NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F015244

Metagenome / Metatranscriptome Family F015244

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015244
Family Type Metagenome / Metatranscriptome
Number of Sequences 256
Average Sequence Length 38 residues
Representative Sequence MDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT
Number of Associated Samples 173
Number of Associated Scaffolds 256

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.69 %
% of genes near scaffold ends (potentially truncated) 23.05 %
% of genes from short scaffolds (< 2000 bps) 80.86 %
Associated GOLD sequencing projects 161
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (67.578 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(24.609 % of family members)
Environment Ontology (ENVO) Unclassified
(35.938 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.281 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.31%    β-sheet: 0.00%    Coil/Unstructured: 47.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 256 Family Scaffolds
PF04551GcpE 10.16
PF01904DUF72 7.03
PF11154DUF2934 2.34
PF11528DUF3224 1.95
PF00072Response_reg 1.56
PF00188CAP 1.56
PF02371Transposase_20 1.17
PF12704MacB_PCD 1.17
PF04542Sigma70_r2 0.78
PF02163Peptidase_M50 0.78
PF07238PilZ 0.78
PF04191PEMT 0.78
PF00248Aldo_ket_red 0.78
PF01148CTP_transf_1 0.78
PF12681Glyoxalase_2 0.78
PF07883Cupin_2 0.78
PF01663Phosphodiest 0.78
PF00873ACR_tran 0.39
PF027373HCDH_N 0.39
PF04055Radical_SAM 0.39
PF00856SET 0.39
PF05598DUF772 0.39
PF04024PspC 0.39
PF00156Pribosyltran 0.39
PF02646RmuC 0.39
PF00135COesterase 0.39
PF03544TonB_C 0.39
PF07045DUF1330 0.39
PF02661Fic 0.39
PF00133tRNA-synt_1 0.39
PF01850PIN 0.39
PF00144Beta-lactamase 0.39
PF00239Resolvase 0.39
PF07589PEP-CTERM 0.39
PF07676PD40 0.39
PF13751DDE_Tnp_1_6 0.39
PF03704BTAD 0.39
PF13520AA_permease_2 0.39
PF01255Prenyltransf 0.39
PF02355SecD_SecF 0.39
PF02738MoCoBD_1 0.39
PF04014MazE_antitoxin 0.39
PF00308Bac_DnaA 0.39
PF01527HTH_Tnp_1 0.39
PF13365Trypsin_2 0.39
PF08808RES 0.39

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 256 Family Scaffolds
COG08214-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpELipid transport and metabolism [I] 10.16
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 7.03
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 1.56
COG3547TransposaseMobilome: prophages, transposons [X] 1.17
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.78
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.78
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.78
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.78
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 0.39
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.39
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.39
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.39
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.39
COG0341Preprotein translocase subunit SecFIntracellular trafficking, secretion, and vesicular transport [U] 0.39
COG0342Preprotein translocase subunit SecDIntracellular trafficking, secretion, and vesicular transport [U] 0.39
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.39
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.39
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.39
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.39
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.39
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.39
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.39
COG1322DNA anti-recombination protein (rearrangement mutator) RmuCReplication, recombination and repair [L] 0.39
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 0.39
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.39
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.39
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.39
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.39
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.39
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.39
COG2367Beta-lactamase class ADefense mechanisms [V] 0.39
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.39
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.39
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.39
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.39
COG5654Predicted toxin component of a toxin-antitoxin system, contains RES domainDefense mechanisms [V] 0.39


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.97 %
UnclassifiedrootN/A32.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10520951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300001867|JGI12627J18819_10052555All Organisms → cellular organisms → Bacteria → Acidobacteria1700Open in IMG/M
3300002245|JGIcombinedJ26739_100012381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia7020Open in IMG/M
3300002245|JGIcombinedJ26739_100196295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1909Open in IMG/M
3300002245|JGIcombinedJ26739_100878841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aurantimonadaceae → Jiella → unclassified Jiella → Jiella sp. CBK1P-4778Open in IMG/M
3300002908|JGI25382J43887_10146866All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300002911|JGI25390J43892_10013498All Organisms → cellular organisms → Bacteria → Acidobacteria1926Open in IMG/M
3300005167|Ga0066672_10451534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter839Open in IMG/M
3300005172|Ga0066683_10464806All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae774Open in IMG/M
3300005172|Ga0066683_10613319All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005186|Ga0066676_10386368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae942Open in IMG/M
3300005187|Ga0066675_11110723All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300005439|Ga0070711_100952290Not Available735Open in IMG/M
3300005445|Ga0070708_100123188All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2393Open in IMG/M
3300005445|Ga0070708_100297578All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1519Open in IMG/M
3300005468|Ga0070707_101677220Not Available603Open in IMG/M
3300005518|Ga0070699_100172572All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1916Open in IMG/M
3300005518|Ga0070699_100606054All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300005518|Ga0070699_101166970Not Available706Open in IMG/M
3300005529|Ga0070741_10015170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter13133Open in IMG/M
3300005529|Ga0070741_10547582Not Available1040Open in IMG/M
3300005536|Ga0070697_100150424All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1962Open in IMG/M
3300005536|Ga0070697_100628732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium945Open in IMG/M
3300005538|Ga0070731_10153176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1530Open in IMG/M
3300005538|Ga0070731_10355535All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300005540|Ga0066697_10285932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae972Open in IMG/M
3300005547|Ga0070693_100757227Not Available716Open in IMG/M
3300005548|Ga0070665_100135277All Organisms → cellular organisms → Bacteria2466Open in IMG/M
3300005552|Ga0066701_10483862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter768Open in IMG/M
3300005554|Ga0066661_10004681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter6284Open in IMG/M
3300005554|Ga0066661_10005957All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5738Open in IMG/M
3300005554|Ga0066661_10017918All Organisms → cellular organisms → Bacteria3705Open in IMG/M
3300005554|Ga0066661_10165175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1360Open in IMG/M
3300005561|Ga0066699_10477157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter892Open in IMG/M
3300005568|Ga0066703_10346744All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae893Open in IMG/M
3300005575|Ga0066702_10341957All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300005575|Ga0066702_10880078Not Available534Open in IMG/M
3300005598|Ga0066706_11166616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter586Open in IMG/M
3300005718|Ga0068866_11305017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300005764|Ga0066903_104819978All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300005764|Ga0066903_108783374Not Available513Open in IMG/M
3300005921|Ga0070766_10133662All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300005944|Ga0066788_10057023All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300005983|Ga0081540_1054544All Organisms → cellular organisms → Bacteria → Acidobacteria1953Open in IMG/M
3300006028|Ga0070717_10035281All Organisms → cellular organisms → Bacteria4048Open in IMG/M
3300006028|Ga0070717_11401394Not Available635Open in IMG/M
3300006034|Ga0066656_10076220All Organisms → cellular organisms → Bacteria → Acidobacteria1993Open in IMG/M
3300006046|Ga0066652_101691064Not Available577Open in IMG/M
3300006047|Ga0075024_100710016Not Available553Open in IMG/M
3300006050|Ga0075028_100005408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4968Open in IMG/M
3300006052|Ga0075029_100039642Not Available2699Open in IMG/M
3300006052|Ga0075029_100167950All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300006059|Ga0075017_100896225Not Available688Open in IMG/M
3300006173|Ga0070716_101227358Not Available603Open in IMG/M
3300006354|Ga0075021_10160244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1363Open in IMG/M
3300006791|Ga0066653_10712502Not Available520Open in IMG/M
3300006800|Ga0066660_10888466All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300006804|Ga0079221_10546234Not Available766Open in IMG/M
3300006854|Ga0075425_102274992Not Available603Open in IMG/M
3300006871|Ga0075434_100168056All Organisms → cellular organisms → Bacteria2213Open in IMG/M
3300006893|Ga0073928_11130262Not Available530Open in IMG/M
3300006893|Ga0073928_11130651All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300007265|Ga0099794_10442247All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300007788|Ga0099795_10176111All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
3300009038|Ga0099829_10035481All Organisms → cellular organisms → Bacteria3594Open in IMG/M
3300009038|Ga0099829_10083156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172456Open in IMG/M
3300009038|Ga0099829_10206668Not Available1590Open in IMG/M
3300009038|Ga0099829_10390496All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1149Open in IMG/M
3300009038|Ga0099829_10518593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium990Open in IMG/M
3300009038|Ga0099829_10607687All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300009038|Ga0099829_10611268Not Available906Open in IMG/M
3300009038|Ga0099829_10621787Not Available898Open in IMG/M
3300009038|Ga0099829_10853178Not Available756Open in IMG/M
3300009038|Ga0099829_10888131Not Available740Open in IMG/M
3300009038|Ga0099829_11073353All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300009038|Ga0099829_11628577Not Available532Open in IMG/M
3300009088|Ga0099830_10062286All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2674Open in IMG/M
3300009088|Ga0099830_10171302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1683Open in IMG/M
3300009088|Ga0099830_10183289All Organisms → cellular organisms → Bacteria1630Open in IMG/M
3300009088|Ga0099830_10318446Not Available1245Open in IMG/M
3300009089|Ga0099828_10162276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1980Open in IMG/M
3300009089|Ga0099828_10276911Not Available1507Open in IMG/M
3300009089|Ga0099828_11306177All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009089|Ga0099828_11790577Not Available539Open in IMG/M
3300009090|Ga0099827_10195486Not Available1680Open in IMG/M
3300009092|Ga0105250_10564713Not Available523Open in IMG/M
3300009101|Ga0105247_10018504All Organisms → cellular organisms → Bacteria4178Open in IMG/M
3300009162|Ga0075423_12677351All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300009176|Ga0105242_11082853Not Available814Open in IMG/M
3300009616|Ga0116111_1038136All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300010047|Ga0126382_12479363Not Available505Open in IMG/M
3300010329|Ga0134111_10469006Not Available548Open in IMG/M
3300010339|Ga0074046_10151181All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300010358|Ga0126370_11565630Not Available629Open in IMG/M
3300010359|Ga0126376_11437960Not Available716Open in IMG/M
3300010360|Ga0126372_11031781All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium836Open in IMG/M
3300010366|Ga0126379_12927288All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300010858|Ga0126345_1196696All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300010861|Ga0126349_1084721Not Available532Open in IMG/M
3300011120|Ga0150983_11218620All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300011120|Ga0150983_11425493Not Available704Open in IMG/M
3300011120|Ga0150983_12808976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae796Open in IMG/M
3300011120|Ga0150983_14446657Not Available574Open in IMG/M
3300011269|Ga0137392_10479574Not Available1033Open in IMG/M
3300011269|Ga0137392_11517221Not Available529Open in IMG/M
3300011270|Ga0137391_10665885Not Available867Open in IMG/M
3300011271|Ga0137393_11278409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300011444|Ga0137463_1042940Not Available1676Open in IMG/M
3300012096|Ga0137389_10115829Not Available2152Open in IMG/M
3300012096|Ga0137389_11255382Not Available634Open in IMG/M
3300012189|Ga0137388_10386155Not Available1295Open in IMG/M
3300012189|Ga0137388_10671621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium962Open in IMG/M
3300012189|Ga0137388_11088254Not Available736Open in IMG/M
3300012198|Ga0137364_10903143Not Available668Open in IMG/M
3300012198|Ga0137364_11308607All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300012200|Ga0137382_10560610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2814Open in IMG/M
3300012200|Ga0137382_10793053All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300012200|Ga0137382_10996573Not Available601Open in IMG/M
3300012202|Ga0137363_10454113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1072Open in IMG/M
3300012203|Ga0137399_10483762All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300012203|Ga0137399_11525290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300012205|Ga0137362_10853921Not Available779Open in IMG/M
3300012207|Ga0137381_10100208All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2456Open in IMG/M
3300012285|Ga0137370_10328077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium918Open in IMG/M
3300012356|Ga0137371_10909520All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300012359|Ga0137385_10059980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3391Open in IMG/M
3300012362|Ga0137361_11220502All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300012362|Ga0137361_11697448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300012363|Ga0137390_10279883All Organisms → cellular organisms → Bacteria1652Open in IMG/M
3300012469|Ga0150984_121703878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300012683|Ga0137398_10401847All Organisms → cellular organisms → Bacteria → Acidobacteria933Open in IMG/M
3300012917|Ga0137395_10529507All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300012918|Ga0137396_10549471All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300012922|Ga0137394_10193270All Organisms → cellular organisms → Bacteria → Acidobacteria1737Open in IMG/M
3300012923|Ga0137359_10511566Not Available1059Open in IMG/M
3300012930|Ga0137407_10107769All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium2400Open in IMG/M
3300012941|Ga0162652_100036518Not Available758Open in IMG/M
3300012957|Ga0164303_10627294Not Available712Open in IMG/M
3300012980|Ga0168315_111902All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300014968|Ga0157379_10388269All Organisms → cellular organisms → Bacteria → Acidobacteria1282Open in IMG/M
3300014969|Ga0157376_12721916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae534Open in IMG/M
3300015264|Ga0137403_11337046Not Available563Open in IMG/M
3300015371|Ga0132258_10014352All Organisms → cellular organisms → Bacteria16844Open in IMG/M
3300015373|Ga0132257_102187210Not Available716Open in IMG/M
3300017823|Ga0187818_10024301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2594Open in IMG/M
3300017823|Ga0187818_10035175Not Available2151Open in IMG/M
3300017823|Ga0187818_10115219All Organisms → cellular organisms → Bacteria → Acidobacteria1164Open in IMG/M
3300017934|Ga0187803_10231793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300017966|Ga0187776_10224313All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1191Open in IMG/M
3300018027|Ga0184605_10094609All Organisms → cellular organisms → Bacteria → Acidobacteria1315Open in IMG/M
3300018060|Ga0187765_11290484Not Available516Open in IMG/M
3300018431|Ga0066655_10048568All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2175Open in IMG/M
3300018431|Ga0066655_10069292All Organisms → cellular organisms → Bacteria → Acidobacteria1885Open in IMG/M
3300018431|Ga0066655_10780458Not Available649Open in IMG/M
3300018433|Ga0066667_11790326All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300018468|Ga0066662_10029911All Organisms → cellular organisms → Bacteria3215Open in IMG/M
3300018468|Ga0066662_11712356Not Available657Open in IMG/M
3300018468|Ga0066662_12416481All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300019361|Ga0173482_10310762Not Available698Open in IMG/M
3300019877|Ga0193722_1112406All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300019879|Ga0193723_1034457All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300019879|Ga0193723_1052674All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300020002|Ga0193730_1023707All Organisms → cellular organisms → Bacteria1774Open in IMG/M
3300020004|Ga0193755_1003195All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5198Open in IMG/M
3300020004|Ga0193755_1018448All Organisms → cellular organisms → Bacteria → Acidobacteria2301Open in IMG/M
3300020004|Ga0193755_1025335Not Available1965Open in IMG/M
3300020006|Ga0193735_1106501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium776Open in IMG/M
3300020199|Ga0179592_10323735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300020579|Ga0210407_10027870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4201Open in IMG/M
3300020580|Ga0210403_10768936All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300020581|Ga0210399_10801386All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300020583|Ga0210401_10061071All Organisms → cellular organisms → Bacteria3550Open in IMG/M
3300020583|Ga0210401_10065752All Organisms → cellular organisms → Bacteria3415Open in IMG/M
3300020583|Ga0210401_10345137Not Available1350Open in IMG/M
3300021086|Ga0179596_10593611Not Available562Open in IMG/M
3300021178|Ga0210408_10025792All Organisms → cellular organisms → Bacteria → Acidobacteria4667Open in IMG/M
3300021344|Ga0193719_10158242All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300021407|Ga0210383_10957356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae728Open in IMG/M
3300021407|Ga0210383_10984583Not Available716Open in IMG/M
3300021432|Ga0210384_10013768All Organisms → cellular organisms → Bacteria8047Open in IMG/M
3300021559|Ga0210409_10167357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2010Open in IMG/M
3300021861|Ga0213853_10600761Not Available536Open in IMG/M
3300025885|Ga0207653_10190559Not Available770Open in IMG/M
3300025898|Ga0207692_10721814Not Available648Open in IMG/M
3300025905|Ga0207685_10611668All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300025906|Ga0207699_10676189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae755Open in IMG/M
3300025920|Ga0207649_11524603Not Available529Open in IMG/M
3300025922|Ga0207646_10023610All Organisms → cellular organisms → Bacteria → Proteobacteria5647Open in IMG/M
3300025922|Ga0207646_11488397Not Available587Open in IMG/M
3300025945|Ga0207679_10351498All Organisms → Viruses → Predicted Viral1285Open in IMG/M
3300026297|Ga0209237_1236167All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300026300|Ga0209027_1196792All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300026312|Ga0209153_1013619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2596Open in IMG/M
3300026328|Ga0209802_1014778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4449Open in IMG/M
3300026328|Ga0209802_1194206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium790Open in IMG/M
3300026360|Ga0257173_1006434Not Available1242Open in IMG/M
3300026529|Ga0209806_1308730Not Available531Open in IMG/M
3300026552|Ga0209577_10047366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3647Open in IMG/M
3300026557|Ga0179587_10063645Not Available2156Open in IMG/M
3300027565|Ga0209219_1153002Not Available554Open in IMG/M
3300027603|Ga0209331_1111778All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300027645|Ga0209117_1090038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300027651|Ga0209217_1148175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300027654|Ga0209799_1123126All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300027667|Ga0209009_1092899All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300027846|Ga0209180_10417600All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300027854|Ga0209517_10030912All Organisms → cellular organisms → Bacteria → Acidobacteria4495Open in IMG/M
3300027862|Ga0209701_10071342All Organisms → cellular organisms → Bacteria → Proteobacteria2198Open in IMG/M
3300027862|Ga0209701_10142045Not Available1471Open in IMG/M
3300027862|Ga0209701_10638029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300027869|Ga0209579_10171065All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1161Open in IMG/M
3300027882|Ga0209590_10132372All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1528Open in IMG/M
3300027894|Ga0209068_10049568All Organisms → cellular organisms → Bacteria → Acidobacteria2128Open in IMG/M
3300027894|Ga0209068_10076355All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1738Open in IMG/M
3300027911|Ga0209698_10023331All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5807Open in IMG/M
3300027911|Ga0209698_10763818Not Available732Open in IMG/M
3300027915|Ga0209069_10083789All Organisms → cellular organisms → Bacteria1525Open in IMG/M
3300030974|Ga0075371_10848232All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300031231|Ga0170824_118810566Not Available711Open in IMG/M
3300031469|Ga0170819_12975114Not Available520Open in IMG/M
3300031474|Ga0170818_102326636All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300031720|Ga0307469_10115605All Organisms → cellular organisms → Bacteria → Acidobacteria1926Open in IMG/M
3300031720|Ga0307469_10571064All Organisms → cellular organisms → Bacteria → Acidobacteria1005Open in IMG/M
3300031720|Ga0307469_10633419All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300031720|Ga0307469_10984974Not Available786Open in IMG/M
3300031720|Ga0307469_11005404All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300031740|Ga0307468_101591741Not Available610Open in IMG/M
3300031820|Ga0307473_10273746All Organisms → cellular organisms → Bacteria → Acidobacteria1048Open in IMG/M
3300031820|Ga0307473_10634680Not Available742Open in IMG/M
3300031938|Ga0308175_100159104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2176Open in IMG/M
3300031954|Ga0306926_11516233All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300031962|Ga0307479_10040289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4485Open in IMG/M
3300031962|Ga0307479_10241763All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300032180|Ga0307471_100064089All Organisms → cellular organisms → Bacteria → Acidobacteria3126Open in IMG/M
3300032180|Ga0307471_100135435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2332Open in IMG/M
3300032180|Ga0307471_100462009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1411Open in IMG/M
3300032180|Ga0307471_100482108Not Available1385Open in IMG/M
3300032180|Ga0307471_100605097Not Available1255Open in IMG/M
3300032180|Ga0307471_102021921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300032180|Ga0307471_103280932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300032205|Ga0307472_100101386Not Available1981Open in IMG/M
3300032205|Ga0307472_100610557All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300032770|Ga0335085_11792859Not Available629Open in IMG/M
3300032783|Ga0335079_10179964All Organisms → cellular organisms → Bacteria2356Open in IMG/M
3300032829|Ga0335070_10000286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae58919Open in IMG/M
3300032829|Ga0335070_10010122All Organisms → cellular organisms → Bacteria11029Open in IMG/M
3300032829|Ga0335070_10081813All Organisms → cellular organisms → Bacteria → Acidobacteria3433Open in IMG/M
3300032829|Ga0335070_10345107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1434Open in IMG/M
3300033004|Ga0335084_10549927All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300033004|Ga0335084_11013374All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300033004|Ga0335084_11255632All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae739Open in IMG/M
3300033004|Ga0335084_12149621All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300033158|Ga0335077_10363889All Organisms → cellular organisms → Bacteria → Acidobacteria1564Open in IMG/M
3300033433|Ga0326726_11168312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium748Open in IMG/M
3300033513|Ga0316628_101951375Not Available780Open in IMG/M
3300033806|Ga0314865_119801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium695Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil24.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.42%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.69%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.30%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.95%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.95%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.56%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.17%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.17%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.78%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.39%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.39%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.39%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.39%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.39%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.39%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.39%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.39%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.39%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.39%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.39%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.39%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.39%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.39%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012980Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCW15EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026360Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-BEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027603Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033806Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1052095123300001593Forest SoilESGVMDAKYNYIIDSVKWRIVLNLAGFGLWLAASVVLLRLT*
JGI12627J18819_1005255533300001867Forest SoilMDAKYNYIIDSMKWRIALNLAGFAVWLVASVVLLRAAA*
JGIcombinedJ26739_10001238163300002245Forest SoilMDAKYNYIIDXMKWRIVLNLAGFGLWLAASVVLLRLT*
JGIcombinedJ26739_10019629533300002245Forest SoilMDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLTTL*
JGIcombinedJ26739_10087884113300002245Forest SoilMDAKYNYIIDSMKWRIMLNVAGFGLWLAASVVLLRLTF*
JGI25382J43887_1014686613300002908Grasslands SoilVMDAKYNYIIDSMTWRIALNLAGFAAWLAAAVALLRAAA*
JGI25390J43892_1001349833300002911Grasslands SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFSLLNVAVR*
Ga0066672_1045153423300005167SoilMDAKYNYIIDSMKWRIGLNMAGFALWLITALALLKVAVR*
Ga0066683_1046480623300005172SoilRWIMDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS*
Ga0066683_1061331913300005172SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKAAVR*
Ga0066676_1038636813300005186SoilVMDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS*
Ga0066675_1111072323300005187SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAVR*
Ga0070711_10095229023300005439Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSMKWRIVLNLAGFGLWLATGVVMLRLTSGNALIAT
Ga0070708_10012318823300005445Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSMKWRIALNMAGFTLWLVTALALLKVAVR*
Ga0070708_10029757853300005445Corn, Switchgrass And Miscanthus RhizosphereWVMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLHLA*
Ga0070707_10167722023300005468Corn, Switchgrass And Miscanthus RhizosphereWVMDAKYNYIIDSMKWRIMLNLVAFGLWLAASVVLLRLAGS*
Ga0070699_10017257213300005518Corn, Switchgrass And Miscanthus RhizosphereIKKRGEWVMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVALLHLA*
Ga0070699_10060605433300005518Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSMKWRIALNMAGFALWLVTALALLKVAVR*
Ga0070699_10116697013300005518Corn, Switchgrass And Miscanthus RhizosphereIKKRGEWVMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLHLA*
Ga0070741_1001517053300005529Surface SoilMDAKYNYIIDSVKWRVALNLAGFALWLAASLALLRAAA*
Ga0070741_1054758213300005529Surface SoilMDAKYNYIMVSAKWRIALNIAGFALWFAVAVGLLAA
Ga0070697_10015042423300005536Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFALLKVAVR*
Ga0070697_10062873213300005536Corn, Switchgrass And Miscanthus RhizosphereRGEWVMDAKYNYIIDSMKWRIMLNLGAFGLWLAASLVLLRLA*
Ga0070731_1015317623300005538Surface SoilMDAKYNYIIDSIKWRIALNLAGFGLWLATSVVLLRLT*
Ga0070731_1035553523300005538Surface SoilMDAKYNFIIDSITWRIALNLAGFGVWLAISLALIKVAA*
Ga0066697_1028593223300005540SoilMDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS*
Ga0070693_10075722713300005547Corn, Switchgrass And Miscanthus RhizosphereGLAVQFGNEESGVMDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLRLT*
Ga0070665_10013527743300005548Switchgrass RhizosphereMDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLRLT*
Ga0066701_1048386223300005552SoilMDAKYNYIIDSMKWRIALNVVGFGVWLAVAVGLLRAAA*
Ga0066661_1000468123300005554SoilMDAKYNYIIDSVKWRIALNVTGFAAWVAAAFVLLKTAG*
Ga0066661_1000595723300005554SoilMDAKYNYIIDSVKWRLVLNVSGFAVWLAAAFVLLKTAG*
Ga0066661_1001791823300005554SoilMDAKYNYIIDSMKWRIALNLAGFAVWLAVSVALLRAAA*
Ga0066661_1016517513300005554SoilTTGEWVMDAKYNYIIDSMKWRIGLNMAGFALWLITALALLKVAVR*
Ga0066699_1047715713300005561SoilMEAKYNYIMDSMKWRIGLNLAGFAVWIVAAVALLKAGA*
Ga0066703_1034674413300005568SoilMDAKYNYIIDSMKWRIALNLAGFAVWLAASVALLRAVA*
Ga0066702_1034195723300005575SoilMDAKYNYIIDSMKWRIALNLAGFAVWLAASVALLRAAA*
Ga0066702_1088007823300005575SoilMDSKYNHIIDSMKWRIALNMAGFALWLVTAFALLKVAAR*
Ga0066706_1116661623300005598SoilRWLMDAKYNYIIDSVKWRIALNVTGFAAWVAAAFVLLKTAG*
Ga0068866_1130501713300005718Miscanthus RhizosphereMDAKYNYIIDSMKWRIVLNLAGFVLWLATGVVMLRLT*
Ga0066903_10481997823300005764Tropical Forest SoilMDAKYNYIIDSMKWRILLNVTGFAVWLAVSAALLKAA
Ga0066903_10878337423300005764Tropical Forest SoilMDAKYNYIIDSIKWRIVLNLAGFGLWLAASVALLRLT*
Ga0070766_1013366213300005921SoilMDAKYNYIIDSMKWRIGLNLAGFSLWLATTVVLLRLT*
Ga0066788_1005702313300005944SoilVPSNERAKESVMDAKYNFIIDSWKWRIALNVAGFAVWLTAVVGLIKLAA*
Ga0081540_105454443300005983Tabebuia Heterophylla RhizosphereMDAKYNYVIDSMKWRIVLNLAGFGLWLAASVALLRLI*
Ga0070717_1003528153300006028Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSMKWRIMLNLVAFGLWLAASVVLLRLAGS*
Ga0070717_1140139423300006028Corn, Switchgrass And Miscanthus RhizosphereVDAKYNYIIDSMKWRIMLNLAGFGLWLAAVVVLLRLTF*
Ga0066656_1007622013300006034SoilMDAKYNYIIDSMRWRIVLNLAGFGLWLAASVVLLRLT*
Ga0066652_10169106423300006046SoilMDSKYNHIIDSMKWRIALNMAGFTLWLVTAFALLKVAVR*
Ga0075024_10071001613300006047WatershedsMDAKYNYIIDSMKWRIVLNLAGFGLWLAAGVFLLRLT*
Ga0075028_10000540833300006050WatershedsMDAKWNGFIDSMGWRIVLNLAGFVVWLAATVGILWVSV*
Ga0075029_10003964223300006052WatershedsMGAKYNYIIDSVTWRVGLNLAGFALWLATVVVLLAAAYL*
Ga0075029_10016795033300006052WatershedsMDAKYNYIIDSMNWRIALNVAGFAVWLALGLALLRVAGA*
Ga0075017_10089622523300006059WatershedsMDAKYNYIIDSMQWRIALNVAGFALWLALGLALLRIAGA*
Ga0070716_10122735813300006173Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSVKWRIALNMAGFTLWLVSALALLKVAVR*
Ga0075021_1016024423300006354WatershedsMDAKHNYIIDSMKWRIGLNLAGFGLWLATAVVLLRLT*
Ga0066653_1071250213300006791SoilMDAKYNYIIDSIKWRIALNMAGFTLWLVTAFTLLKVAGR*
Ga0066660_1088846613300006800SoilDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRLAS*
Ga0079221_1054623423300006804Agricultural SoilMDARYNYIIDSMSWRIVLNVTGFSLWLAASMALLRLT*
Ga0075425_10227499213300006854Populus RhizosphereMDAKYNYIIDSMKWRIMLNLAGFGLWLATSVVLLRLT*
Ga0075434_10016805633300006871Populus RhizosphereMDAKYNYIIDSMKWRIVLNLAGFSLWLAATVVLLRLT*
Ga0073928_1113026223300006893Iron-Sulfur Acid SpringMDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLT*
Ga0073928_1113065113300006893Iron-Sulfur Acid SpringMDAKYNYIIDSVKWRIVLNLAGFGLWLGASLVLLRLT*
Ga0099794_1044224713300007265Vadose Zone SoilGEWVMDAKYNYIIDSMKWRIGLNMAGFALWLITALALLKVAVR*
Ga0099795_1017611113300007788Vadose Zone SoilMDAKYNYIIDSMKWRIGLNLAGFGLWLATAVVLLRLT*
Ga0099829_1003548133300009038Vadose Zone SoilMDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT*
Ga0099829_1008315653300009038Vadose Zone SoilVDAKYNYIIDSMKWRIVLNLAGFGLWLAASAVLLRLTTL*
Ga0099829_1020666823300009038Vadose Zone SoilMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLQLAAVD*
Ga0099829_1039049623300009038Vadose Zone SoilMDAKYNYIIDSMKWRIGLNLAGFGLWLATTVVLLRLT*
Ga0099829_1051859313300009038Vadose Zone SoilERWIMDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS*
Ga0099829_1060768723300009038Vadose Zone SoilDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT*
Ga0099829_1061126813300009038Vadose Zone SoilMDAKYNYIIDSMRWRIGLNLAGFGLWLATAVVLLRLT*
Ga0099829_1062178713300009038Vadose Zone SoilVDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLTTL*
Ga0099829_1085317813300009038Vadose Zone SoilMDAKYNYVIDSMKWRIMLNLGVFGLWLAASVVLLRLA*
Ga0099829_1088813123300009038Vadose Zone SoilMDAKYNYIIDSMKWRIMLNLAGFSLWLAASVALLLAAGSFS*
Ga0099829_1107335323300009038Vadose Zone SoilMDAKYNYIIDSMTWRIALNLAGFAAWLAAAVALLRAAA*
Ga0099829_1162857713300009038Vadose Zone SoilMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVILLHLA*
Ga0099830_1006228653300009088Vadose Zone SoilVDAKYNYIIDSTKWRIVLNLAGFGLWLAASAVLLRLTTL*
Ga0099830_1017130223300009088Vadose Zone SoilMDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT*
Ga0099830_1018328923300009088Vadose Zone SoilMDAKYNYIIDSMKWRIALNLVGFAVWLATAVALLRA*
Ga0099830_1031844623300009088Vadose Zone SoilMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLRLA*
Ga0099828_1016227633300009089Vadose Zone SoilMDAKYNYIVDSMKWRIMLNLGVFGLWLAASVILLHLA*
Ga0099828_1027691133300009089Vadose Zone SoilMDAKYNYIIDSMKWRIMLNLGAFGLWLAASLVLLRLA*
Ga0099828_1130617723300009089Vadose Zone SoilVDAKYNYIIDSTKWRIMLNVAGFGLWLAASVVLLRLTTL*
Ga0099828_1179057723300009089Vadose Zone SoilMDAKYNYIIDSMTWRIVLNLGVFGLWLAASVVLLHLA*
Ga0099827_1019548613300009090Vadose Zone SoilEWVMDAKYNYIIDSMTWRIALNLAGFAAWLAAAVALLRAAA*
Ga0105250_1056471313300009092Switchgrass RhizosphereMDAKYNYIIDSMKWRIVLNLAGFALWLATGVVMLRLT*
Ga0105247_1001850433300009101Switchgrass RhizosphereMDAKYNYIIDSMKWRIGINLAGFGLWLATSVVLLRLT*
Ga0075423_1267735113300009162Populus RhizosphereEWVMDAKYNHIIDSMKWRIALNMAGFALWLVTALELLKVAVR*
Ga0105242_1108285313300009176Miscanthus RhizosphereMDAKYNYIIDSMKWRIVMNLAGFGLWLAASMVLLRLT*
Ga0116111_103813633300009616PeatlandMDAKYNYIIDSVTWRIGLNLAGFALWLAAIAGLLAAVQL*
Ga0126382_1247936313300010047Tropical Forest SoilMDAKYNYIIDSMKWRIVLNLAAFGLWLATSVALLRVT*
Ga0134111_1046900613300010329Grasslands SoilMDAKYNYIIDSMRWRIILNVVGFFLWLAASAALLRLAT*
Ga0074046_1015118123300010339Bog Forest SoilMSAKYNYIIDSMKWRVWLNLVGFALWLAAVVGLFAAAEL*
Ga0126370_1156563013300010358Tropical Forest SoilMDAKYNYIIDSIPWRIILNLVGFGLWLAASAALLHLAS*
Ga0126376_1143796013300010359Tropical Forest SoilMDAKYNYIIDSMKWRIVLNLAGFGLWLVASVTLLRLT*
Ga0126372_1103178113300010360Tropical Forest SoilKRWVMDAKYNYIIDSIPWRIILNLVGFGLWLAASAALLHLAS*
Ga0126379_1292728813300010366Tropical Forest SoilMDAKYNYIIDSMKWRIALNLAGFSLWLATAIVLMK
Ga0126345_119669623300010858Boreal Forest SoilAKYNYIIDSMKWRILLNLAGFGVWLATSIVLLRLT*
Ga0126349_108472113300010861Boreal Forest SoilMDAKYNYIIDSMKWRVMLNLAGFGLWLAASVVLLRLTTL*
Ga0150983_1121862013300011120Forest SoilMDAKYNYIIDSMKWRIMLNLAGFGLWLATSVALLRLT*
Ga0150983_1142549323300011120Forest SoilAKYNYIIDSMKWRITLNLAGFGLWLAAVVVLLRLTF*
Ga0150983_1280897623300011120Forest SoilMDAKYNNIIDSMKWRIVLNLTGFGLWLAASVVLLRLT*
Ga0150983_1444665713300011120Forest SoilMDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLLTF*
Ga0137392_1047957413300011269Vadose Zone SoilVDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT*
Ga0137392_1151722113300011269Vadose Zone SoilVDAKYNYIIDSMKWRVMLNLAGFGLWLAASVVLLRLTTL*
Ga0137391_1066588513300011270Vadose Zone SoilMDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVFLRLT*
Ga0137393_1127840923300011271Vadose Zone SoilVDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT*
Ga0137463_104294023300011444SoilMVMDAKYNYIIDSMKWRIALNLAGFAVWLAVTVALFKAAT*
Ga0137389_1011582933300012096Vadose Zone SoilMDARYNYIIDSMKWRIMLNLGAFGLWLAASLVLLRLA*
Ga0137389_1125538223300012096Vadose Zone SoilMDAEYNYIIDSMKWRIMLNLGVFGLWLAASVILLHLA*
Ga0137388_1038615513300012189Vadose Zone SoilMDAKYNYIIDSMKWRIMLNLGGFGLWLAASVVLLRLA*
Ga0137388_1067162113300012189Vadose Zone SoilKYNYIIDSMRWRIGLNLAGFGLWLATAVVLLRLT*
Ga0137388_1108825413300012189Vadose Zone SoilMDAKYNYIIDSMKWRIMLNVAVFGLWLAASVALLLLS*
Ga0137364_1090314313300012198Vadose Zone SoilMDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRLAS*
Ga0137364_1130860713300012198Vadose Zone SoilMDAKYNYIIDSVKWRIGLNMAGFTLWLVTAIALLNVAAR*
Ga0137382_1056061013300012200Vadose Zone SoilMDAKYNYIMDSIKWRIGLNMAGFALWLVTAFALLKVAV
Ga0137382_1079305323300012200Vadose Zone SoilDSKYNHIIDSMKWRIALNMAGFTLWLVTAFALLKVAVR*
Ga0137382_1099657313300012200Vadose Zone SoilMDAKYNHIIDSMKWRIALNMAGFTLWLVTALALLKVAVR*
Ga0137363_1045411313300012202Vadose Zone SoilMDARYNYIIDSMKWRIALNLTGFGLWLVASVVLLRLT*
Ga0137399_1048376223300012203Vadose Zone SoilMDAKYNYIIDSMKWRIGLNMAGFTLWLVTAFALLKAAGR*
Ga0137399_1152529023300012203Vadose Zone SoilMDAKYNYIMDSIKWRIGLNMAGFALWLVTAFALLKVAVR*
Ga0137362_1085392123300012205Vadose Zone SoilMDAKYNYIIDSVTWRIVLNLAGFGLWLAASVVLLRLT*
Ga0137381_1010020833300012207Vadose Zone SoilMDAKYNYIIDSMRWRIILNLVGLGLWLAASAALLRLAS*
Ga0137370_1032807723300012285Vadose Zone SoilMDSKYNHIIDSMKWRIALNMAGFTLWLVTALALLKVAVR
Ga0137371_1090952013300012356Vadose Zone SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFALLKAAVR*
Ga0137385_1005998023300012359Vadose Zone SoilMDAKYNYIIDSMRWRIILNVVGFGLWLATSAALLRLAS*
Ga0137361_1122050213300012362Vadose Zone SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAGR*
Ga0137361_1169744813300012362Vadose Zone SoilSGVMDARYNYIIDSMKWRIALNLTGFGLWLVASVVLLRLT*
Ga0137390_1027988313300012363Vadose Zone SoilMDAKYNHIIDSMKWRIGLNLAGFSLWLATTVVLLRLT*
Ga0150984_12170387833300012469Avena Fatua RhizosphereMDAKYNYIIDSMRWRIVLNLAGFGLWLAASVVLLQLT*
Ga0137398_1040184723300012683Vadose Zone SoilMDAKYNYIIDSVTWRIVLNLTGFGLWLAASVVLLRLT*
Ga0137395_1052950723300012917Vadose Zone SoilMDAKYNYIIDSMRWRIGLNLAGFGLWLATGVVLLRLT*
Ga0137396_1054947113300012918Vadose Zone SoilMDAKYNYIIDSMKWRIALNLAGFGLWLATAVVLLRLT*
Ga0137394_1019327033300012922Vadose Zone SoilMDAKYNYIIDSVKWRIALNMAGFTLWLVTAVALLNVAAR*
Ga0137359_1051156613300012923Vadose Zone SoilMDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRL
Ga0137407_1010776943300012930Vadose Zone SoilMDAKYNYIIDSIKWRIVLNLTGFGLWLAVSMVLLRLT*
Ga0162652_10003651823300012941SoilMDAKYNHIIDSMKWRIVLNLAGFGLWLAASMVLLRLT*
Ga0164303_1062729423300012957SoilMDAKYNYIIDSIKWRIALNMAGFTLWLVTAFTLLKVAAR*
Ga0168315_11190233300012980Weathered Mine TailingsVGWVMDAIYNYIIDSMNWRIALNVAGFAVWLALGLALLRVAGA*
Ga0157379_1038826913300014968Switchgrass RhizosphereMDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLR
Ga0157376_1272191613300014969Miscanthus RhizosphereKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT*
Ga0137403_1133704613300015264Vadose Zone SoilMDAKYNHIIDSMKWRIVLNLAGFGLWLATSVILLRLT*
Ga0132258_10014352123300015371Arabidopsis RhizosphereMDAKYNYIIDSMKWRIVLNLAGFSLWLGGTGVFLRLT*
Ga0132257_10218721013300015373Arabidopsis RhizosphereMDAKYNYIIDSMKWRIVMNLVGFGLWLAAGMALLRLT*
Ga0187818_1002430163300017823Freshwater SedimentMSAKYNYIIDSMKWRVWLNLVGFALWLAAVVGLFAAAEV
Ga0187818_1003517523300017823Freshwater SedimentYNYIIDSMKWRVWLNLVGFALWLAAVVGLFVAAEL
Ga0187818_1011521923300017823Freshwater SedimentMDAKYNYIIDSVAWRVAMNVAGFALWMAAVVGLLGTAA
Ga0187803_1023179313300017934Freshwater SedimentMDAKYNYIIDSMKWRIMLNLAGFGLWLGASLVLLRLTF
Ga0187776_1022431333300017966Tropical PeatlandMDAKYNYIIDSMKWRIALNLAGFSLWLATAIVLLRMAA
Ga0184605_1009460913300018027Groundwater SedimentMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAVR
Ga0187765_1129048423300018060Tropical PeatlandMDAKYNYIIDSMNWRIALNVAGFVVWLAAGLALLHVAGA
Ga0066655_1004856813300018431Grasslands SoilMDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRLAS
Ga0066655_1006929223300018431Grasslands SoilMDAKYNYIIDSMRWRIVLNLVGFGLWLAASVVLLRLT
Ga0066655_1078045813300018431Grasslands SoilMDAKYNYIIDSMRWRIILNLVGFGLWLAASAALLRLAS
Ga0066667_1179032613300018433Grasslands SoilTTGEWVMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFSLLNVAVR
Ga0066662_1002991123300018468Grasslands SoilMDAKYNYIIDSVKWRIALNVTGFAAWVAAAFVLLKTAG
Ga0066662_1171235623300018468Grasslands SoilMDAKYNYIIDSVKWRLVLNVSGFAVWLAAAFVLLKTAG
Ga0066662_1241648113300018468Grasslands SoilMDAKYNYIIDSMKWRIGLNMAGFALWLITALALLKVAVR
Ga0173482_1031076223300019361SoilMDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLRLT
Ga0193722_111240613300019877SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTALALLKVAVR
Ga0193723_103445713300019879SoilMDAKYNYIIDSMKWRIGLNLAGFGLWLATAVVLLRLT
Ga0193723_105267423300019879SoilMDSKYNYIIDSMKWRIALNMAGFTLWLVTAFSLLNVAVR
Ga0193730_102370723300020002SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAAR
Ga0193755_100319543300020004SoilMDAKYIIDSIKWRIALNMAGFTLWLATAFTLLKVAAR
Ga0193755_101844823300020004SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTALVLLKVAVR
Ga0193755_102533523300020004SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFSLLNVAVR
Ga0193735_110650123300020006SoilMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKAAVR
Ga0179592_1032373523300020199Vadose Zone SoilKVKRSEVMDAKYNYIIDSVTWRIVLNLTGFGLWLAASVVLLRLT
Ga0210407_1002787043300020579SoilMGAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT
Ga0210403_1076893613300020580SoilMDAKYNNIIDSMKWRIVLNLTGFGLWLAASVVLLRLT
Ga0210399_1080138623300020581SoilMDAKYNYIIDSMKWRIMLNLAGFGLWLATSVALLRLT
Ga0210401_1006107123300020583SoilMDAKYNYIIDSMKWRIGLNLAGFSLWLATTVVLLRLT
Ga0210401_1006575233300020583SoilMDAKYNYIIDSAKWRILLNLAGFGLWLAASVVLLRLT
Ga0210401_1034513723300020583SoilMDAKYNYIIDSMKWRIMLNLAGFGLWLAAIVVLLRLTF
Ga0179596_1059361123300021086Vadose Zone SoilMDAKYNYIIDSMKWRIVLNLAGFGLWLAASVVLLRLT
Ga0210408_1002579283300021178SoilMDAKYNYIIDSVKWRIILNLAGFGLWLAASVLLLR
Ga0193719_1015824213300021344SoilEWVMDAKYNYIIDSMKWRIALNMAGFTLWLVTAFTLLKVAVR
Ga0210383_1095735613300021407SoilDAKYNDIIDSMKWRIVLNLTGFGLWLAASVVLLRLT
Ga0210383_1098458313300021407SoilMDAKYNYIIDSIKWRIALNLAGFGLWLATSVALLRLT
Ga0210384_1001376813300021432SoilMDAKYNYIIDSMKWRIGLNLAGFILWLATTVALLRLT
Ga0210409_1016735723300021559SoilMDAKYNYYIDSMKWRIMLNLAGFGLWLAAMVVLLRLTF
Ga0213853_1060076113300021861WatershedsMGAKYNYIIDSVTWRVGLNLAGFALWLATVVVLLAAAYL
Ga0207653_1019055913300025885Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSMKWRIVLNLAGFALWLATGVVMLRLT
Ga0207692_1072181413300025898Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSMKWRIALNLAGFGLWLATSVVLLRLT
Ga0207685_1061166823300025905Corn, Switchgrass And Miscanthus RhizosphereMDARYNYIIDSMKWRIVLNLAGFGLWLATGVVMLRLT
Ga0207699_1067618923300025906Corn, Switchgrass And Miscanthus RhizosphereIMDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT
Ga0207649_1152460313300025920Corn RhizosphereQFGNEESGVMDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLRLT
Ga0207646_1002361023300025922Corn, Switchgrass And Miscanthus RhizosphereMDAKYNYIIDSMTWRIALNLAGFAAWLVAAVALLRAAA
Ga0207646_1148839723300025922Corn, Switchgrass And Miscanthus RhizosphereGGWVMDAKYNYIIDSMKWRIMLNLVAFGLWLAASVVLLRLAGS
Ga0207679_1035149833300025945Corn RhizosphereMDAKYNYIIDSMKWRIGINLAGFGLWLAAGMVLLR
Ga0209237_123616723300026297Grasslands SoilMDAKYNYIIDSMTWRIALNLAGFAAWLAAAVALLRAAA
Ga0209027_119679223300026300Grasslands SoilMDAKYNYIIDSIKWRIALNMAGFTLWLVTAFTLLK
Ga0209153_101361953300026312SoilMDAKYNYIIDSMRWRIVLNLAGFGLWLAASVVLLRLT
Ga0209802_101477853300026328SoilMDAKYNYIIDSMKWRIALNVVGFGVWLAVAVGLLRAAA
Ga0209802_119420623300026328SoilLDAKYNYIIDSMTWRIALNLAGFAAWLASALALLSAAA
Ga0257173_100643413300026360SoilMDAKYNYIIDSMKWRIVLNLAGFGLWLAASAVLLRLTTL
Ga0209806_130873013300026529SoilMDAKYNYIIDSMKWRIALNLAGFAVWLAASVALLRAVA
Ga0209577_1004736623300026552SoilMEAKYNYIMDSMKWRIGLNLAGFAVWIVAAVALLKAGA
Ga0179587_1006364523300026557Vadose Zone SoilMDAKYNYIIDSVTWRIVLNLTGFGLWLAASVVLLRLT
Ga0209219_115300223300027565Forest SoilMDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLT
Ga0209331_111177823300027603Forest SoilMDAKYNYIIDSMKWRIMLNLAGFGLWLAASVVLLRLTTL
Ga0209117_109003823300027645Forest SoilMDAKYNYIIDSVKWRIVLNLAGFGLWLAASVVLLRLT
Ga0209217_114817523300027651Forest SoilMDAKYNHIIDSMKWRIVLNLGGFGLWLAASAALLRGG
Ga0209799_112312623300027654Tropical Forest SoilSRKRRWVMDAKYNYIIDSMKWRIVLNLAGFGLWLVASVALLRLT
Ga0209009_109289923300027667Forest SoilMDAKYNYIIDSVKWRIVLNVAGFGLWLGASLVLLRLT
Ga0209180_1041760023300027846Vadose Zone SoilVDAKYNYIIDSMKWRIVLNLAGFGLWLAASAVLLRLTTL
Ga0209517_1003091253300027854Peatlands SoilMSAKYNYIIDSMKWRVWLNLVGFALWLAAVVGLFAAAEL
Ga0209701_1007134213300027862Vadose Zone SoilMDAKYNYIIDSMKWRIALNLVGFAVWLATAVALLRA
Ga0209701_1014204513300027862Vadose Zone SoilVVDAKYNYIIDSMKWRIVLNLAGFGLWLAASAVLLRLTTL
Ga0209701_1063802923300027862Vadose Zone SoilMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLRLA
Ga0209579_1017106523300027869Surface SoilMDAKYNYIIDSIKWRIALNLAGFGLWLATSVVLLRLT
Ga0209590_1013237233300027882Vadose Zone SoilERSVMDAKYNYIIDSMRWRIILNVVGFGLWLAASAALLRLAS
Ga0209068_1004956833300027894WatershedsMDAKWNGFIDSMGWRIVLNLAGFVVWLAATVGILWVSV
Ga0209068_1007635523300027894WatershedsMDAKHNYIIDSMKWRIGLNLAGFGLWLATAVVLLRLT
Ga0209698_1002333143300027911WatershedsMDAKYNYIIDSMNWRIALNVAGFAVWLALGLALLRVAGA
Ga0209698_1076381823300027911WatershedsMDAKYNYIIDSMQWRIALNVAGFALWLALGLALLRIAGA
Ga0209069_1008378923300027915WatershedsVDAKYNYIIDSMKWRIVLNLAGFGLWLAAGVFLLRLT
Ga0075371_1084823213300030974SoilVDAKYNYIIDSMKWRLILNLAGFGLWLAASMVLLRLTTL
Ga0170824_11881056623300031231Forest SoilMDAKYNYIIDSMKWRIVLNLAGFGLWMAASMVVLRLT
Ga0170819_1297511413300031469Forest SoilMDAKYNYIIDSMKWRIVLNLAGFSLWLAASVVLLRLT
Ga0170818_10232663623300031474Forest SoilAKYNYIIDSLKWRIVLNVAGFGLWLAASVVLLRLT
Ga0307469_1011560533300031720Hardwood Forest SoilMDAKYNYIIDSVKWRIALNMAGFTLWLVSALALLKVAVR
Ga0307469_1057106423300031720Hardwood Forest SoilMDAKYNHIIDSMKWRIALNMAGFALWLVTALALLKVAVR
Ga0307469_1063341913300031720Hardwood Forest SoilMDAKYNYIIDSIPWRIILNLVGFGLWLAASAALLHLAS
Ga0307469_1098497423300031720Hardwood Forest SoilMDAKYNYIIDSMKWRIILNLAAFGVWLATSVVLLRLT
Ga0307469_1100540423300031720Hardwood Forest SoilMDAKYNYIIDSIKWRIALNMAGFTLWLVTAFTLLKAAAR
Ga0307468_10159174123300031740Hardwood Forest SoilSGVMDAKYNYIIDSMKWRIVLNLAGFGLWLATSVVLLRLT
Ga0307473_1027374623300031820Hardwood Forest SoilMDAKYNYIIDSMKWRIALNLAGFAVWLVASVVLLRAAA
Ga0307473_1063468023300031820Hardwood Forest SoilMDAKYNYIIDSMKWRITLNLAGFGLWLAAVVVLLRLTF
Ga0308175_10015910423300031938SoilMDAKYNYIIDSMRWRIVLNLAGFGLWLAASVVLLQLT
Ga0306926_1151623323300031954SoilMDAKYNHIIDSMKWRIALNLTGFAVWLAVSWALIRIAA
Ga0307479_1004028953300031962Hardwood Forest SoilMDAKYNYIIDSMKWRIALNLAGFALWLVASVLLLRAAA
Ga0307479_1024176323300031962Hardwood Forest SoilMDAKYNHIIDSMKWRIVLNLAGFGLWLAATVVLLRLT
Ga0307471_10006408923300032180Hardwood Forest SoilVDAKYNYIIDSMKWRLILNLAGFGLWLAASVVLLRLTTL
Ga0307471_10013543523300032180Hardwood Forest SoilMDAKYNYIIDSMKWRIALNMAGFALWLVTALALLKVAVR
Ga0307471_10046200933300032180Hardwood Forest SoilMDAKYNYIIDSMKWRIMLNLAGFGLWLGASVLLLR
Ga0307471_10048210813300032180Hardwood Forest SoilEEFMDAKYNYIIDSMTWRIALNMAGFALWLAVSVALLRG
Ga0307471_10060509723300032180Hardwood Forest SoilMVMDAKYNFIIDSMKWRIALNLAGFAVWLAVTVALFKVAS
Ga0307471_10202192113300032180Hardwood Forest SoilMDAKYNYIIDSMKWRIVLNLAGFSLWLATSVVLLGLT
Ga0307471_10328093223300032180Hardwood Forest SoilMDAKYNYIIDSMKWRIMLNLGVFGLWLAASVVLLHLA
Ga0307472_10010138633300032205Hardwood Forest SoilEWVMDAKYNHIIDSMKWRIALNMAGFALWLVTALALLKVAVR
Ga0307472_10061055713300032205Hardwood Forest SoilMDAKYNYIIDSTPWRIILNLVGFGLWLAASAALLHLAS
Ga0335085_1179285913300032770SoilMGAKYNYIIDSVTWRIGLNLAGFALWLAAIAGLLAVAQL
Ga0335079_1017996423300032783SoilMDAKYNYIIDSMNWRIALNVAGFAIWLAAGLALLRVAGA
Ga0335070_10000286513300032829SoilMDAKYNHIIDSISWRIALNLAGFALWLTTAVVLLHLAA
Ga0335070_1001012283300032829SoilMGAKYNYIIDSMTWRVGLNLAGFALWLAAIAGLLAAVQL
Ga0335070_1008181323300032829SoilMDAKYNHIIDSMGWRIALNMAGFALWLATAITLLMAAA
Ga0335070_1034510723300032829SoilMDAKYNYIIDSMRWRIVLNLAGFGLWLATSVVLLRLT
Ga0335084_1054992723300033004SoilMVMDAKYNHIIDSISWRIGLNLAGFTLWLVTAAVLLRLAA
Ga0335084_1101337423300033004SoilMDAKYNHIIDSMSWRIALNLIGFALWLATAITLLGVAA
Ga0335084_1125563223300033004SoilMDAKYNYIIDSMTWRIALNLAGFSLWLAASYALLRLAA
Ga0335084_1214962123300033004SoilTVMDAKYNHIIDSMGWRIALNMAGFALWLATAITLLMAAA
Ga0335077_1036388923300033158SoilMDAKYNYIIDSMKWRIVLNLSGFALWLAASVALLRLTF
Ga0326726_1116831223300033433Peat SoilMDAKYNYIIDSMKWRIVLNLTGFAVWLAASVILLRLAS
Ga0316628_10195137513300033513SoilMGAKYNYIIDSVTWRIGLNLAGFALWLAAVAGLLAAVQL
Ga0314865_119801_326_4453300033806PeatlandMDARYNQFIDSFKWRIMLNLAGFSLWLGLSFALLAAGAH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.