10300132	3300028064	Phyllosphere	IATFRSVWVHLAMFHYYTKLGAKRVELVQLMHKFVL
Ga0268334_10042221	3300028140	Phyllosphere	LNSCFGVFRSVWVHLAKFCYYMKLGAKRVEPVQLMLKFVP
Ga0268326_10002912	3300028141	Phyllosphere	LCASRSDWVYLAIFRYYAKLGAKWVEPVKLMHMFVP
Ga0268326_10032421	3300028141	Phyllosphere	WTLNSCFDASRSIWVHLAMFRYYTKLGAKRVELVQLMQKFVL
Ga0268347_10224341	3300028142	Phyllosphere	CFGVSRRFRVHLKMFCYYTKLGAKRVELVQLMQKFVP
Ga0268347_10261941	3300028142	Phyllosphere	NSCFGASRSIWVHLAMFHYYTKLGAKQVELVQLMQKFVP
Ga0268303_1030181	3300028147	Phyllosphere	GASRSIWVHLAMFRYYTKLGAKRVELVQLMQKFVP
Ga0268303_1071621	3300028147	Phyllosphere	RAFRTISVHLAMFHYYTELGAKWVELVQLRHKFVP
Ga0268354_10081881	3300028148	Phyllosphere	HPTHSIGASPSFWVHLAMFHYYTKLGAQRVELVQLMHKFVP
Ga0268353_1114111	3300028149	Phyllosphere	CFGASLSIWVHLAKFRYYTKLGAKRVELVQLMQKFVP
Ga0268343_10013121	3300028150	Phyllosphere	RTSCFGVFRTIWVYLGQFHYCTKLGAKRVELVQLMQKFVPQSLV
Ga0268343_10152741	3300028150	Phyllosphere	CFGASPSVWVHLAKFHYYTKLVAKQVELVQLMHKFEP
Ga0268343_10158832	3300028150	Phyllosphere	GASPSVWVQLAMFHYYTKLVAKRVELVQLMQKFVP
Ga0268308_10022121	3300028151	Phyllosphere	CFGASHSIWVHLAMFHYYTKLDAKWVELVQLMHKFVP
Ga0268308_10023771	3300028151	Phyllosphere	FGATQSVWVYLAIFRYYTKLGAKWVALVQLMHKFVP
Ga0268308_10058721	3300028151	Phyllosphere	SCFGASRSVWVHLAMFYYYTKLGTKRVELVQLMHKFVP
Ga0268308_10200271	3300028151	Phyllosphere	DLVRFRSGWVHFSMFRYYVKLGAKRVELVQLMYKFVP
Ga0268308_10223541	3300028151	Phyllosphere	GASRSVWVHLAMFHYYMKLGAKQVELVQLIHKFVQ
Ga0268308_10269211	3300028151	Phyllosphere	FGASRGVWVHLAMFRYYTKLDPKRLELVQLMHKFVP
Ga0268336_10226821	3300028152	Phyllosphere	GASRSIWVHLAMFRYYTKLAAKRVELVQLMQKIVP
Ga0268320_10022931	3300028153	Phyllosphere	TLNSCFGASRSIWVHLAMFRYYTKLGAKRVELVQLM
Ga0268320_10069281	3300028153	Phyllosphere	GVSRSVWVHLAKFHYYIKLVAKQVELVQLMHKFVP
Ga0268320_10205711	3300028153	Phyllosphere	CFGVFHSVRVHLAIFRYYAKLGAKYVEPVQLMLKFMP
Ga0268341_10145601	3300028154	Phyllosphere	YASRIVLVHLAIFRNYTKLGAKRVELVQLMHKFMP
Ga0268341_10236761	3300028154	Phyllosphere	WTLNSCFGASRSIWVHLAMFRYYTKLGAKRVELVQLM
Ga0268351_10169911	3300028246	Phyllosphere	GAFCSVWVHLAMFRYYTKLGAKQVEMVQLMLKFVP
Ga0268312_10008051	3300028248	Phyllosphere	FRASCGVWEHLAMFCYYTKLGAKWVELVQLMHKFVP
Ga0268312_10145621	3300028248	Phyllosphere	DPAHWTLNSCFGVSRSIWVYLAMFRYYTKLGAKRVELVQLMHKFVP
Ga0268316_10042601	3300028253	Phyllosphere	HVLVCFHSVSVHLAMFCYYMKLGAKRVEPVQLMHKFVP
Ga0268316_10111451	3300028253	Phyllosphere	GVSRSIWVHLAMFRYYTKLGAKRVELVQLMQKFVP
Ga0268316_10213771	3300028253	Phyllosphere	WTLNSCFGASRSVWVHLAKFRYYTKLGAKRVEQVQLMQKFVP
Ga0268310_10038731	3300028262	Phyllosphere	PHWTLNSCFGASRSVWVHLAMFRYYTKLGAKRVELVQLMQKFVL
Ga0268310_10356151	3300028262	Phyllosphere	CFGAYRSIWVHLAMFRYYTKLGAKQVELVQLMQKFMP
Ga0268310_10487901	3300028262	Phyllosphere	HVLVRFCSVWVRLSMFRYYMKLGAKRVELVQLMHKFVP
Ga0268321_1059991	3300028466	Phyllosphere	FGVFRSVWVHLAMFCYYTKLGAKRAELVQLIQKFVP
Ga0268321_1082592	3300028466	Phyllosphere	CLCVSRSVWVYLAKFRYYTILGAKWVELVQLMHEFVP
Ga0268333_10017602	3300028467	Phyllosphere	IPLDNKLMCLVRFHSVWVHLSMFRYHMKLSAERVELVQLMHKFVP
Ga0268333_10023861	3300028467	Phyllosphere	LCASRSVWVHLAIFRYYTKLGAKWVEQVQLLQKFAP
Ga0268333_10058741	3300028467	Phyllosphere	LVRFRSVWVHLSMFRYYMKLGAKRVELVQLMHKFVP
Ga0268317_10035141	3300028468	Phyllosphere	SCLCASRSVWVHLKMFHYYTKLGAKWVELVQLMHKFVP
Ga0268307_10170651	3300028470	Phyllosphere	GASRSIWVHLAMFCYYTKLGAKRVELVQLMQKFVP
Ga0268323_10144771	3300028471	Phyllosphere	GVFCSISVHLAMFRYYTEFGANWVELVQLMHKFVS
Ga0268323_10199631	3300028471	Phyllosphere	LVRFCSVWVHLSMFRYYMKLGAKWVELGQLVHKFVP
Ga0268323_10200971	3300028471	Phyllosphere	SLFRTIWVHLDLFRYYTKLGAKRVELVQLMKKFVP
Ga0268315_10005081	3300028472	Phyllosphere	CFGASRSIWVHSAMFRYYTKLDAKQVELVQLMHKFVP
Ga0268315_10282761	3300028472	Phyllosphere	NSCFGASRSFWVHLAMFRNYTKLGAKRVELVQLMQKIVP
Ga0268319_10056071	3300028473	Phyllosphere	YFGAFHCVWVHLAMFPYYTKLGAKRVELEQLMHKFVP
Ga0268331_10263831	3300028474	Phyllosphere	WTQKSCFGASRSVWVHLAMFHYYMKLVAKRVELVQLMHKFVP
Ga0268327_10027901	3300028475	Phyllosphere	HWTLNACFGASQSILVHLEMFRYYTKLGEKRVELVQLMQKFVP
Ga0268327_10081222	3300028475	Phyllosphere	NSCFGASHTVWVYLAIFRYYTKLGAKWVELVQLMHKFVQ
Ga0268327_10165121	3300028475	Phyllosphere	SCFGASRSIWVHLAMFRYYTKLSAKRVELVQLMQKFVP
Ga0268327_10256111	3300028475	Phyllosphere	GAFCSVLVHLAMFHYYTELGAKWVELVQLRHKFVP
Ga0268339_10123391	3300028526	Phyllosphere	NSCFGASRSVWVHLAMFHYYTKLGAKRVEQVQLMQKFLL
Ga0268311_10176791	3300028529	Phyllosphere	NSCFGASRSVWVHLAMFRYYTKLGARRVEHVQLMHMFVP
Ga0268311_10213911	3300028529	Phyllosphere	GASHSVWVHLAMFRYYTKLGAKRVELVQLMQKFVL
Ga0214497_10494851	3300032689	Switchgrass Phyllosphere	FREVRSIWVPLSMFRYYTKPSAKRVEQVHLMHNLVP
Ga0214494_10676861	3300032699	Switchgrass Phyllosphere	LNSCFGVSCSIWVHLAMFHYYKKLGAKRVELVQLMQKFVP
Ga0314760_11156381	3300033530	Switchgrass Phyllosphere	FVSSPTIRMHLAMLRYYTKLGAKRVELVQLMQKFVP

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F014817

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign